3SF0A

Structure of recombinant haemophilus influenzae e(p4) acid phosphatase mutant d64n complexed with 5'amp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
247
structure length
247
Chain Sequence
EEHANMQLQQQAVLGLNWMQDSGEYKALAYQAYNAAKVAFDHAKVAKGKKKAVVANLDETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQSRAVPGAVEFNNYVNSHNGKVFYVTNRKDSTEKSGTIDDMKRLGFNGVEESAFYLKKDKSAKAARFAEIEKQGYEIVLYVGDNLDDFGNTVYGKLNADRRAFVDQNQGKFGKTFIMLPNANYGGWEGGLAEGYFKKDTQGQIKARLDAVQAWDGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein E
publication title Structural basis of the inhibition of class C acid phosphatases by adenosine 5'-phosphorothioate.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase/inhibitor
total genus 95
structure length 247
sequence length 247
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2011-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3sf0A00
3U13A 2G0AA 2G80A 3NANA 1RMYA 3EF1A 3L0CA 4O8CA 1RC8A 3NASA 1Z4IA 2YFYA 5AIAA 3ZTWA 5AW8A 3QU7A 2HI0A 3KDPA 4OD0A 4XOUA 2CN1A 4XQ0A 5ALPA 3WK7A 3ZX5A 2WF5A 3ZX4A 1MH9A 3OCVA 4HGQA 3QU4A 5ALOA 2MU1A 1ZD2P 2EARA 3B8EA 2HSZA 5AKJA 2EATA 3RFUA 3SKXA 1EK2A 3RF6A 3OPXA 3ZUPA 4BEVA 2AMYA 4FYPA 4IG4A 2R8XA 2QYHA 3QX7A 3MPOA 3L7YA 3W5AA 2YMQA 2FPRA 4L57A 4CE6A 3AR8A 3U26A 1RLMA 3HYCA 5ALHA 2RARA 4ZEVA 3MC1A 5AM1A 2IA5A 3QGMA 5JJBA 3NUQA 2G08A 3D6JA 4Y2VA 2HOQA 3N8GA 3M9LA 3QLEA 4C4SA 5AW1A 1EK1A 1ZD5A 2B8EA 2RBKA 2IOFA 3L1VA 2OM6A 4Y2YA 5ALVA 2P9JA 4HYTA 5A3QA 2FUEA 2B30A 4I9FA 3EPRA 2IOHA 4J2TA 2FI1A 1VFPA 5ALTA 4DCCA 1Z4PX 4UW9A 2GO7A 1CR6A 3ONNA 2WM8A 2C9MA 3N07A 1TJ3A 4FFDA 5AW5A 5A3SA 2BDEA 1XVIA 2W43A 3QYPA 4PNHA 5AKZA 5E0OA 2Q5EA 3L8FA 1RKVA 2PQ0A 5ALFA 4BX3A 2FPSA 1O08A 1TJ4A 2P69A 1Z4NA 3DV9A 3WKCA 2JAOA 2Q4TA 4UU0A 2HEGA 1ZS9A 5AKXA 4YIHA 3U7GA 2FPUA 2G07A 5AHXA 4XE5A 4ZEXA 3DDHA 2R8YA 5ALKA 3AR3A 3KD3A 3ZTYA 1RMTA 3QUCA 5AW6A 2OYCA 3EF0A 4QQFA 2CFSA 4RESA 4C4TA 4Y2PA 4MWOA 4UAVA 1SWWA 3L5KA 3QUTA 1YS9A 3UM9A 3QUQA 4F71A 2Q4RA 2C8LA 3W5CA 2OA0A 2GMWA 4DFDA 3ET5A 2FEAA 3L0BA 3UMGA 4KNWA 3B9BA 1WPGA 4JDPA 2G06A 2B0CA 4NAVA 3ESRA 1YMQA 3KC2A 5IS2A 5A3RA 2ZOSA 2O2XA 3A1CA 2YJ6A 3P96A 2YN4A 4KX3A 1FEZA 1WR8A 2HHLA 3BWVA 3OCYA 3ZW7A 3AR2A 3CNHA 5AM5A 5AW0A 4H1WA 4HGPA 3U19A 4L6CA 1ZOLA 1Z4MA 5AKLA 1RKUA 3WKBA 5T41A 5AI0A 3WKDA 3ZU6A 2B1QA 1Z5GA 3OCUA 4CF4A 1Z4LA 4CF3A 4B6JA 4OCZA 3DNPA 3I6BA 3FPSA 4JB3A 3FPBA 5AW2A 1IWOA 3WKEA 2YMLA 2GHTA 4Y2TA 3IRUA 1AQ6A 2B1RA 3U7EB 3WGVA 3WK6A 3AR9A 2G09A 1RQLA 4HGRA 4FE3A 2YJ5A 5AIBA 3FZQA 4G9BA 4UMDA 1VJRA 3MMZA 3U7FB 3NRJA 3A1DA 4DW8A 4YCNA 2HCFA 1U2TA 2WHEA 2WF9A 2I33A 5AVYA 1RQNA 3QUBA 2BDUA 2EAUA 2I6XA 3WGUA 2HX1A 3SHQA 4CNQA 1Q92A 3WK9A 1RMQA 3AR7A 3L8HA 3U7HB 1T9ZA 3AR4A 4UASA 1CQZA 3M1YA 3SF0A 4QJBA 2W4MA 1Z88A 5IT0A 2NO4A 2WF8A 4BNDA 3WK4A 2DQSA 1T5TA 5AK3A 4YGYA 1NF2A 1Y8AA 1ZD3A 4EZEA 3N1UA 3ET4A 1RDFA 1RPZA 2HDOA 5AW3A 3KOOA 3QNMA 5ALLA 2AUTA 3IJ5A 1NRWA 4BEWA 1PW5A 2WF7A 2BY4A 3CZ4A 3PGVA 2PKEA 5ALDA 1Z4KA 1TJ5A 2OBBA 1L7NA 4AS3A 3A3YA 3OCWA 3WK8A 3FVVA 2JGAA 2GHQA 4ZEWA 4EELA 5AVUA 1S8OA 2VKQA 2JAWA 5AVRA 3SLRA 3QU5A 4YCLA 3L1UA 5AVWA 2AH5A 1F5SA 3L0YA 2YJ4A 2YMPA 4UARA 4BNDB 2RB5A 3AR6A 3R4CA 2AGVA 1L7OA 3FM9A 5ALSA 4G63A 4NWIA 1WVIA 1WZCA 5AM2A 3SMVA 2CFTA 4OFZA 3R09A 2PR7A 3ZVNA 4MUMA 5AK6A 2ZBGA 1ZD4A 3E81A 4YH1A 5AESA 2MSNA 2P11A 2YBDA 4UAUA 3J7TA 1QQ6A 1J8DA 4UMVA 4Y2RA 1SU4A 1L7MA 1N8NA 3MN1A 4AP9A 2WF6A 2I55A 5AICA 4HGNA 2R8EA 4YCMA 4EX7A 3L8EA 1S2OA 5AW9A 3TLMA 4Y2QA 3PDWA 3QU2A 4CF5A 5ALXA 1LTQA 2D2VA 2C88A 1RKQA 1Q91A 5ALGA 1N9KA 2CFRA 1QYIA 1L6RA 2R8ZA 5AVXA 3ZVMA 3NIWA 1L8LA 3ZWDA 3W5BA 4BYGA 4EX6A 2YY6A 3SKYA 3S6JA 1YV9A 1U2SA 2ZG6A 3FGOA 1ZRMA 4F72A 1J97A 2HF2A 1Z5UA 1RLOA 4NABA 2IOFK 4UU1A 3N28A 5AKEA 4BBJA 2HF7A 5AVQA 4HGOA 5AK5A 2ZBFA 3UMBA 3QU9A 4Y2XA 4I9GA 2I7DA 2I34A 2B82A 1LVHA 5ALZA 4BX2A 1RRCA 3QXGA 4GXTA 3EWIA 4UATA 4Y3UA 3WKAA 4UM7A 1QH9A 1ZJJA 5AW7A 5AW4A 3IB6A 3I1YA 1JUDA 5FP0A 5ALWA 2ODAA 4E88A 3E58A 2I54A 2YJ3A 1QQ7A 5AI8A 4XPZA 4Y2UA 1O03A 1YNSA 2NYVA 3ZVLA 2IYEA 1SWVA 4KNVA 3L8GA 4KYTA 3ZWKA 1T5SA 5AM4A 5AVZA 2YMMA 1Z4QA 4NV0A 5AI4A 4Y2SA 1ZRNA 5ALNA 3ED5A 1L7PA 3GYGA 3AR5A 5AKHA 3I76A 4EENA 1U02A 2NO5A 2ZXEA 5ALYA 3UMCA 2G1AA 1KYTA 2FPWA 2WFAA 4RETA 2ZBEA 5AVSA 5ALJA 5AKKA 3K1ZA 3N5KA 1TA0A 4J03A 4C4RA 3NALA 5AM0A 4KX5A 4KN8A 2C4NA 4IFTA 5IT4A 1U7PA 1X42A 4OHFA 3NAMA 5AKIA 2FUCA 3I28A 4Y2JA 4EEKA 5ALIA 1YDFA 2B8JA 3WK5A 4AS2A 4NFLA 3OCZA 3ZI4A 2QLTA 3B9RA 3SD7A 3E8MA 5AKYA 2FDRA 3ESQA 3R9KA 3E84A 3PGLA 4BKMA 5ALUA 3KZXA 5AI6A 1L8OA 2JARA 3F9RA 2O9JA 3KBBA 4UM5A 1QQ5A 4DWOA 2C8KA 3OCXA 1Z4JA 5ALEA 1NNLA 5ALQA 2X4DA 3A1EA 2HO4A 2P27A 1XPJA 1XP5A 5ALRA 3BA6A 4GIBA 5ALMA 4UMFA 5AI9A 5AM3A 4BX0A 3HLTA 4UMEA 3W5DA 2RAVA 1YJ5A 1Z4OA 3OTQA 1TE2A 1U7OA 2FPXA 4HAIA 1VJ5A 2GFHA 3PCTA 2JAUA 4L6AA 5AKGA 3VAYA 5AK4A 5AVVA 1RLTA 2ZBDA 2W11A 4YIKA 5AVTA 5AI5A 1K1EA 3DAOA
chains in the Genus database with same CATH superfamily
4ZC8A 3CEMA 4NPHA 4Q4HB 2V0NA 1VBMA 1E1CB 2BRUA 2VUTA 3IESA 4CIWA 2RAFA 1DE0A 2AG8A 2IUEA 4I4CA 3M4NA 3UH1A 5KYWA 4CLRA 2XQFA 1VJGA 1RQXA 5AHOA 4LHSA 1F20A 3M5WA 2CB0A 3DPSA 2II6A 1ZN8A 2HI0A 2DPMA 2AEMA 3CT6A 2JCSA 3ZCPA 5M7EA 1H22A 1VG0B 4DRYA 4XQ0A 3RSLA 3MUEA 3CW9A 3ZX4A 3ESYA 2ZAYA 2JD1A 1UWLA 4WQMA 4ZJZA 4KMMA 1MJFA 2HBRA 3D3QA 4HEQA 3T4UA 3UJ6A 5B4VA 1N75A 4EI2A 3HL0A 2X19A 4QPPA 2LVBA 1GQSA 4WN3A 1JTFA 1NBMD 2C59A 2DT8A 2JFPA 3K5PA 3RYHB 3SC6A 3U4AA 4ZIRA 1EM6A 4DQXA 5JFOA 3I8SA 3ZUPA 2O7NA 3NVKI 2Q4OA 2IUSA 4KQ1A 4OUKX 4Q6WA 1B0UA 1SKUA 4GX0A 4MX8A 1DOHA 4RZQA 5F33A 5FADA 5JJ5A 3NTLA 1M74A 1J90A 4UNQA 3GJ3A 4UXJA 2X9VA 2DE0X 1ZM3A 9GPBA 3HBLA 2NACA 4PFSA 3TCKA 1LDNA 4JLKA 3WOHA 2UXBB 5F35A 3OFJA 2KX7A 1SXJA 1KY3A 2NXNA 1C9YA 3P1JA 1FFGA 2WIDA 1IQRA 4RTSA 2K6GA 1L4BA 3AI1A 1LLDA 3SHFA 4P0TA 1U5BB 4PNZA 4KU4A 3S5UA 5C1IA 4PFJA 4TQUS 4XCQA 4M1SA 1W7AA 1MP0A 1TUEA 3F5MA 1C41A 1PJ2A 4LUCA 4EG4A 1EXWA 1H1DA 1F8FA 5DVZA 4YACA 5JZBA 4PG7A 5C3MA 3LPLA 5AMXA 3E7WA 4JLPA 4KQXA 5JJIA 1UPXA 2XBLA 1B4DA 4L4RA 1JECA 4MYRA 3LUHA 3AY3A 1BJKA 3WSWA 2GJ9A 2LR0A 2AFRA 3R6DA 1AVTA 1SCUB 3ZBPA 4EABA 1CR6A 4BASA 5EVCA 5FBWB 1TJ3A 4C0JA 3ZHRA 4UXHA 3ZWBA 3SIPA 3B38A 5JSKA 4BV9A 4IHJF 2F4NA 2YDXA 1E3JA 2PMBA 3QYPA 5SZIA 3TOCA 3UY4A 2BSXA 3W90A 4UHFA 5E7MA 5H5JA 4DEXA 2NX2A 5ALFA 2ORVA 4JA2A 1WW3A 4BX3A 2D3WA 4AMVA 4YT4A 5K3SA 1ZAYA 1JQEA 4OGWA 2OE2A 2PWYA 1XN1A 2XBUA 1BKSB 2JI4A 3KQHA 4EF4A 2HDHA 2YS7A 3ABIA 2C31A 2RKBA 2CLEB 3OZGA 3CX3A 3WLKX 2RGGA 2OXFA 4EJSA 4YAWA 1L7EA 3KD3A 3ZHCA 3A9RA 4XCVA 4LMPA 1M2FA 2C9OA 1DBSA 1GRRA 3OP4A 3WGLA 2YNMD 4J2HA 1AHPA 3ZJVA 4GICA 1WZEA 4I55A 4HI0E 2ERYA 1H23A 4OSOA 4V2UA 4ZOAA 4JB8A 5TQJA 1ODJA 2IS2A 3Q5EA 2D2EA 4QQFA 3GLIE 1SKAA 1R5OA 3ACBA 3ASZA 3PNVA 1G4HA 4FFBA 4EHNA 5KYNA 3KR0A 2GM5A 1K7FB 2H11A 3AV0B 3SU8A 3WLMA 2QOEA 1ZC3A 2NU9B 3KR1A 3E35A 4LPSA 4BO0A 3CRW1 2Z2JA 3I12A 3CBGA 3K1JA 4GYJA 4NBNA 2ZK7A 4WX2B 1ZGZA 5FLEX 2OV8A 3N8IA 4MV7A 1KQFA 4QULA 4R2HA 4K2AA 5I9MA 3WZMA 4D80A 3K9GA 2VA9A 2QRUA 4NMLA 4DEYA 4A6EA 1EDEA 1XTTA 2W00A 4DOMA 1ZLXA 2ZJFA 1MPXA 5LQDA 4LF8B 3OAAA 2GK6A 2E1RA 2Q3CA 3MG9A 1DEHA 1U2PA 4KOAA 1PI3A 2NSJA 1M8JA 2VK2A 4QYIB 4QXAA 3L7DA 5JQWA 1Q16A 5KTMA 5ADUS 3B5EA 4G0WA 1FLNA 4TTTS 3UZUA 1T4CA 2XXAA 3GIDA 3GLRA 3QY0A 1DINA 1XWIA 4JVOA 2JFQA 4BKQA 1IZYA 3CNHA 2UZ3A 4IGAA 5BW8A 1QP0A 5EZYA 4HDMA 2H7XA 1IL0A 3ANTA 1OI3A 4HGPA 4JR2A 5CVUA 1BFDA 3L7OA 2OZPA 5ARCA 5LD2C 3JX9A 1YB4A 3WKDA 3H86A 4G5OA 1LLQA 1U0GA 4M1MA 4TMXA 3RU3A 2CK3D 4J3JA 1TECE 2C3PA 3PHBE 3INYA 1N7HA 1RCTE 2HD4A 4M89A 4ARZB 4EG1A 3UMRA 3OIDA 4UTVA 1USVA 4EEXA 3TZ6A 2JH9A 2OBXA 1YTLA 3FPSA 3ENVA 2X2EA 2NU8B 3GPLA 3AVQA 1P62B 3K1YA 3GX1A 1MJNA 2JBAB 1CUUA 1UAAA 4BB9A 4C0WA 3AKCA 4K9PA 1AQ6A 4XDGA 1ZXXA 3B9PA 3N2GB 1DTSA 3W7VA 4OFXA 4KWEA 2UUOA 1ACLA 4R2LA 1NKVA 4EI9A 1UQUA 3L8MA 3EYAA 5CXUA 3NHRA 4WMLA 3FZQA 3P2IA 4ONEA 4D6PA 5M3BA 3NWJA 1VCOA 3MS4A 4PZPA 2O57A 1EFKA 1AN9A 4AIIA 3MILA 1D9ZA 5H70A 3K9QO 5IJAA 4LRTB 3Q41A 4I1SA 3AXTA 1DOAA 1X8LA 3BREA 3D4IA 3G1TA 5FUMA 3KVNA 1E8NA 1VCNA 2BZ0A 2HNBA 1U2TA 1RU3A 4Q1CA 3MB8A 3I52A 4RQAA 5AVYA 3ZU3A 3EA0A 3WRXA 5DHFA 1JG1A 3PBKA 4PO9A 3IP1A 4YN3A 3UO8B 4NZNA 2DPHA 1W4RA 1XHFA 5JAOA 5DHTA 1GZ3A 3W04A 5IK2A 2H4HA 5BSMA 5EE5B 2D1RA 2OCBA 2OAQ1 1IHOA 3GLFE 3ZE8A 2O3QA 3WSTA 4DEVA 1GGJA 4O1HA 2IIVA 2IKSA 3R7BA 3RSZA 3GRRA 2ZKIA 2VYFA 3CRQA 5FTMA 2Q46A 3VZDA 3KETA 2Y1XA 4FYHA 4RL6A 2X0RA 1CT9A 3P97A 4FR5A 1EUDB 1QHXA 3PT5A 2Y1DA 4NBWA 4NF2A 4PYLA 3L7LA 4AKSA 1KVTA 2FN3A 2EP5A 2C99A 4FX2A 1QCZA 4MQEA 4KGXA 4BNGA 2G72A 1Q6YA 2Q4DA 3H3FA 1W9MA 1KFBB 2XYPA 4K2HA 2NNLD 1T8UA 5LUBA 4DG5A 2H16A 1U2DA 1XRNA 3QNMA 4WN9A 1C4KA 1QM5A 4QGBA 1BDJA 2GOYA 3C97A 4A0GA 3MM4A 4ARAA 3AJ8A 3NNNA 1JLKA 5CA1B 4GP6A 2ZT5A 2O19A 1P1HA 3KKOA 4BFYA 1LJ8A 1NL3A 3A7EA 4AS3A 1AUXA 3VR4D 1I2CA 3GJ4A 5I45A 2VCEA 3U7QA 1T1IA 2YDYA 2YTZA 3DBHB 5H4HA 4ESHA 2PE5A 3B52X 2ZXFA 4ZVMA 1KYZA 1TADA 2EWWA 3FPLA 1G66A 4QASA 2C2ZA 2FWIA 3QNWA 2GF9A 4UPDA 2DZDA 2DETA 3BH6A 1GRNA 3JTEA 1O5TA 2Y77A 1YCGA 3GFVA 1UAYA 1ZIXA 3QU5A 3LLVA 4ADSG 5EHZA 2DFDA 5ECYA 1R6TA 3FMIA 3DEYX 2JDID 5FT9A 4RKFA 3L9WA 4CW7A 3R0QA 3PQ4A 4TGLA 2YMPA 1AQJA 2GZHA 3PC4A 2BZGA 2H17A 3IH5A 3R4CA 2KMLA 2J32A 3CPJB 5JASA 1K2WA 2B21A 1XTSA 1YB1A 3IGFA 4CF7A 1VHTA 4G63A 4M38A 4N9QA 4MA4A 1KFEB 1OX4A 3HMKA 1XZQA 3KXKA 3NKFA 3MOSA 4MQFB 4WOBA 1SJ9A 5JD4A 4B9AA 2O2JA 4KLCA 1QXSA 4A8PA 2QL5A 2GWHA 4FQ5A 4N0EA 1WLSA 1F2UA 2IUYA 2R96A 4U9HS 5AK6A 3RDPA 1TQ6A 5KC8A 5L9AA 5HKOA 1DAOA 7ABPA 5I48A 3B85A 2PUEA 1WQ3A 3A4TA 2RGXA 3COWA 2LXNA 4NFYA 3D1JA 3OBBA 1NM5C 1F0YA 4HFJA 5CGQB 2X8AA 3SQWA 2QQEA 1RR6A 1BD4A 1U2EA 3AHJA 4L08A 4V0ME 4B2IA 2CCGA 3KVRA 2QSUA 1OGYA 2REBA 3QPVA 3JASA 5T5QA 3AEQA 5COBA 4NLLA 1ZVVA 3GLIA 2HC9A 2BEVA 1U3VA 3TPZA 5E4YA 2RHLA 3R76A 5C4GB 5DULA 4RGQA 4CQLA 1PJAA 1RI1A 5HOQA 1IQ0A 2C94A 3CG0A 2X0NA 2ZI5A 5IHPA 2XE8A 3D3EA 2HRZA 1ARZA 3D8TA 3OX2A 4HX9A 2LDBA 2HIHA 2W6JA 3Q5DA 3RNLA 2R97A 1QS0A 1HKUA 4HQNA 3TX2A 1AO3A 3SPXA 3OZCA 4JLMA 4TT8A 2X6RA 1OILA 4V24A 2OHJA 4G9EA 1YQDA 2BLNA 4QYWA 3WB0A 1QFJA 2BV3A 2G8LA 3WMRA 1BHO1 2CFRA 5FBQB 4C4YA 1QE0A 5B12A 1DFHA 4V03A 3D8NA 5JZOA 4NHOA 4KR2A 1NMZA 2BMVA 1TEZA 2UU9B 4U9IS 2QENA 3JZIA 3CURA 4HNQA 5LQMA 3ZHBA 1J1ZA 1NNEA 1CWUA 4EX6A 3REQA 4UDXX 2YY6A 3BERA 3QSGA 3T5AA 3WIBA 1UBJS 4FHFA 2YFKA 3NBFA 1NF3A 4MJLA 4EKGA 1E3DA 2P77A 4RD3A 3QG5A 3FNFA 3RS5A 3RSOA 3UYKA 1FXWA 4LMBA 1B26A 4R5MA 2IEBA 2RG7A 3H1EA 3AEXA 1IRXA 5ENVA 4P4SA 3SAJA 2ZJZA 1V39A 1PG2A 4HHEA 4AK9A 4AU1A 2EJTA 3CRRA 4BQFA 2PJRA 3P7MA 1E2MA 2AG0A 5FL7D 1A98A 4IDBA 2I4TA 4ZCSA 1P1RA 2NUPB 2NAPA 3NBAA 4R54A 4NQZA 3QXGA 3I64A 4RK4A 1UXHA 3NWOA 1F2TA 1C7JA 4PX9A 2EBFX 1XDSA 1PVOA 1Z83A 2EBHX 3SZGA 1E2EA 2ODAA 3B48A 3O8NA 1I1HA 5J2TF 5HCNA 3Q9UA 4LDZA 4OJMX 4ZT7A 1JIKA 3O3OB 3SS7X 1C14A 3EVAA 1R74A 3NAQA 2I4LA 4JCOA 4YI5A 4RU1A 4R1MA 4IKOA 1TF2A 4Q9KA 4PPYA 2FPIA 3HEAA 3KUDA 5EP1A 4TV8B 1FUEA 3G7NA 2B9VA 4NV0A 2IPOA 1JEEA 1SUEA 3Q9LA 2BFFB 4QGAA 3R75A 2SECE 4WK0B 4XD7D 2BTEA 3H4TA 4KI7A 4NFHA 2IHYA 2NP7A 3A4VA 2ZVPX 3ZCSA 1ONSA 1RXVA 3TUJC 4B8ZA 2H85A 5L7YA 4PLVA 1QQTA 1TKRA 2O2GA 5ALYA 1PV2A 1JI0A 2HQOA 4DT1A 2I7CA 5T4BA 1XXLA 5HQ3B 1V0JA 2IEAA 3B1XA 4KDRA 1XJWA 5KO2A 3QX3A 4GEKA 3FYUA 2ZTUA 2GEVA 5CCBA 2DHQA 3J80A 3HJNA 4RSMA 3RSSA 1HRDA 1T6YA 1OBFO 1U0EA 3OEWA 3RC2A 4BE4A 4QG3A 4KX5A 1NPDA 2QVZX 3G85A 1CTQA 1E1QA 2JBHA 4ZCTA 3QLTA 4KPGA 4K46A 2VAVA 2J3QA 2ZTMA 3NM5A 4KQGA 2Z2ZA 4E5YA 4TKVA 1VCHA 3A6GA 3QF4A 1VYUA 1DXYA 1RFLA 4X5OA 2O48X 2W2MA 4M8NE 2XT0A 3OKPA 5EI5A 4G2TA 1Z6ZA 3RODA 3PFIA 3Q88A 3OF5A 1G21E 4QD3A 3FMOB 4Q82A 4GBMA 4AD8A 4FU0A 2QPOA 3ZLTA 2DUUA 3DBRA 1CQJB 1W30A 5AJZA 4G5XA 3VPSA 2C84A 1R3UA 3A3OA 1ZR4A 3KZXA 1RW4A 4QUIA 1IFXA 4XFDA 3EUAA 4QVIA 3SBEA 1Z12A 1PT5A 3PXAA 3KOUA 2HQBA 4DDKA 2N46A 2XVMA 3TTYA 5EL0A 4NRDA 1WWKA 2WD7B 1NQXA 1DP4A 1EX9A 1P4JA 2QAGB 2QRPA 3M4YA 3TZEA 2EEPA 4E5UA 2GAAA 1P0FA 1VMEA 5KSOA 2HSDA 1GUDA 3FWKA 4JUCA 4WK2B 5HGXA 5JT1A 1JZTA 3SQMA 1B2LA 1MX9A 1P7CA 3NHAA 5EXXA 1NFRA 4GIBA 3HADA 3MWLA 1Y4UA 3E3OA 4UMFA 2JVJA 4LW8A 5IVPA 1LQUA 4AI6A 2PTGA 4QICA 3BILA 3DVAA 4V0KA 1NJ1A 2BP7A 2BZ1A 2JFFA 2O52A 2ZEJA 5FO1A 3SZUA 4DHEA 2ZUEA 2EX1A 3E7XA 1LLCA 1WXFA 2N1MA 4HUTA 4J0QA 2F9MA 3OTQA 3E7DA 2IEZA 3KL2A 3JRNA 4X20B 3DPUA 1WVGA 2PIDA 4OHXA 1IM2A 1M8GA 2RC6A 4IIJA 1F6BA 2Y2UA 4X7RA 5L3SB 1XLTC 5EWJB 1RLTA 2BMDA 5J40A 2Q2WA 1M34B 5BUSA 3OP1A 4ZVOA 5J2UB 3KSAC 5AVTA 5F77A 1M6WA 1QHNA 1EINA 1SN7A 5K8CA 3NH9A 4ZQHA 3VVMA 1HYEA 1RMYA 4PS1A 3U09A 5E7JA 1D5WA 1KOGA 2DQYA 1NXXA 3CPEA 4ATNA 4HWOA 4D4HA 2G1PA 5CW2A 2H9YA 1XRQA 5JBIA 4PXSA 5G0WA 4BWVA 2Q28A 5IBCA 4JI1B 3P9YA 1UPFA 4FT4A 3OTWA 2PL5A 4IGFA 3MBOA 4K40A 5E6UB 2FSVC 4EO7A 1E89A 1X9HA 1CUSA 1M0EA 1GQ2A 4ZU3A 1YA4A 2BGJA 5E7IA 5G0TA 5GJBA 1O87A 1FSGA 3H17A 3TTVA 3SHTA 1UOEA 3ZK7A 4DJFC 3VJRA 2G7MC 1PR1A 1BXKA 3LYUA 2EIHA 2QM7A 1KZYC 3NBXX 3AVPA 2Y67A 2HNKA 3FW1A 3QWAA 3H4MA 4D96A 1OZAA 3LG2A 1SCJA 4KDFA 4QRDA 1UBNA 3QEMA 1UBLS 4B6FA 5I4IA 1QBKC 2YMQA 2OENG 5T6MA 5KREA 2DTEA 3W5AA 4FC6A 2Z4SA 3BWYA 3IYLW 4D4MA 2H1WA 5KSYA 1SVNA 4M87A 2Y4NA 5KNBD 3RWOA 5CT6A 1OLOA 2WZDA 2Q45A 5H0IA 1LY1A 5JSYA 2R1TB 5BSTA 3Q7SA 4ZTUB 3C3YA 4EEZA 4HB3A 5BSKA 4H7KA 3GUHA 2PZKA 3I6IA 4D8WA 4ZDWA 1EJ6A 1JPVA 3DW1X 3HKBB 5FOXA 5AW1A 4GVPA 4RABA 4ZO9A 3C70A 3VH2A 1ZIPA 4ZQEA 1O1YA 5EJ9A 1NJ6A 3HR4A 5KX5B 4GS5A 2J85A 3C7CB 3DB2A 1EVEA 2VS1A 2QUJA 3E1SA 3ISVA 3L1VA 5WRFA 2D54A 3FHJA 4B6OA 1NAHA 4NENB 4Y2YA 1YJXA 2W6ZA 3KZMA 3W6OA 1SQ5A 3OOEA 5IUJC 5KWJA 2IOHA 5A5FA 2B8TA 4BGEA 4WFIA 4YPOA 2IXTA 3RTGA 3TLXA 3U3XA 4MHOA 3JS5A 4MPJA 4P5EA 2DR0A 4RF4A 1X7YA 1GL3A 2YH2A 4A23A 1VLZA 3BK1A 3LVBA 3GXOA 1U2GC 3QEJA 4FFDA 1U0SY 2PRJA 4NMHA 3LUAA 1LRLA 4UNSA 3OJWA 4Q02A 1RE1A 3NONA 1NBHA 3ZY4A 1N25A 4ANFA 2GAFA 5C8VA 2F3TA 1EVIA 4LV5B 3W6UA 1OFVA 4UE6A 1AKVA 2HRDA 2YUIA 1R4ZA 1SBTA 1VSQA 4LJ5A 2ZS9A 2ZUTA 3G5MA 3TW8A 4G5HA 1RRPA 3DV9A 2XUJA 2HTEA 2XJ9A 4WZ6A 4XR9A 3C3XA 2BFCB 4JQCA 3RKRA 5BOSB 1FRQA 1DKNA 2VP0A 3H11B 4JD5A 4M7RA 4UD2A 1Z16A 4LAFA 1NBEA 4P0QB 1R0LA 2GBGA 3LPCA 1GNVA 1QRDA 2QR2A 4OLFA 3MGCA 1KE1A 4TVOA 1PL6A 2VQSA 1WXQA 1M1UA 2W2TA 3IP9A 3QUCA 4LDQA 5IAGA 4C7VA 3AESB 4MLDA 4P5PA 5I9IA 2BFPA 2PUFA 1OXBB 1J49A 1P1BA 3PWZA 2PN1A 2Q5QA 3ETCA 2WJAA 3JZMA 4UTZA 2PL9A 5I7UA 1XT6A 4MWOA 1O5OA 1SOAA 1WB5A 1ULAA 4IJVA 4E2YA 2AJ8A 1E2QA 1AZWA 1U6IA 4GI7A 1D9XA 4CQMB 1N2SA 2O1XA 2ZSUA 1LBQA 4I8IA 4HS4A 4HDAA 3VKVA 1NW3A 5DHUA 4AKTA 1YNOA 3AK4A 4X95A 2GMWA 5A2GA 1VKJA 3RLIA 5CCEA 2V58A 3IMGA 4LRXA 3VTKA 2IUTA 4BKPA 4GL2A 4G1UC 2YX1A 4FDAA 3GMIA 3Q7IA 3DKRA 3N05A 2JLSA 3OOWA 4RE5A 5DLPA 4BNJA 2X9QA 3IFSA 3RR2A 4X64B 4ZI7B 5CVDA 1YF3A 1CDDA 3KRTA 1LV8A 2B0CA 2QUBA 1R8XA 4S2UA 5I8ZA 1KGSA 2P6PA 3COJA 4GOND 3TXYA 4Q9DA 1Y9JA 1UK7A 2YYZA 4A0SA 4AZ0A 3OU6A 1G21A 4D92A 1WETA 3AIIA 1WR8A 5BW6B 4BIIA 4WKPA 1A88A 1CUFA 3IA2A 1S9DA 3I6MA 3L6RA 3OT5A 4OA5A 4E3ZA 1EFAA 3HZHA 2CNOA 4ZGGA 1KL7A 1YKSA 4KBFA 4IZIA 3CUEF 3ESXA 3S27A 3WMGA 4ED9A 2Q1SA 3MERA 2AI1A 2VBIA 2FSSA 2OMEA 2QPAA 3GJTA 3KPYA 1Q1BA 3DOCA 3O91A 1BU8A 3TW6A 3OCUA 4JVNA 4PM4A 1Z4LA 4NYMR 1KC3A 3D4OA 3RIYA 3WNZA 4Z2YA 5CA1F 3OQ6A 1UXGA 3PE3A 1I3NA 2PKQO 4H59A 4A7PA 1QVRA 2GPSA 2FJ0A 3THYA 2CXNA 1URPA 5CNMA 5I7HA 5IM5A 1JKIA 4BO3A 4X62B 2ACVA 4WH0A 5B1IA 4NV3A 5BSRA 4KK3A 1VP9A 1A9XB 1UKCA 3WLHA 2NSDA 3R2JA 2D1YA 4BFLA 5LWQA 3N86A 2AZXA 3BRSA 2R6JA 3ODPA 2W58A 4PXYA 4X6YA 3U7EB 1ZUNA 4IMIB 1Y8RB 4B2PA 4QUHA 1EH5A 1DAFA 3GG9A 1JDJA 5A9TA 4KRXA 4N1AA 4BQEA 3GZJA 5TEVA 4XEUA 3JQCA 3HG7A 4KSCA 1NVUQ 3FUCA 4RHFA 3BXFA 1MGPA 4CR6A 3TBFA 3IAAA 2BSQA 2QQFA 3ICWA 5CEEA 3BG5A 3CEJA 3UMVA 1DCMA 4IJUA 4V02A 3V4OA 4ASUA 2ZUFA 3LU1A 4ILEA 3MJRA 4DW8A 2HREA 4M1QA 5T6BA 5LOVA 1NUPA 3MTQA 4QJ3A 1TYCA 5C8XA 5TB5A 2YWFA 3I2IA 3M81A 1SBYA 4NNPA 4ND2A 2ZR7A 3LL4A 4DIDA 5C34B 3AFGA 2ADMA 2EXXA 2VBGA 5A9SB 3MBIA 4CKEA 4MICA 3NOOA 3W1WA 3ZZUA 4HDSB 4ND7A 5HRUA 1RMQA 3KYDA 3MSCA 4JI7B 3BT7A 1VMKA 1IVYA 1UT6A 5DT2A 2JLRA 1VPVA 2XTNA 5CB8A 2OGTA 2Q21A 4HEA6 3ZDEA 4L5CA 1DLIA 3WBJA 3DDWA 3SJAA 3TSCA 4P33A 2FVXA 1U81A 5J43A 1I0IA 4IOKA 3SP1A 4BPBA 4L4SA 2OHIA 2X2PA 3QV2A 1PF7E 3LHDA 4TWBA 1UJBA 1YBHA 3IHLA 1LF5A 1J0AA 2JAQA 5DCYA 3NTOA 3BCSA 4HRAA 3PI7A 4J7UA 4PZLA 1WMDA 2QJOA 4GX2A 1HT2E 2AFHB 1TJ5A 4GMDA 5A5VA 3BE8A 5ENZA 2C3UA 3LM8A 1Y4SA 2ZDQA 2BEUB 1GAEO 2NVUB 4HMQA 5C31A 2AG6A 1I36A 4I99A 4JXXA 4MJ3A 2TS1A 2C07A 1YI8A 3DDOA 3S7ZA 3NYWA 4LSGA 2YV3A 4NEHB 3T1HB 4CMEC 5AVOA 1GCIA 2JAWA 2IE8A 4AJEA 4EHKA 4MHTA 1V8PA 3LT5A 4PZZA 1PNQA 1AD2A 4YLGA 1O95C 1MT3A 2WM3A 3EEYA 2AH5A 1IM8A 1GFIA 3L1UA 5FORA 2QP3A 4JJ6A 421PA 1R4NB 3CH7A 2QGNA 2PRIA 4A0RA 2PMDA 1KKUA 3L0YA 3ZV5A 3FTFA 1AGYA 3EIUA 1AH2A 2DT5A 1HNWB 3F2IA 2FU5C 5LZ5A 1QANA 2VYND 4DLVA 3VSEA 3ORHA 1AQUA 4LC9A 1L7OA 1GKKA 2VP5A 1GDDA 3AG5A 4WLOA 1HFWA 4PQFA 1C8KA 4RSHA 4ER6A 1Z7YA 1RPAA 1P2BA 1KYWA 4CV0A 4N5IX 4J0IA 3OI7A 2XVAA 4TVBA 4DANA 3KK0A 2PO7A 2R8OA 3P9RA 3O2NA 3U9SA 3X2FA 1IY0A 1O6GA 3T7SA 4FKMA 4DMUB 1X70A 2PZBA 4LRYA 2ZWAA 4BDTA 2KW5A 3JQDA 1BRMA 3TG2A 4DLPA 1A8QA 4OFBA 2BBWA 1TW3A 1TCBA 5JS8A 5KTOA 5FUYA 1E7MA 2Z04A 1E2HA 1KIMA 1KJQA 3PICA 4UAUA 3OTOB 3F7MA 4XX0B 3W9BA 3EQ9A 4HN2A 4FYJA 3FUVA 3NHSA 1P33A 2RGUA 4LVCA 5EHGA 3DWEX 4GXNA 4Y2RA 1L7MA 1T5IA 4JL5A 1IJFA 1Q7TA 2C5AA 3LX5A 2IUUA 1ONPA 4AP9A 3SYNA 3CT4A 1Y0BA 1TTPB 4FI3F 2AS0A 4F3YA 1E2NA 4O4IB 4FMPA 1QPBA 3FETA 3GIWA 1TUBB 1E2BA 1SOUA 2J7PD 3KJEA 3PEVA 1P2DA 2WKWA 2G71A 1XVAA 2JEZA 4YECA 4N0DA 1B74A 5GIPE 4JUIA 5SY6A 2JA1A 3VU9A 2FMTA 1GGVA 4OP1A 3IOEA 4BNTA 3G02A 4ES6A 5CNKA 3IX7A 2ZB7A 3VHQA 1J00A 4EA8A 1AC5A 3AHGA 3MSXA 3MMXA 4C43A 1R9MA 4XAQA 1N7GA 3PHHA 4AICA 3M5PA 3SJZA 1MC5A 1W5TA 3GLKA 2CMFA 4EM6A 4LF6B 3G5AA 3BUSA 2ZSHA 3E4CA 4L4UA 1Z5UA 5LYYA 3FDJA 3KWMA 1E18A 2XKBA 1PSWA 1ZMOA 2WB4A 4PIPA 4XGKA 1LB1B 1CHNA 1GUYA 3DQQA 4UU1A 3T35A 4M0EA 2Z6UA 3RRMA 4J16C 1BOFA 3CHYA 1C1DB 1HL3A 3NBYC 1LX6A 1DO2A 4CEHB 2IIBA 1R0KA 2NU6B 3O2SB 1CQWA 1PQ4A 4MVJD 1BN7A 1LQ2A 4CL8A 4C6TB 3FAKA 1NRIA 2FQXA 4OXXA 4PPQA 4WKGA 5SICE 4OLAA 1GL6A 3BGOS 5K2OA 1L8XA 3D7LA 5CGZA 2JGMA 5AT1A 4ZAVA 2QDXA 4YMIA 4Y3UA 2WFZA 4OKIA 1R0XA 1XMQB 1ZQ1A 4Q93A 1E1RA 4G0QA 4RA9B 2Q8NA 3EZ6A 5CU7A 1XCLA 3I1YA 5CM8B 1JUDA 5U9CA 5IC5A 3OOJA 1L4UA 5CTAA 1YS6A 1UK8A 2I54A 2OPHA 3MFQA 5KC9A 2NQ8A 3C1TA 3MD0A 4ER7A 4C89A 3E22B 2BEWA 4OH1A 4CFYA 1P7WA 3ORRA 3NDJA 1GOTA 3K6KA 4HLQB 3STTA 3ZE9A 1T2DA 4HUQB 2I9KA 2O8FA 1T6NA 1Z4QA 1J20A 2DHEA 3DCNA 3O8LA 3AUJB 2Y27A 3EHDA 2VZ0A 4JUAA 5SY4A 3HN6A 2CSXA 4FI3C 3LX8A 2YFHA 2BJHA 1SVUA 1XF1A 2AC2A 1AZLA 1JJFA 2FLWA 2GCOA 1R1DA 2JK1A 3EISA 1Z0UA 3JPYA 1PQUA 1OAAA 2VHVA 3EMVA 3RROA 2A92A 2BGTA 4A1OA 3D4NA 4RF3A 4EHJA 1YK1A 2G4LA 2SHKA 3OJ0A 4XUGB 4DQVA 3BGDA 5AVSA 5KVAA 4I36A 3LQQA 1LPBB 5D00A 1N7IA 3D7SA 5K3CA 4LCJA 3B53X 2GTHA 1CUEA 4CUJA 5EE0A 1GAXA 1UEJA 1Z6YA 5AM0A 3DE3X 4OK3A 3SLGA 3QFTA 2QROA 3U6KA 1T6BY 2BMFA 1NG1A 3BX1A 3QX8A 4PONA 5F5LA 2A1TR 3SY8A 4WZAB 3GRCA 4FGZA 3WA7A 1CUAA 1VQ1A 3A04A 4L9AA 1RQRA 2V55B 4ZCMA 6GPBA 1TPZA 3DZDA 3RSFA 4MIEA 2XDQA 3FBTA 3ZN2A 1LSJA 2HA3A 2XV1A 3HI4A 4O2AA 3O38A 4J0DA 4X1IB 5AKYA 3GEEA 2QZJA 5DFAA 1W2HA 4WBNF 5JDIA 4URWR 1H85A 2GETA 5JD3A 1GR0A 1L3CA 4JS0A 2IHTA 1KQGA 2VQFB 4AXBA 2PBFA 2P3LA 2PSHA 2XGGA 3WBKA 1CVLA 4B83A 2BM0A 3STVA 1I7DA 2HHCA 2VAWA 2TMGA 3DLAA 3IO5A 5TRTA 1YRAA 3E9NA 1II8B 3OA2A 2EFJA 1K5DA 2DYKA 4K7JA 5JSUA 1ULTA 4O08A 1Y6GA 2DXIA 3OE5A 3RS2A 4U6SA 4UPEA 2W2KA 4KDCA 1YE8A 4PX3A 1QP4A 1D07A 1R3DA 1ZN9A 2Y0PA 4BTLA 2P9QA 3O1JC 3KEMA 1WABA 5EJEA 5KX5F 1J1IA 5AM3A 3U6BA 4QBTA 2L69A 4BB5A 3EPKA 3GYBA 4Z0TA 4X90A 3WDLA 3W8DA 2X14A 4F06A 1SY7A 2I87A 2JHGA 2ZSKA 3K16A 3S7TA 1U7OA 3ANNA 1UPCA 4XSGA 5DCLA 1YBVA 1MJGA 1NW4A 1PFUA 1YZGA 2X5OA 1K8ZB 2HGSA 3QKWA 4TTIA 2ZKLA 5AHKA 2J08A 4OL9A 4OLJA 5JUWA 1GPUA 4W9NA 1AUVA 1Z5WA 4D8XA 3HY3A 1R00A 2ZFUA 1ZNQO 3HFRA 4KSBA 5E6SB 5G4KB 2VK8A 2IPLA 3G9ZA 4JJ4A 4QBGB 4L85A 5E9JA 3ZE0B 2G80A 4X1KA 3RQIA 221PA 4UHBA 1ML3A 3M6XA 2BOVA 3UT5B 4AJNA 3VBCA 2P9HA 3V2GA 1XD2A 4A2CA 2M6LA 1FYVA 1KRHA 3PC7A 3BMCA 2ZB3A 3QE4A 5I7VA 3F1LA 3L8YA 2IITA 1T2VA 3O73A 2NUAA 4U7JA 2IEDA 2OGSA 5MDHA 3WP1B 4YMGA 4LRWA 3H18A 2XCUA 4FCTA 1JIXA 4O3FA 4PEVA 1Z68A 3GI1A 4C5AA 2NUTA 1RI5A 4ZYZA 5BNTA 5IYZA 4MJXA 5EFZA 5CH3A 3DFMA 3ANSA 1EHYA 3HM2A 1GV1A 3KDSE 4MS4B 1PIWA 3CTMA 3QEAZ 2XY4A 5DTJA 1YOBA 3G9UA 1XTZA 1JZSA 5HFJA 1THGA 3GVPA 4HQKA 4OPMA 2CD7A 2AEFA 2R8XA 2QYHA 3QX7A 1ECPA 5CAEB 1E7RA 2BL4A 5KWIA 2VP2A 2P9GA 1BTOA 1ODSA 1EP2B 3T3HA 1U99A 3QFFA 2Y1EA 3MQFA 1EVKA 2O23A 3H5VA 2HLDA 1K9VF 3K09C 3ONEA 1QVWA 4NCKA 3EVTA 4TN5A 4ZEVA 3A9WA 1ZP6A 1OC4A 1P8AA 2FOXA 1DAPA 1Y6QA 1TM4E 2DLDA 4Q1VA 3F49S 1F7UA 1Q95A 2OC9A 3IV6A 1JHXA 4Q19A 3HKEB 1Q7BA 1IE3A 4UU8A 4BDSA 1OJLA 3JAMA 2DSNA 3V3TA 1RAFA 1QVAA 3WOVA 3NP9A 1JP7A 3BMXA 4NOJA 4WBSA 3RC8A 4HYTA 1V5FA 3AW9A 1RBMA 3DUFA 4H7JA 1A82A 1GGNA 3TEMA 4P54A 3C87A 3RHFA 5AUNB 5CFQA 3K9HA 1T1RA 2VWQA 4A8JC 2CCJA 4DCCA 3SDBA 1W2GA 4AKHA 1TFUA 1S3IA 1Z6AA 2X3FA 4JZYA 3HO1A 1AKYA 1Y3BE 4ZREA 4CMKA 4DYHA 5LYJB 5F7JA 1ZESA 2IK8A 3FOWA 5DBGA 3RYCB 2RGRA 4CKCA 3UT6A 4L0DA 2JLAA 1DXQA 1OWMA 2AI3A 3HBNA 1ISRA 3R24A 2QV0A 4RADA 1P3Y1 1DG1G 3EGXA 3BEDA 4DA9A 2WWYA 3ZGZA 2W2OA 2VA8A 2KI5A 4RFSA 3A3KA 1YL6A 3KQKA 3DMTA 3L1IA 4BV8A 5JVDF 1L5RA 3IALA 3RI3A 2CMGA 4FYIA 3IAS1 3WKCA 4A8HA 1QZXA 4KXWA 2H9IA 1XBTA 1NBOA 2P2SA 4ZWNA 4D3FA 3TKYA 1PKXA 1ZICA 1C3OA 5J1TB 1EP9A 3ZJUA 1D6MA 1DKMA 4IIBA 3SCZA 3CKMA 4DR5B 3KE8A 5AOAA 4NS1A 4XIGS 3A32A 1RKBA 2GBLA 5JHHB 4XIYA 1SBQA 2FE4A 3TMYA 3I9JA 3IEMA 5UKDA 1WW8A 1E3MA 3UMSA 4YGXB 4HRYA 2JFBA 1XRJA 4ARUA 4DN6A 5IN4A 4OJNA 2VJKA 4WZBA 1Y6JA 4XFJA 5KJFA 2H0AA 3HGMA 4JI6B 4C3OB 1PV4A 2ST1A 3WG9A 1SM4A 4DA7A 2WU1A 4KAJA 3GJ8A 1L5VA 1D5CA 3EDQA 3BWDD 2FPKA 2ZRIA 4PCVA 4HDCA 1FU4A 2DFPA 3A6EA 5KQRA 3O74A 2Y9MB 3R8FA 3G0HA 1TM2A 4ZV9A 2I0FA 3B9BA 2ZUUA 4MOWA 4TM8A 1DEKA 1DRKA 3CLRD 5HF6A 1Z3IX 5C3UA 2ZANA 2HQRA 2OV3A 3E1KA 3D8BA 4XGNA 1P0MA 3GRZA 4NAVA 3HJHA 4F5YA 1ZNXA 4ACBA 5A5DA 1PLKA 1KFJB 4BFWA 3QXHA 2ETXA 3P96A 3JALB 1XMPA 5JXWA 4FC7A 4UAGA 4WI1A 3V2IA 3PWKA 1PEKE 4P5DA 4US2R 5KPJA 2REOA 4MV9A 1JXOA 1ULBA 1PAUA 2ZAGA 3I32A 2Q2VA 4ZVSA 4GPTA 1A7KA 4H1WA 3U19A 1M5RA 4D0GA 1I0LA 1UC9A 5BN5B 4K6OA 2EW2A 4H3SA 4DLZA 4EG0A 3B6ZA 1DTWA 2IT1A 4MS1A 1GPKA 4CF4A 3BE6A 3UANA 1WKCA 3HY4A 3MCTA 4O0MA 2FZVA 2X2OA 3LWBA 4UBLA 2HGZA 4GPBA 1I0ZA 3S2EA 2F67A 1ZH6A 3DMGA 1VG1A 1WZ2A 2OYRA 2JI8A 4EPVA 4W5RA 1HTBA 3V97A 3OOYA 3VH1A 2FEXA 1GSAA 4RM3A 4N6OA 5HK8A 2FW6A 1M67A 5A6VA 3HA5A 4M6WB 3B78A 4YT5A 3CISA 2YMLA 5TGTA 2FZGA 2LKDA 5MGNA 3A3NA 2G8NA 4LVUA 3PD0A 4CXMA 3WLIA 5FWXB 1N5LA 5KKNB 3VZRA 4O4HF 1CNFA 4FN4A 1CR4A 3NEAA 1TZKA 4QHTA 4ZOLA 2DC1A 3GEMA 3MAJA 4QEZA 1S0UA 2XGMA 2PZFA 3USES 1EFUA 5JAUA 2GLUA 3PDUA 1IN8A 1ZA2A 2WYVA 2ZE7A 4IQ8A 1NF9A 2ZR9A 4PNPA 4M9CA 3WWPA 1ADFA 4R01A 3AB7A 4L28A 3GZNB 4LRQA 5ELMA 3KL4A 2OZLA 4TS4A 4GMGA 5DSZA 3DVQX 4L4YA 2YY5A 2FSFA 3IPRA 2FR8C 3O8DA 1X9IA 2UYYA 1DJLA 3ZCVA 3ERCA 4Z1MD 2CLMB 1T3HA 1EFVB 4RZIA 2QUAA 3ZBUA 4XTCS 5KTTA 1CUHA 1GG8A 1R8SA 3PQFA 2GRUA 1GA1A 2OM2A 1KYQA 5K45A 2HT1A 1HO3A 1SUSA 3AR4A 1LFAA 3M1YA 3RUAA 4BMSA 2RGWA 4C7BA 4ZO4A 4CF6A 5JMWA 1XTPA 1ZKMA 5AJUA 5LR6A 1COWA 1ADGA 2NO4A 4PZ0A 3OFNA 3WK4A 4BNDA 1EFPB 2QJFA 4RK0A 1Q0QA 3R7SA 4BNIA 4XVUA 1NF2A 1W94A 1M1YB 5LP6B 3UATA 4ZT2A 3SFVA 4B3GA 3U1BA 1BE8A 1OU4A 2AV6A 4L8FA 4Z7JA 5B7NA 2HZBA 3DDUA 2Y0EA 2PQMA 2I7VA 2P90A 1RDFA 4I4NA 3VDMA 2DFLA 1IPHA 2GDJA 4TM7A 3CMMA 1FU8A 2AUTA 3D6AA 3FFXA 4H1TA 3LKZA 5DHPA 5BMVB 4TYQA 4EKNB 1ST3A 2ROQA 5ALDA 2POQX 1NQAO 3EIEA 4P3KA 4TLCA 2FZEA 1OF1A 1E2UA 4WOJA 2HDWA 5C1PA 4O33A 3VISA 1ZPDA 4EVQA 3I2FA 4QQKA 1UP7A 2NYRA 1A4RA 1YZVA 5H9VA 4EY7A 3STXA 3ROMA 3HB7A 3JU3A 4X7PA 1SVSA 3TGLA 2RIPA 2DBZA 3VX4A 5CB4F 1HDZA 5GOTA 5G41A 1RXWA 4KREA 1JYEA 1MF7A 1R5BA 2VTDA 5BR7A 2IXBA 3ZHYA 3TUZC 2JLUA 3AZPA 3C8MA 4E4YA 3UPUA 3D2AA 2WG1A 5HE9A 3I5UA 3N7UA 1WW2A 1N2HA 2QWXA 2CHGA 1Z36A 2AJDA 5LQSA 3VH3A 5KYXA 3NCTA 4UHEA 2P6NA 2X22A 5E9QA 4FYYA 4BMOB 3ZWXA 5DASA 10MHA 1Z0JA 1ZVJA 4AIRA 4D42A 4R0VA 3FOAA 4BLVA 2C97A 2O8DA 3ON5A 3CCBA 1Y3AA 5H80A 1AQLA 1SK8A 5AM2A 4IQ0A 2BH2A 3AQ4A 1BE6A 1K06A 2IYOA 2X4GA 2PR7A 5DNVA 4OHVA 2FRVA 3OURA 4TRMA 2Z2IA 2GCPA 2WKRA 2WU3A 3DE1X 4LE1A 1ELOA 4Y6QA 1E69A 1JQBA 1FYEA 5BPHA 4BNHA 1DEAA 2XWSA 1BCRB 4P8RA 5AESA 4MDEA 1ZK2A 4QXQA 5DHQA 1DT3A 3BS4A 3GPBA 4EY6A 1FF9A 5TS3A 4KV7A 2EFYA 2J0EA 2PUBA 1LSSA 3AIMA 2A4KA 1OLSA 3ECCA 3NHFA 2G04A 3G79A 3PLRA 4G1CA 4RETA 3VO9A 3OCCA 2NYUA 4UMVA 3FF4A 5BORA 2JGKA 1Z8NA 3F6PA 3AF5A 3HJFA 1A9TA 4RV4A 3K15A 2ANCA 3E03A 3EMBA 3K9BA 1NUHA 3H5TA 5TMPA 1ZVMA 1IOZA 1BROA 3PI6A 4YCMA 1KSGA 3L8EA 1E8DA 5IJWA 2QMOA 5JSQA 3I1FA 4FWBA 4J7AA 4GMHA 1T5HX 5ALXA 5T8KA 3U44B 4IM7A 4ITVA 1KZGB 1BYIA 3BSYA 1G2OA 3FCUB 1M5UA 3OKFA 4ZCPA 4Y6SA 4OQMA 3I9V1 3GL9A 4P32A 4BGDA 3OEHA 2BFAA 4Q4AA 5FKJA 3NIWA 3D64A 2Y1FA 3IPXA 4QZVA 3THXB 2WC1A 1E7SA 4PBSA 2YYAA 3QTBA 3W5BA 3K0HA 1K08A 2QMEA 4XGIA 2AT1A 1R6UA 4I1RA 4F6RA 3N87A 5D6OA 3BXEA 4BU1A 1SVLA 4F7WA 4F4IA 1TLTA 2XVZA 4L51A 1KMNA 1YV9A 4CCWA 5IM4A 1P91A 4WGGA 1LDGA 4W5QA 5KTYA 2HXSA 1L1EA 3I45A 5IDYA 1GVNB 4G5GA 2OBNA 2ERCA 5CK4A 3S5JA 4NP6A 4R71A 4JBWA 1HLFA 4TKUB 2CJPA 3GGPA 1P29A 2WUWE 3WGJA 3WYBA 2F8MA 2PUHA 3DXFA 4M76B 3SIXA 5CLLA 2PZLA 3SSMA 3GT7A 1KJYA 2HM7A 1Y4ZA 1AXGA 1W52X 2B83A 2I34A 2QZPA 5KMGB 1U7UA 1RWNA 1JE0A 4J7XA 2IHNA 2ZVQX 1E79A 3FDFA 3RGGA 5TV2A 3UA3A 2WYUA 1CDEA 4U0KA 3BTSA 1NJSA 4U9UA 2C1ZA 2OO3A 2WVGA 1O8BA 1PK9A 1HT3A 3PWTA 4G8DA 4M98A 3E0XA 1KY2A 1EVLA 4J90A 3KVOA 5DIZA 3AWIA 4XWTA 2XOKA 1ZIYA 4Y1EA 1G7CA 4GQIA 1QIIA 1GQOA 3KHSA 1YQXA 3W2FA 1KR5A 1BH6A 1GYQA 1PT9A 2XEXA 1GUAA 3RVOA 3Q1LA 4RPGA 3SJBA 3ZGVA 4KN6A 4EQZA 1PNOA 2JJYA 3FA2A 3T3NA 2CZGA 4U2KA 4H0FA 3ZWKA 5AM4A 5BRAA 3EFBA 2ZE6A 4HAYA 4NJMB 1J9EA 4D9IA 4XSVA 2QL6A 3EFOB 5HJ5A 1DIRA 1JA9A 5JC1A 4JJKA 1HURA 5ED4A 1BXRA 1WCYA 6ABPA 1CR1A 3LFTA 2ZB4A 2P6MA 3UMFA 4Y18A 1P2UA 1E1NA 2E4XA 3G2QA 1PBNA 1NASA 1L7PA 2JGRA 3HP4A 3KE9A 1M8KA 4BFTA 2CDNA 1Z7EA 5CHEA 2BFWA 5K8TA 1GDTA 2NO5A 2PHZA 2G9NA 3BTUA 3CO0S 4A3SA 1P2FA 3LC0A 2AUNA 3DOIA 1SZDA 3L7NA 3A6FA 4J1QA 1NXWA 3EODA 5AKKA 4W8GA 1MD9A 1CULC 2EIXA 1COZA 1AMUA 4CMCA 1JFFA 3E8SA 1AMNA 1FOEB 5K0NA 2AA3A 1UMCA 2ZIZA 2ZUWA 2DWOA 3FNBA 4H18A 4AECA 4U1RA 4BKRA 3MS7A 1YFZA 3HACA 1HUQA 2DAPA 2P2GA 5IT4A 5KOHA 5KBYA 3JVUA 2V5AA 3GAMA 1Z2OX 2WOJA 2Z56A 2G6TA 3NAMA 4KXYA 5CDFE 1NVFA 5EVJA 5ALIA 3S70A 4DG8A 1CUDA 1JSLA 2B8JA 2R751 2W83A 5JS2A 4D6XA 3ZVKA 2FEWB 1UBFA 3DMPA 2CJWA 3HCCA 3OECA 3I2KA 4PRYA 3Q7RA 4TXNA 5FUVA 1ZR2A 1W36D 2ODNA 2HQSA 3K0CC 4LA4A 2WHRA 1I24A 1LW7A 4G0XA 4DBLC 2X0IA 1JB9A 3K8YA 4GGOA 2D8MA 1H3FA 2CMHA 4WY2A 4DCVA 2CVFA 2J3LA 3LRTA 3U56A 4C01A 1M66A 3FRIA 3EC2A 1PR6A 1X80B 2J0UB 5JLAA 2CW5A 4BNXA 1KWKA 1OFGA 1XLUA 5ALEA 2P40A 3TQHA 3CLTD 1VB5A 3HWRA 4FJ2A 4ZVQA 3LLCA 3CUWA 4BC0A 5JAZA 1XF9A 1XMVA 3VGJA 1XALA 3CUVA 3LDAA 3M6WA 3Q6IA 1E3IA 4N01A 3C3EA 4JSYA 4RKYA 3TQTA 1KEKA 2V0GA 1AKWA 2J46A 5AUPB 2WIJA 3MJVA 4PLTA 1FZTA 1J99A 1U9IC 3X0DA 2GAJA 1E8MA 4ON9A 2X5XA 5B6PA 3BC1A 5E4TA 3E7PA 2JLBA 2VF8A 3PTZA 3KO8A 3SX2A 1EHIA 2DWQA 1QIEA 4R1OA 3PC8C 5TMBA 5D86A 4GP9A 2JANA 2PY6A 4NE2A 2NV6A 5AKGA 4LTNA 5EMHA 3TW4A 3W3ZB 3FYTA 5LYJF 2VI5A 1N2XA 4L8VA 2PLWA 1FRVA 5K0TA 3GNTA 2QMYA 5HR5A 5B2ZA 1KXZA 1D1QA 1T5LA 3JYOA 1ZU5A 2HNAA 1RYFA 2KBEA 3E5RA 4TS9A 2ZBRA 1FS6A 3L1JA 3TVDA 4F84A 5EJ8A 5AIAA 5IX8A 1Z18A 2JJ8A 4N40A 4QOJA 1I1QB 5AOVA 1JEJA 3LY8A 2WEKA 3N6RA 2TYSB 1D1SA 4OD0A 4G81A 3VMFA 3RSGA 3ZY6A 1UDRA 1XGKA 4OTZA 2NTVA 3EOZA 2W22A 3VYSB 4D5GA 2C7PA 2QX7A 2MU1A 3O4RA 3PGJA 1PK7A 4RORA 2A9RA 3QOWA 2J9YB 4LE0A 3K30A 1WUYA 3LYHA 2X0JA 1C4WA 4OXIA 4ALLA 4EK9A 1QOPB 1JZQA 3C74A 3DJFA 1YZ3A 2A1UB 2WJZB 3OTGA 3NHWA 5EKDA 2ZIXA 1MB4A 5JECA 7AT1A 5F3RA 1TQHA 2GHRA 3TNYA 2QTLA 3FTPA 2N75A 1NP6A 2IQIA 2RARA 1ZA1A 5FTNA 3X1MA 4BS9A 2ZRPA 1B42A 2ONZA 5IJ9A 2COKA 2PFKA 3USZA 2WU4A 3L46A 1A1VA 2QX8A 1CE8B 3VR4H 2LUOA 1FP4A 3QLEA 1EWYA 4BKUA 5HKKD 2FP4A 3N2LA 4MO9A 4AJHA 4R9SA 4QSMA 4BO4A 1A7JA 4IHAA 3TNLA 1LEHA 1YS1X 4RTNA 3H87A 5F52A 4YY3B 1VBFA 2G9UA 2OB1A 2RGAA 3D1LA 3U3OA 5I5EA 2W0MA 3HA7A 1EJ2A 5FYQA 1Y37A 3H3JA 3TJZA 1Q11A 3AYXB 4EYOA 4W9MC 3DSRA 3L6BA 1XMIA 4H1HA 2WLSA 1NDUA 2ZJ6A 4DWWA 3RHSA 1A77A 1RNLA 4ENQA 2RJOA 1SU6A 2REQA 3VO2A 4ID3A 2GT1A 2QUHA 2WYOA 4IVRA 4UHCA 4GE0A 4UW9A 4TMYA 4ZA2A 1VE5A 1SCDA 3REOA 3VPHA 4H15A 4EGCB 2VZ9A 3L93A 4YUYA 3S1SA 5AW5A 1EIWA 3T34A 5L40A 5A3SA 3SZOA 2XGJA 3WLTA 3QVVA 5DLQC 4WACA 2A5YB 4ZHQB 3AF4A 3SR0A 5ENDA 3VR5H 1GEEA 4LJ8A 3UIEA 1JILA 3DYVA 2QY6A 1QFYA 2Q5EA 3G8AA 4XJXA 1DU4A 3OT1B 4ZO8A 2GD0A 5JJLA 3TOSA 3A6ZA 1PVVA 3QVMA 6CHYA 1A9PA 3BSWA 2LWIA 2IYVA 2SNIE 3U7GA 2FRDC 1JFLA 1XRRA 2W93A 3VNSA 3LH5A 4CMIB 4EZIA 3D59A 1QOQB 2J3HA 1XLTA 2R00A 3IDFA 5CEJA 1EDOA 2IYQA 2QORA 3IAM6 4PBRA 3HCPA 4AJ9A 2HLNA 4HB0A 4P80A 1JPJA 4Q4HA 1E9DA 4QXRA 3WL7A 4DDWA 3P9XA 1ATZA 1LBTA 4E14A 1Z07A 3FVQA 4I1YA 1EB8A 4ND8B 4HTAA 5KHAA 3UICA 4D26A 3UHPA 4KKXB 3ESDA 5EKTA 5BSWA 2OXCA 3B89A 3GH1A 4UZEA 1QLWA 4HNGA 4WNAB 4KZKA 4N7JA 1SOWA 1WUTA 3ROGA 3TDKA 3HB5X 1AKUA 1U0NA 4B79A 4CTOA 3EPHA 4QUJA 5JSZA 3FHTA 5JAQA 4KUGA 3PKIA 5A4IS 1VL0A 3FLMA 2VRCA 2I4RA 2BONA 2KPOA 3P26A 3NWPA 4FSXA 3HDHA 3DE4X 1KDPA 1ZK1A 4LGMA 2HMYB 4YMWA 1RHUA 1C3JA 2NXWA 1YMQA 3TMKA 3GJQA 4QATA 5TQ2B 5CDFA 2H52A 2R7KA 4PLHA 1AT1A 5C37A 3KOYA 4J0FA 5BSVA 1UPAA 1GXSB 4G3XA 2WE8A 3ND7A 5DXFA 5C7IO 5I9BA 1XEAA 1E4EA 2BELA 2LW7A 4S1OA 1A1SA 4YT2A 5LP6F 3CSDA 1EP1B 2YZKA 4EPRA 3FNGA 5ELXA 1K5PA 3MXTA 3RT9A 1X7ZB 2Y0DA 4IWYA 1G5TA 2Z2YA 4MXDA 4QAQA 4R4JA 1RKUA 2UYGA 5DNWA 3WYNA 3A8TA 4Z86A 5IAEA 3V1YA 1BQ3A 2RHGB 5CFRA 4Q3NA 2XUAA 5IF9A 2I1LA 3LY7A 3A1SA 2DECA 2V59A 3DKKA 1WDMA 3A10A 2J07A 3I72A 1PN3A 1PJLA 2W8BB 4NBVA 1NMXA 1IEXA 3EGDB 3HZZA 6REQB 1CLEA 1KK3A 1VMAA 1QSGA 4JJGA 1WG8A 4DUYB 2OESA 4X7MA 4J8PA 2GASA 4RWEA 3GPCA 3PQEA 1WM1A 3CVJA 1FMLA 1GZHB 3OICA 1SCUA 1I7PA 5F64A 1HBJA 5KNDD 5C32A 4J0JA 1OYVA 1E77A 3PJRA 3IOMA 4YCAA 3T5DA 2Z5VA 1NU8A 3CXUA 3N7TA 4CM9D 2F2TA 3F67A 3HPQA 1M0WA 2E21A 1RQPA 3B3JA 4FJ0A 4HH3C 4NMXB 4YC7A 1YD7A 3VR6H 1N2EA 4K8OA 2DCMA 4RH1A 3RRYA 2I7XA 4Y0VA 1X1DA 4YRJA 4EA9A 5JROA 4B5KA 3LHSA 3CLUC 2WIAA 1ULUA 3QKRB 1VHLA 5E6RB 4NZ9A 4REQB 4DV7B 3ND6A 1H05A 3L7JA 2VZ8A 3B51X 3GR6A 5I4BA 1L4FA 5FV7A 4Q6BA 3NC0C 3WYFA 1G6OA 1Z06A 1TT7A 3K9NA 3TLBA 5J58A 3PRYA 4QX6A 1G5RA 4GNKA 1K7XB 2SCUB 1NXTA 2EKLA 2I1QA 1YS7A 4RK7A 4F6LA 1GYRA 4BEJA 3FYHA 1ECFA 4DRXB 2XH8A 3U3KA 1JQJC 1WCWA 5IKXA 2OFOA 4UASA 4MQLA 2BT4A 1ES9A 3DDNA 4S1TA 2YN2A 1QHHB 5EIEA 1Z9BA 4IV0A 4YDQA 3MMSA 1XNGA 2NU9A 2I2DA 1G64A 3BZWA 2H5EA 1V5GA 1HSZA 2Z5LA 3FBWA 5LP6C 4PZCA 1XXHA 4DF3A 2PCLA 3LO5A 2PUTA 3HO6A 4KE7A 5GGYA 1Z26A 2NV0A 5DTIA 2K87A 2W2VA 3M34A 3L8CA 2VHTA 1WMAA 2I6FA 1J8YF 3A1UA 2UVQA 4RFVA 3SHOA 1I32A 1IK4A 2V6IA 4Q0MA 1AQIA 4QYIA 8AT1A 5JH7B 2FRXA 3C3KA 4NCIA 1TO6A 1KARA 4QSHA 4CQNA 2B69A 1GLGA 4N0MA 8OHMA 2DFVA 3ROXA 1WBJB 2B20A 2H5JA 3A3PA 4IIUA 3CVYA 1QIKA 1S8OA 5CXXA 3I73A 2OEPA 1GZDA 1R0CA 2QUZA 4LOHA 1ABEA 4L9RA 3KYJB 1IXZA 1YAJA 3SLRA 1GCGA 1SZJG 2L18A 4AO6A 4RJTA 1W0JD 3GUVA 1GFWA 5E2AA 4YCLA 3FCAA 1Q19A 2Y4OA 2HBZA 4WLEA 5CYGA 1SKMA 1G8HA 4GZLA 3M3DA 1H6CA 5JD6A 2BKVA 5C8YF 1IXKA 2I3DA 1VKOA 2QRMA 5EEGA 4UNPA 5JYCA 3CWCA 3WLAA 4DM7A 3PYLA 2QSYA 3H97A 1EVZA 3EXG2 2X8WA 1MZVA 3M49A 3S0JA 4YREA 4IXWA 2UUAB 3IKJA 4H4CA 4M0UA 1YVRA 2AC4A 4MRVA 2X1MA 4JP5A 3WTBA 1ZM4A 3H5AA 1T0JB 3UCEA 1T2EA 4NWIA 5D2CA 1K8XB 2JBAA 1MMFB 4CM1A 5DX1A 1K7CA 1A5ZA 3FJYA 1XVUA 3KALA 2CFTA 1NLFA 2WWGA 3K6RA 4OFZA 4CODB 1M2WA 5EZ5A 1FLVA 1S2DA 3MLBA 4FMCF 4FGWA 1EFTA 1H3EA 1I4WA 4CG0A 2FF5A 1UMDB 2OY0A 4HS9A 1NW6A 4TROA 4WT7A 1U28A 2HUPA 4NH4A 3DWFA 3TD6A 4I8DA 3PFKA 3HWSA 2E1PA 3RNOA 1EK5A 1UOQA 3H2IA 1UBSB 2YHAA 1XFAA 1F1JA 2Z9DA 3LIPA 1VHQA 4GZMA 4LYDA 4YRFA 1NOJA 3BAZA 3RTEA 4CKWA 2J30A 5G02A 4INAA 1EGAA 1Q3TA 4MRRA 3NT4A 2ZJ1A 3W3AD 5LMCA 4G4SP 5FTWA 2J5XA 3VKGA 2PMKA 1A96A 4C1BA 3TNFA 2V6FA 3I9FA 2ZJ8A 5KNBH 5ERYA 4CF5A 2IWRA 3VC2A 3GRVA 2FLVA 3NYIA 3UXHA 1V11A 4KQ9A 1Z2PX 1CP3A 2X58A 3L18A 1L7RA 2C03A 4REOA 3I04M 4TV9B 3GRUA 1A50B 1J39A 3B6JA 5LA6F 5DX8A 1MO4A 1M8FA 4ARBA 3KUXA 1XQ9A 3FI0A 4LECA 4NYJR 4BLUA 1TEVA 2UKDA 4DSNA 5BWOA 4OHUA 2BUCA 4OQLA 1L1QA 2FGKA 1NVAA 5CCXA 4AKEA 4C7OB 4D3ZA 1YU9A 1JYSA 4C0QC 5TF4A 1F0KA 4XB6B 5DT9A 3Q7TA 3SKYA 3O83A 4LN1A 4RZ3A 4F72A 3QZUA 1L1RA 1WD7A 2ACWA 1Y1RA 2VAPA 2VNKA 2LD4A 2ZWMA 3FGOA 3VU3A 1GSHA 4Z8YA 4O4JF 4WASA 4EBFA 3CBQA 1PLLA 3JQQA 4ZKDA 1UP6A 4P3XA 1PGOA 2Q3JA 5E2IA 2V7UA 4B84A 3LVFO 3IPYA 4QJIA 3WLLA 3NOVA 4ZAZA 4BO6A 3DTNA 4MCJA 2CWDA 3CRNA 3DBHA 1KDVA 1Y7LA 4JKYA 5F5NA 5FF9A 4M0MA 4X1OA 1GKYA 1P73A 4FXOA 2B82A 1JAYA 1PL7A 4FPXA 4YB8A 2F8TA 2F9FA 3E2PA 3HFGA 4QPNA 4Y9RA 3CIFA 4OAQA 3RYIA 4LY9A 1KQPA 1CJSA 2QIOA 3DE0X 1XEWX 3DP9A 1K98A 3JYLA 4RVCA 3WKAA 4F96A 3ANXA 3CSUA 4JQOA 3KZOA 4LHEA 1F9AA 1VI5A 4Z0NA 1UZMA 4A5SA 2XB4A 1Q74A 3QVJA 4RVFA 2IPMA 1JDBC 2Y76A 1E79D 4AROA 1M34E 5HEKA 5LB2A 3BIWA 3OUTA 1HM5A 4X6LA 2A0YA 1U65A 2NVOA 2ECOA 4YRPA 1HF3A 5CB6A 2C96A 4KYTA 2NV2B 1V1RB 3LF2A 2C4UA 3LI2A 5F2OA 5K51A 2W5UA 1IZ0A 2ZTVA 4Z4IA 4MQFA 3LGAA 2YVQA 5IH3A 3L8ZA 4R69A 2Z3VA 3R7DA 4PYMA 1V2GA 3A1VA 2O06A 2P30A 5B3AA 3AHCA 3WWCA 4YRIA 3VR2A 1U02A 2PYZA 1DQPA 3Q3EA 3UMJA 1ULZA 2YWRA 2HO5A 1NXSA 5LFAA 1O97C 1ODFA 3CZQA 2P35A 1VA5A 1XPUA 1CFZA 4ZAFA 5HS4A 3PYXA 1YR1A 4OQDA 1MBZA 3AILA 4NTZA 1VPTA 2EWVA 3N0XA 3O1LA 4HNAB 2F55A 3ZHVA 1IN5A 2VP6A 3IE0A 1NC3A 3VAAA 2GZAA 4YP0A 3K53A 3SGLA 1GLNA 2J8ZA 4HKTA 4YUXA 5BN3B 5JCXA 5EUQB 4JN6B 3WNQA 2RONA 1QWOA 2RGNC 3EBOA 3ABZA 3SZ3A 1E6MA 2QLTA 3H1GA 4LDPA 1IONA 4TLEA 4AP5A 1ZGBA 2RHWA 1D1PA 2FDRA 4PX5A 4AZTA 1P17A 3G0OA 4B40A 5TF0A 1PJRA 1LCIA 2IOYA 5AI6A 1FNNA 4BLTA 121PA 2JH8A 1VE6A 2VP3A 3EXIA 1TMYA 4JL8A 2ASEA 4XIJA 2B6NA 1CIPA 1WQ1R 2X9GA 3D0RA 5DBOA 4YMHA 3D7RA 4KYUA 1QRTA 3M89A 3L3BA 4L22A 2ADFA 2HK6A 3S1LA 4NFSA 2JGJA 3O9VA 1AGRA 2X7HA 3V8NA 1I10A 2P27A 3G8BA 4BJ5A 1T1GA 2OCDA 1A2KC 3OZSA 5DGCA 5KSZA 3HMQA 3K0AB 3V42A 4UNIA 7REQA 1ZH4A 3OLZA 4LX8A 2Z57A 4UPVA 3U3JA 4D4JA 4BX0A 4UNRA 3UPTA 3KHUA 3CX6A 1L9XA 3AETB 1BVYF 2LDXA 5DKFA 4F9EA 1SG0A 4G0OA 5LZ4A 2JIOA 4J16A 3ZH9B 5KTRA 1FUYB 3L79A 1TE2A 2Z8XA 2OCPA 3HXKA 2B8WA 2OAGA 3VSCA 2O0MA 1TF7A 3VAYA 2P2DA 3OM0A 3A25A 1P6XA 2NUPA 1UJMA 2JZCA 3LNTA 5K7SA 1PGQA 4YIKA 1NVKA 2Q4BA 4KIWA 4DTIA 5T57A 1NE7A 4QLAA 2H07A 1HZZA 1RP7A 2N47A 2P79A 3M2TA 3NANA 4I8XA 1QIGA 2QLBA 3K72B 2A4MA 2A9PA 4YQZA 4ME6A 3SQLA 2CXXA 3V1KA 1Q3HA 3R3HA 2GKOA 3QOXA 1AX9A 2Q41A 5DWDA 2CEAA 3G8YA 4R1SA 4MUJA 1ZJ4A 2WIFA 4KVGA 4IH4A 4TT3A 3ELYA 3O3CA 4NQRA 5AUQA 3O4JA 1KZ4A 1G6HA 1MAAA 1OFUA 2PS9A 3GJ7A 521PA 3T41A 2BJWA 5ALPA 4TV8A 4EF5A 4DSAA 5F9FA 1B6GA 2WF5A 1MH9A 4NZYA 3BKWA 1B00A 3TWOA 1D2HA 3W2EA 4DV5B 3LCRA 2DHDA 3HYNA 2BFFA 3D2LA 3KT8A 3NM6B 3RUCA 1CPYA 4E32A 1EUQA 1QORA 3B8EA 1D4FA 3C14C 4OATA 3PR3A 3ZDCA 3JARB 5AQ1A 4IUYA 2EG5A 3N0WA 4IWNA 5EQJB 3ZCTA 4ETNA 5AUOB 2E5LB 2AMYA 3TBHA 5L7WA 2FPMA 3IPAA 3KZVA 1NJ2A 4DZTA 1RIFA 3F73A 4MPRA 1UDAA 1KI3A 2CNNA 4PW0A 3VQTA 3G2HA 3K0FB 1KI8A 3ZWWA 2V7VA 2FZWA 4MCHA 4M9QA 3CZRA 1E6CA 3B70A 2QI9F 1ZJZA 4Q7LA 4UKDA 3VNQA 1TAQA 3F98A 1LWOA 2IZ0A 3AXSA 3MUNA 4DGSA 4XUEA 2VXBA 3I9MA 2V7EA 4JEHA 4OHZA 2HOQA 1PS0A 3N8GA 2O1SA 1GTSA 3C8UA 2IV7A 2VF5X 4J1TA 3P0EA 4FTWA 4IX9A 1R18A 3OO1A 1G2IA 3GUCA 4IQGA 2JLYA 2IYFA 4C4XA 2IOFA 3QWHA 4IYRA 5JADA 1SULA 1WSWA 2AFVA 1CQJA 1VE9A 3G88A 4PRZA 1WL8A 4X00A 4Y9UA 1KOLA 1NW8A 4MPTA 2BGGA 1RT9A 1B15A 1KU0A 2OKCA 3HCEA 3EXHA 3I0ZA 3WIUA 5BNIA 1Q3KA 2V5UA 4R9RA 3D7NA 2WD7A 3KIPA 4S3MA 2YY7A 2QAGA 4LCEA 1ZHFA 2C57A 4JBHA 4DJTA 4YS6A 4DLYA 4HVCA 4AKGA 2HU5A 4ZI3A 2EBWA 1YI1A 2QF7A 4UD6A 3TGWA 1FNBA 2Q5LA 4K6HA 4Q47A 4RF5A 2CE7A 4NBRA 5GONB 1IU9A 1BQ4A 4LOIA 3ZBTA 2GPBA 4PNHA 2TSYB 3BB1A 1PJTA 1SZPA 2OGZA 1ZDMA 4YRGA 3EE6A 1HLPA 4F04A 3L8FA 5KDLA 2W70A 4DA8A 4TXJA 2WQ6A 3GP5A 1J07A 2GM3A 2KQUA 1NF8A 1R8QA 3IE1A 1KVQA 3QE3A 4B1FA 2D74A 1HC7A 4ABTA 3DDZX 3HFJA 4PHGA 2QLLA 1CIVA 1Z0ZA 3OU2A 5EWJA 4ILKA 3JWPA 3ABRB 1M34A 5K6RA 2X15A 3AR3A 3Q1KA 5J2UA 2OPBA 3WIOA 3LQ4A 3FWNA 3QE9Y 1WF3A 2XD9A 1N2CB 4MI9A 4LJLA 3BM5A 1T0IA 1P2VA 2M98A 4D74A 4XQGA 2AOTB 4HNVA 4KIJA 3ILHA 4URUR 3SMQA 1IWPB 1ACJA 3JQEA 1E0SA 4MRSA 3ESZA 4U7FA 2F1HA 1S2NA 4R8RA 3BH7A 5EPUA 3JQFA 2Y2VA 4F7DA 5E6UA 3B82A 4MARA 2H92A 4BAZA 3ICEA 4JBXA 3BSSA 2CXOA 3AERA 4HC4A 2A5DA 2QI9C 4B73A 4BRSA 3A58B 4M9RA 1NAIA 1FA9A 5KHOC 1G9TA 3LIIA 3G6KA 1XUOA 1XCGB 4GI3A 3THWB 4QJ5A 3MS2A 2VCHA 1EXDA 1HLDA 3EEQA 4ZK6A 4QXOA 1WTAA 1G16A 2IDJA 1QH1A 1T3ZA 2PS3A 2PWZA 2YINC 2AOUA 2CFOA 1JV2B 2RMKA 1OFHA 3EXG1 2VPTA 3T5GA 4RQUA 3SF8B 2OO5C 1QGYA 5CEFA 2FN7A 3GEIA 3AYZB 3GEHA 4KFTA 5EMNA 2EF1A 3A1CA 1N9GA 1QZTA 2PMCA 2WJJA 1CR0A 4KX3A 4XVQA 4JLWA 3BSFA 3BXZA 5C53B 3K09A 3ITNA 3LP5A 1OPXA 3AEKB 3IQWA 4LK2A 1SC6A 2CXPA 2R1TA 2R7NA 3C8ZA 4H3VA 4U2DA 4X85A 5LXTB 1IY8A 5MF6A 2Y6UA 5D51S 2F1IA 2AFHE 1YQEA 1RCUA 4LJAA 1MQ8B 3HKBA 1UXOA 3ADKA 3LPMA 3X1DA 3ZU6A 4BY9E 4DGQA 2D7CA 1E1YA 5U1PA 1TO1E 3OEEA 3WO0A 5B3JC 1S2IA 3O47A 1QRAA 3R5XA 2PXCA 4MVJH 3C6BA 4B71A 4DPLA 4NENA 4BPRA 1LDEA 3THSA 5JO0A 2B1GA 5JH7F 1BMQA 4B3DA 2CNWA 2OAP1 2H2IA 4NK5A 1JHMA 2EP8A 3CE9A 2ISSD 1QKKA 2OVBA 4X91A 4KO8A 1QDLB 5ER9A 5JRJA 3PXEA 2HEIA 3GA0A 2PFSA 5JMOA 2IHJA 3QENA 3UHOA 4BO1A 3B2EA 1Z5VA 5FQOA 2E9SA 4QVGA 4PYJA 4LOLA 1ZHOA 1AK2A 2XCOA 1NYRA 1ZY2A 2YVUA 1JPUA 1T8WA 2WT4A 5EMKA 5CBPA 3IVAA 4HYQA 1VL1A 4JITA 4X7BA 3FXAA 2X77A 4W1RA 5E0KB 2XZDA 3G0IA 3I4CA 1BN6A 4BP3A 4OQ4A 3UA4A 3BHMA 2A2ZA 1NYTA 1SQGA 2JB9A 1A71A 1W75A 1GITA 3FHLA 4AB1A 5GZ1A 2XCRB 4UMDA 3N9IA 3E3LA 5INTA 4TVKA 3Q7EA 3ROEA 1RJWA 5FTLA 4RVGA 3A1DA 1KR2A 3ESBA 5EEHA 3WYGA 5BOSA 4RO0A 1JMKC 4ENPA 1EKXA 2XNSA 3LDHA 4EHLA 2XJ4A 4RZSA 1IHYA 5JR3A 1BW9B 5H68A 1E3EA 3JVIA 3EJ6A 4LZLA 4KQFA 1EVQA 1Z62A 4ZMSA 4WW0A 3AESA 2OGUA 3EVDA 3KFLA 4JGIA 3GT0A 1DBWA 4V0QA 5DLDA 2H2GA 4LNAA 1GG9A 2RK4A 3QVXA 4UUBA 2C4TA 1ND5A 2Q3EA 1EGMB 4LZOA 4WXMA 3SF0A 1VKZA 2VNIA 3U4DA 3UGKA 4B43A 4FHDA 4PGMA 3KFXA 1V5IA 1PYDA 4R3NA 4CQMA 5IT0A 2FF7A 3H2SA 1J25A 4JEIA 5FUBA 2VTBA 3DW3X 1W88B 2GJKA 4M8SA 3ONVA 4ITUA 3UBMA 3V9PA 1GN8A 2PT7A 2V45A 1TU4A 1Z0KA 2JIQA 4CEIB 1XZFA 3C24A 1K0FA 1EX1A 1ZK3A 3RHZA 2QW1A 5A05A 3FVTA 5G0UA 3HVIA 1WY5A 4EFLA 2AL7A 4X3PA 3KOOA 3RFCA 4QA9A 3SJ7A 3FE2A 5DBHX 3VVLA 4ZI7A 5JCOC 4X63A 1ZG3A 1P6UA 2YJNA 3TW0A 4EJ0A 1PJ4A 2OCIA 4GR5A 4YJHA 2PKEA 2E48A 1OJ7A 3DOHA 4TV9F 3A3YA 1FSSA 1XTQA 2UAGA 2QT9A 5BUCA 1FLAA 3JD3A 4GRDA 1Y4DE 4F86A 1XRMA 4NYIQ 5K20A 3FPKA 4DLWA 1WXGA 1Q0UA 4ZV4A 1NMSA 3RWBA 4P35A 4YJ2B 1C5KA 4IINA 4UAJA 2R6CA 2BM8A 2Y0CA 1Q7RA 1E62A 3TXAA 4QOFA 3ZZNA 4UFOA 3A28A 2YOGA 2QM8A 2OWDA 4FNGA 4RY0A 4LHZA 5B2EA 1X15A 3PVSA 3HDQA 1F1BA 3AL3A 3R3ZA 4IZHA 1RBZA 2VDWA 2IPAB 2PZMA 2SKDA 2XT9A 3QVWA 5CPFA 4ESOA 4F56A 4YRAA 8GPBA 5GZ3A 3A4YA 2IHUA 1Z37A 5EC8A 4KQJA 3CVOA 4ETIA 1LBIA 3PUIA 2R9VA 5EJIA 3C16C 2V0CA 1E0DA 4ARSA 1OH6A 2Q1YA 1A9XA 1T35A 3DGFC 2WY2D 2IIPA 3CU5A 4YV7A 1N9ZA 3FFTA 5LUAA 2WJGA 4Q3AA 1XDBA 5AOCA 1WZNA 2OILA 1RS0A 4M46A 1PEDA 1Y8RA 3TB6A 2QSJA 2NTJA 2JIZA 1M2OB 3KQWA 3D5QA 4NOLA 2X6TA 4ARCA 4PTLA 3CGGA 3BBLA 4LBWA 2P75A 3DC2A 4YUZA 1XI2A 4IJKA 4ZP1A 3IJPA 4LZJA 4M60A 4OHWA 2A8YA 4X97A 5BYKA 1VZ2A 3KAJA 3COVA 1GAQA 1SU4A 2IWHA 1IEQA 2AMLA 4EOGA 1KWGA 4F92B 4NEQA 5JWHA 4H35A 1QC5B 1SQSA 1O54A 2WR8A 4TMZA 5BXQC 1N7JA 1K4MA 2PU5A 1EZ1A 3CKYA 4M22A 2R47A 5CK5A 1K88A 2H4JA 4Y2QA 5A9SA 4LNUA 2EFDB 4BNKA 1JR3E 3W34A 1YR3A 2YICA 4TQ9A 4O29A 3TTXA 3ETDA 1P39A 1RTKA 3H9UA 2DFKB 4QBHA 3IQXA 4C7MA 3IE2A 5LQNA 4WZAE 1CZKA 1IN6A 1TVEA 1Q15A 3CJQA 2A5JA 4DV0B 2B2NA 1V9CA 2Z6AA 3LWNA 4IV5A 2JEOA 2Q6OA 4E4TA 2V9CA 4DV1B 5F3WB 4MKHA 4DMHA 5DGDA 5BWBA 2W2NA 4HY3A 1AHIA 1VE7A 4DQKA 2X8JB 1HEIA 1PWEA 3DLTA 4EG6A 5JQGF 1SU7A 2PYDA 4DBLE 4RQBA 4KAFA 4G5QA 5ECWA 4V0SA 5K0BA 2DF8A 3E2MA 1U7TA 1ZI8A 1K6EA 4IDPA 4X8MA 3GJZA 5CTJA 2RCYA 1G7TA 1Y5RA 4BVEA 1WV0A 4P4GA 5EJ2A 3A6JA 1G8JA 2D1QA 1AGXA 4DAEA 4BFZA 3I9OA 4O2LA 5AKEA 3GPIA 1VLMA 1HQDA 5FI5A 1XZBA 4YRDA 4UM9B 4ZYVA 2BEUA 3T5PA 2NVUA 3UMBA 1EPUA 1KJWA 5DYGA 1GQQA 4DIMA 4F4JA 3J81A 1JEYA 3GGDA 3S29A 4Y9TA 3AUFA 1O4WA 4KQIA 3JQBC 1E64A 3IUPA 4IDHA 5JZVA 3AUYA 4QHSA 4AZVA 3I5XA 2DHCA 1YO6A 5BR4A 4H3KB 5D7NA 1RPNA 3HBFA 1C9KA 2AJCA 3MYRA 4PCUA 3ER8A 1XZ8A 1CW2B 4WKNA 3AZOA 1KMCA 1V47A 4IP0A 4XA8A 1QV7A 1Q83A 1P9LA 3ELUA 2QNRA 4N4AA 3HU2A 2IVFA 3ONWA 2YFQA 4KGDA 1Z8HA 4ZO7A 3VNUA 1IUOA 2A86A 2H1FA 3PDCA 3PS9A 1UZUA 1GPJA 1VBNA 2JIRA 4BVJA 1O95D 1EVJA 3N2YA 4URVR 4HR7A 4JODA 4MPPA 2IS1A 5THQA 2C00A 3P2JA 1NC1A 4M1KA 1G0OA 5J4VA 3LSTA 1G41A 2DG2A 3GYGA 3UFBA 3LHFA 3KWJA 4O2RA 1K8QA 4WNYA 3SBDA 2QD3A 3UMCA 2QRHA 1E96A 4JP1A 4ZZ0A 3O6VA 1J33A 3D7MA 1OW3B 4KIFA 1PTJC 5TE9A 1MB3A 1TA0A 5JANA 4GM1A 4ZMRA 2NOAA 3NALA 4XX0A 1H2HA 1EA5A 2H54A 1U0JA 3U17A 1FDIA 5J1SB 1XAGA 3N59A 4EG8A 2OZKA 3PL5A 1VDMA 4F97A