3SFEB

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and thiabendazole
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
b'APRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3sfeB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sfeB01
1OQRA 4WQMA 1E0ZA 4JWSC 5EE3A 3W5UB 4YT0B 1FXIA 5AUIA 1UWMA 5G5GA 1GTEA 4HROA 1GT8A 1N62A 2M56B 1IUEA 1GTHA 1TKGA 3VRAB 1QLBB 1KF6B 1N5WA 3AE1B 4YSYB 1SIJA 2BT6A 2N0SB 4HRSA 1YQ4B 1TJEA 3P1MA 2CJOA 1I7HA 3AEFB 3VR8B 3ABVB 3P4SB 1ZUD2 3AE7B 1L6UA 1PUTA 3CIRB 1TKYA 1L5PA 1JALA 3B9JA 3BIID 3P4QB 3AE2B 4YXDB 2OHFA 3DWMA 2WLBA 1T3QA 1N61A 2G1EA 2W54A 1J7AA 2WS3B 1N60A 1FFVA 1NEKB 1WXQA 2BS4B 3P4PB 2LEKA 3AH7A 3P4RB 1EWYC 1QOFA 1XLQA 3KWLA 4LTUA 3AEAB 1E9MA 4JWUC 1XLPA 1TKEA 1NYRA 1DGJA 1L0VB 3AM9A 3ETRA 1FO4A 4ZHPA 4ZOHC 3EUB2 5EE9A 1FRDA 2MJDA 5GXGB 1V8CA 1QOGA 3B2FA 1KRHA 2DWQA 1XLOA 3HUIA 1CJEA 1FFUA 1DOIA 5EE1A 3AECB 1PDXA 1E6EB 4USAA 4N59A 1QF6A 1XO3A 3AEBB 2M19A 2W3SA 1ROEA 3AB5A 1NVID 1TYGB 2L83A 5EE0A 2K22A 1QOAA 2PIAA 5H8YE 2WDQB 1PFDA 1F0ZA 4C7ZA 1FRRA 2MJ3A 2QJLA 3ZYYX 5C2TB 3NVYA 1FM0D 2QIEB 2DBYA 1JROA 2MH7A 1GPXA 2WU2B 4N6EB 1N5XA 1JW9D 2HTME 1FIQA 2JQRB 2PVOD 3LXFA 3DWGC 4P6VF 3FAHA 1E10A 4US8A 2W3RA 2B76B 3PO0A 3AV8A 2WDVB 4WWMA 2PVGC 1FMAD 2E3TA 3WCQA 1DOXA 2H88B 1WRIA 4N58A 3SFDB 1CZPA 3P63A 4ZHOA 2CU3A 1YJIA 1JQ4A 3HRDD 1DOYA 1ZP0B 1QT9A 1B9RA 2EKIA 2Y5CA 3AMZA 1RFKA 4FXCA 3AE4B 2Q5WD 1J7BA 3VR9B 3NVVA 1J7CA 1H7XA 1YQ3B 4YSZB 2PKOA 1RYJA 1ZOYB 3AE3B 1V97A 4A9AA 1OQQA 5C3JB 4YTPB 2WQYB 1FXAA 1NI3A 1KFYB 2H89B 3AE8B 2WP9B 1NENB 3AEEB 1AWDA 3CF4A 1JWAD 1NYQA 1ZXIA 2JX5A 3NRZA 5H92C 1WYGA 3SR6A 1R7SA 2L52A 1WWTA 1SB3C 5AUKA 3LB8C 3NVZA 1N63A 2K5PA 2W55A 3HVZA 3SFEB 1JWBD 2AX5A 1VDVA 3W5VB 3AE6B 3B2GA 1QOBA 1XLNA 2BS2B 4YTNB 4JX1C 1E7PB 4YTMB 2WDRB 3L4PA 3AEDB 3VRBB 1AYFA 3NVWA 5G5HA 3AEGB 4KX6B 1GAQB 4C80A 1VLBA 4US9A 3RPFC 4IDIA 4C7YA 5MPOA 4YSXB 2ACZB 2MJEA 2WU5B 3NS1A 1H7WA 2FBWB 3FC4A 3AE5B 3AE9B 1RM6C 1WGKA 3CWIA 1RWSA 1L6VA 1VJKA 1OFFA 1YJJA 3AN1A 2CJNA 3W9CB 2KAJA 2BS3B 2KMMA 2K9XA 1A70A 4ITKA 1JRPA 1SF0A
chains in the Genus database with same CATH superfamily
2WXRA 4ZRKA 1P9DU 4M00A 2QSDA 2KNBA 5D3DA 5G5GA 3BYYB 5HKHA 3EFCA 4BOZB 4PT5A 3VRAB 4HRSA 4KDLB 2MHJA 2DZMA 1V6EA 4A6QA 3WALA 1K50A 4YXDB 2CHXA 2V9HA 3ZIMA 3UGBB 3BZDB 4RM9A 2JPHA 1KRHA 3DBSA 1F77A 2NPTB 3UF8A 1V49A 1ROEA 2LUMA 2L0TA 4C7ZA 4TV3A 4LNKA 3DQVA 1D5MC 2K3UA 2AQ2B 3RNCC 3H8HA 2CU3A 1AN8A 3X23A 2BYTA 1YJIA 2KC1A 4ZYSA 3Q6BA 1H7XA 1HTQA 4HPPA 2MEKA 3SU8X 1NI3A 1LXDA 4KKJA 1G6JA 2JX5A 1ZDXA 3ZNID 2WWZA 3VQIA 1EU3A 1Q10A 4TMAB 3QA8A 3W5VB 3DBRB 5E6PA 4GXBA 4TSSA 4W9FA 2ZW1A 4C80A 3ZDTA 2LXCA 2JRHA 1P7EA 2RD0A 3W1SA 1E7UA 2AL3A 1WGKA 1RWSA 1L6VA 3U30A 3E9SA 2QDFA 2CS4A 1FNVA 4AS1A 1KTKA 3IG3A 2GOWA 5G55A 4BZAA 3ZLZA 4XX5A 4CHKA 4M02A 4WWPA 1I4QA 3AE7B 3CIRB 2YLMA 4DHJB 2VH1A 4XYCA 3AH7A 3P4PB 4XE0A 5D3IB 3TCAA 1KOTA 1SIFA 1V9JA 3ETRA 4ZOHC 2JZ3B 2LGIA 3AULA 1QOGA 3IBEA 2KZRA 2MP2A 3N1ZC 4FULA 2N7JA 2VZKD 2W3SA 1GNUA 3PHWB 1R4NI 1RLFA 3B1LX 1E5WA 3AXCA 3HVDA 4HCPB 3A4RA 2V4IB 2KDIA 2N7DA 2PVGC 1FMAD 5D6JB 3DVNV 4P1BC 2REXA 1IGCA 3QIJA 1ZP0B 4JIOU 1L2NA 1E8WA 4RNAA 3IXSA 1YNTE 2KKCA 4IKGA 3RULA 1ZOYB 1QQRA 1WZ0A 2L76A 3AEEB 1D5XC 3TBLD 4WQOB 2UYZB 3UQBA 2K5PA 4LLGM 1C1YB 1TS5A 3L0WB 4JX1C 2J0KA 1YN3A 4M01A 3DVGX 3VRBB 4KX6B 3TEWA 3RPFC 3NUHB 2ACZB 2HE7A 3NS1A 4JPSA 2N4FA 2FCSA 3PLVA 3RCZA 3E56A 3FILA 3NG0A 1OFFA 2K1FA 4A90A 4MM3B 4FBJB 3QARA 3PGEA 1E0ZA 4RM8A 4XDDA 1ZKHA 3MJ5A 2V4LA 5AUIA 2PMVA 2LGSA 1WJNA 4GU2A 4MGZE 3TUOA 2V3PA 2G4SA 5G2NA 4RGNA 4FLHA 1SSNA 1UNSA 1I4HA 3AE2B 4IM0A 3Q8EA 1BUIC 1UBIA 2ZPNA 3AU5A 1EWYC 2ZZPB 1NYRA 2GBKA 2C7NB 2WGSA 4FADA 2MW5A 1TY2A 4NJ6A 2MJDA 2GLSA 2J52A 3HUIA 5EE1A 2N7EA 3Q69A 3APFA 1WR1A 2KWDA 2AL6A 1TS2A 3U7DA 2G4DB 2WDQB 3BVGA 5JHAA 1V2YA 1WI0A 2NTSA 2M17A 1E7VA 2EMTA 4P6VF 3ZTCA 4ZYNA 1E10A 3DBRI 2WXKA 1C78A 1WGDA 4N58A 4ZHOA 2DNFA 2D2QA 1FXTB 1X1MA 3MTNB 1DOYA 1B9RA 2K6DB 1KJTA 3TEYA 5T8IA 4IWPA 3AE3B 1ISNA 1KFYB 2WP9B 1EUVB 2KMCA 4AQ7A 3ZNGC 2ZJDA 4WJPA 2GB1A 3OLMD 2GMIC 2IO2B 4B0EA 2XK5B 2AX5A 1JWBD 3L4PA 5G5HA 2LD9A 3PS6A 2EMSA 3U4EG 2I1KA 2Y5BB 1Q5WB 4LNFA 3HHMA 3AE9B 1RM6C 4ANWA 5HHDG 5GMVA 1KH0A 3W5UB 4YT0B 2R2OA 4EE2A 1GT8A 5J18A 3NJTA 3DPDA 4URKA 3NOBA 5LXHA 1HTOA 2HJ1A 3WAMA 4K7SA 3PTFC 1V5OA 1D3ZA 3W1SC 3VFKA 1I4RA 4LK0M 2RDBC 3BWUD 3OWEB 1E9MA 2BVCA 4X57B 3BVMA 5J17A 3AM9A 3MHZA 3ALBA 2KC2A 2DWQA 1KLVA 1UWXA 3NHEB 4MGYE 3L16A 5LLIA 4KIKA 2L05A 1SJED 5C23A 1J0GA 1PFDA 2XEWA 3IAM1 2RDGA 2YEPF 1Z5SB 2AQ1B 1WSPA 4E3CA 4ZRPA 1ESFA 2WXJA 3MC0B 3ZRCA 2L3ZA 4GDKA 2ON8A 1U4AA 2KOXA 3RNGC 2I38A 3VHTC 3VH4B 1L4DB 3R66C 4M0WA 1XQQA 3SR6A 1F2RI 4TUUA 4NQLB 2GRIA 2FUHB 1V1OA 2KDMA 3DHIC 1HZ6A 1SE2A 4PK1A 1V1PB 3PZ8A 2FBWB 2JYTA 2NVUI 4A8XC 2D11A 1VJKA 3QCAA 5L95C 2KAJA 2BS3B 2KMMA 4BKSD 5E6JA 1OQRA 3U8ZA 2N9EB 1VZ6A 1ZW7A 4N9F4 2KD0A 1ZXHA 3ZUNA 1ZDVA 1SE4A 1FNWA 3CF6E 2M56B 1RFAA 2INPE 4YSYB 4DBGA 4W9EA 1TJEA 3VR8B 4MGKE 3H1UA 3IT6B 2ASQA 2W54A 2LEKA 2AQ3B 2BS4B 2BGFA 2MRPA 3GB1A 4FA6A 2DYMA 4XWTA 4JQWC 1E8ZA 1Q0WB 2LMCA 5BYRA 2IO1B 1P7FA 2FIFA 3IFWB 3ZNZB 1TZOA 4ZRQA 4A3OA 4N59A 2M19A 1LGRA 4M8MA 2O6VA 4G3XB 3D32A 1D6EC 3I3TB 3JVZX 2NMQA 4MM3A 5DPWA 4DWFA 3HK0A 2MX2A 4AJYB 3P63A 3S2AA 4RGTA 2JU6X 3BY4B 1YQ3B 5BYSA 3QQ8B 2EKEC 2QC8A 2H89B 1AWDA 3A33B 3R7RA 4GSWA 3BYTB 2J7QB 2NTTA 2HJ8A 4NJCA 1QOBA 1WR6E 1K52A 3RUIB 3IAS1 1AYFA 3MC8A 4GB9A 2KFKB 4AP4C 2IY1B 4EUTA 1UUPA 3Q3MC 4WWNA 3URYA 4GGQA 2K9XA 3RFZB 1Y56A 4B6WA 4JWSC 4KGSA 3DVGY 1FXIA 4B9KA 1E8YA 3W1YA 1WJ6A 2OOBB 1TKGA 4MEMA 2NBWB 5HG2A 1L6UA 1TKYA 1JALA 2L7RA 2OJWA 5BMIA 3Q8FA 2KWUB 3MHSD 2KN5A 2LGXA 1DGJA 1FO4A 4BAXA 3OJ4B 1VD2A 1YOVB 3B2FA 1UGMA 1XO3A 4JGHB 2BYVE 3KUDB 3L10B 3PHXB 4OVZA 4FJVB 2DBYA 1PGBA 1XF5L 4I6LB 4B95A 1M94A 1K8RB 3M63B 2KYWA 2B3AA 2XBBC 3Q14C 3PT2B 2Z59B 2BYEA 1J7BA 3W2DA 4PS8A 1JWUD 1Y8RC 1V5TA 1OQQA 2GBNA 1JWAD 1B1ZA 1T5XD 2NBVB 2MBBB 2IO3B 2LI5A 3O65B 3NVZA 2JVCA 1PQSA 2KJRA 3L13A 5IN7A 3T9LA 4ANVA 4K3CA 4LNNA 4P16A 2PEAA 3C19A 1GAQB 4MACA 4P1CC 2K6QA 3B08A 4ZRJA 2KQSA 2UWQA 1MI0A 2N1WA 2O6VD 2LGDA 3A4SC 2O2VA 2ZW0A 3DOWA 1BMLC 1EWCA 4KGRA 3A9JB 4MH0E 1WGRA 3ZGZA 3A9KB 2YVCA 3CMMB 2FIDA 1H4RA 1PYWD 1UF0A 3N32A 4W9JA 1WH3A 3P1MA 3VVWB 1C4AA 2Y5PA 2INDC 4GOCA 1IBXB 1EF5A 1WXQA 4MT5A 2BYFA 2KTRB 2N9XA 2IGDA 4WH4A 5HI1A 1MHHE 4EZLA 1EF1A 3QJZA 4IM3A 3ZRFA 2ZNVC 1C4CA 5LXIB 3EA6A 2DLBA 5DPRA 1XCQL 4IW0A 3EHVA 3T3OA 2QJLA 3LDZE 4S17A 1GOZA 2K8BA 3DHHC 1MJDA 1FIQA 2MBOA 3VUXA 4O1NA 4DDGD 3PO0A 4WWMA 3WCQA 1J19A 4BVUC 1BXTA 4JL9A 5IA7A 1RFKA 3VR9B 1WRDB 3MC9A 1XCTL 1FXAA 4HWIB 1NENB 2M4NA 1WYGA 3QC8B 2KX0A 4DK5A 5CX3A 1SB3C 2D07B 3ZJTA 4XDCA 2GBJA 3JSVB 3BK1A 2HD5B 5TSSA 4YTNB 4Q2JA 2KO3A 1RRBA 2K8HA 1LM8B 2BKRB 3OJ3A 1VLBA 2D5GA 2FCQA 2Z8LA 4DHZB 1WZ3A 2C9WB 3WANA 1WX7A 1JRUA 2C7HA 3AE5B 1WFYA 1OEYJ 2N9PC 1UBQA 5AEKB 2M0XA 1JRPA 4AJWA 2L8JA 3GP7A 1FEHA 1MPEA 2ZNVB 3DBHB 3KW5B 1SGHA 2FUG1 3Q3NC 2L32A 4HJKA 3ENEA 4NPNA 1ZPSA 1AARA 5AZHA 4XWWA 3N30A 4WJOA 4F7ZA 1WJ4A 1NEKB 3APCA 4IC7B 3KWLA 1S1QB 1TY0A 2WXMA 1OQYA 4J3OD 2J53A 2DYOA 1V8CA 3ECIA 2I2YA 3IT4B 5D94A 3HM6X 1DOIA 2BB6A 2BBCA 3ZKJC 4GMVA 1TYGB 4WAFA 5DPSA 1YX5B 2DENB 4RF0A 3EECA 1YN5A 1WMHA 3T8MA 1D4BA 1PGXA 4AUQC 3LXFA 3R2IA 2Y3AA 4EOYA 3L17A 2LWPA 1WE7A 2MBHA 3H7PA 1KLGD 2I1JA 3KYDD 1NI2A 3PRMB 1GC6A 4FHKA 4GDLB 2WXLA 2C60A 3QHTA 1E90A 2WXNA 2VH2A 1ENFA 5I4DA 2L52A 2AWTA 2IBIB 2KLGA 3TSSA 1XT9B 4LDTD 1OTRB 3RZWC 2W55A 4C4VB 2DAJA 4ICVA 5E6OA 4CO7A 4S0RA 3A1QB 1PGAA 2J0MA 3BINA 4MJSB 2BF8B 2IO0B 1Z2MA 3VDZA 1WXSA 3DHGC 2BKFA 2KK8A 3N1YC 4NAWB 3W9CB 3RMKC 4TQ1A 3Q8AA 3ML8A 1SF0A 4C56C 1H8CA 1L4ZB 4FJZA 2KVZA 1YJ1A 3TEXA 1N62A 1IUEA 4FXCA 2VZKB 3AE1B 1YQ4B 2INNE 2NPTA 3QWZB 4A55A 3DCGA 1PUTA 1L5PA 2ZCCA 2WLBA 2KXJA 2GI9A 2WS3B 4BKTA 4KZCA 3ONSA 1AW7A 4E71A 1TKEA 2R2QA 4TKNA 3KH0A 3M3JA 3X0WA 2PJHA 5EE9A 1JWSD 3Q8BA 1ZE3D 5GXGB 1E6EB 2CR5A 2K22A 2PIAA 2HDEA 3KVFB 5H8YE 1T0SC 2RPQA 5JHBA 3ZYYX 1R4MB 3R8BA 2L00B 1JROA 1JWMD 1FD6A 2HTME 5IKCM 2LFIA 3A9JA 1HA5A 4EKUA 2NS5A 3AV8A 5JXVA 3RN9C 2BB5A 3SFDB 1CZPA 1V80A 3PPAA 3M62B 2MWSB 1WE6A 4LJPB 5DPTA 2CKHB 4LJOB 5BYQA 4YSZB 4A9AA 3WIMA 4YTPB 3CF4A 5L83A 3GOEA 1ET9A 3MJWA 1OEYA 3ZJVA 2KQ4X 2M8SA 3SEBA 5J2RA 1P0RA 1GB1A 5BMGA 1T0RC 4L1BA 3V60A 4G0NB 2WDRB 5KHQA 2KJ6A 3NVWA 1L0YB 3AEGB 3SDLC 2WU5B 4MH8A 2FCNA 3U52E 1FCLA 3Q3OC 3H7SA 4ITKA 2XN9C 2Z0EB 3NS8A 2KX3A 5FK9C 1C76A 3EFUA 3GE8C 2IDYA 1TTNA 2KQ7A 2CJOA 2WDTB 3I9V1 3AEFB 1BT0A 2RGFA 3BIID 2OJRA 3DWMA 2G3QB 2KDEB 3LB8C 3IVFA 3ZXVA 1XLQA 4ANUA 3KWVA 1DYQA 1V86A 4WIPA 4HDOA 3RZFA 1XLOA 3KUZA 1CJEA 4II3B 4W9HA 3PRZA 2YEPB 3WAOA 2JZZA 3VH3B 2MSED 4A3PA 5C2TB 2LVOA 2MH7A 4QAYA 1K51A 1JW9D 2K25A 1HEZE 1IPGA 4NY0A 3T3NA 1DOXA 2MP2B 3RD2A 2LZ6A 2N1VA 3AE4B 1FPYA 2PKOA 3VXWA 2CHWA 3SD5A 4CQNA 1YMHE 3KQ4A 2ZPYA 5FR3A 2JWUA 2K39A 4WURA 1XEEA 2JUOA 3SFEB 3QAQA 1XLNA 3MP9A 2BS2B 2J42A 4CYEA 3K9PB 3VTUA 3CSFA 4C7YA 5MPOA 3GE3C 2MJEA 3NZ3A 2BQQA 4I6PA 4HLEA 1A70A 1WGYA 1VZ7A 5EE3A 2KWVB 1GTEA 4HROA 2JT4B 1QLBB 1KF6B 1SIJA 4HCNB 1I7HA 1RAXA 4II2B 1QZEA 3FILB 2KACA 5C1ZA 3LYYA 1UZXB 1QKZA 1VCBA 4LTUA 1XLPA 3R3MA 3TEZA 3VUYA 4OW0A 2RPVA 2BTEA 4DHZE 3RNBC 2M1MA 4DXFA 1F52A 1I4GA 3AB5A 3GS2A 1QOAA 3H9DA 4PYZA 1FRRA 2M0AA 3C8YA 4DHJD 3NVYA 2DZKA 2WU2B 4NAWA 3TL5A 1NDDA 2GBMA 4W9CA 2CHZA 1WM3A 4W9KA 2G45B 2H88B 4TQ0A 2XK5A 4A20A 4XC2A 2DYBA 2Q5WD 1C77A 1J7CA 3AI5A 1RYJA 1C4PA 2KVRA 4W9GA 2KJHB 3AE8B 3ZW3A 2EELA 4ZDVA 3N20C 3JYUA 2G9HD 2KDBA 4HEA1 4DQOC 3NY5A 2IGGA 4HJGE 2C5LC 2RSUA 1WIAA 4WAAA 2UU7A 4IM2A 1H7WA 1WGHA 1J8CA 3FC4A 5AZFA 3GZNB 4R3DA 2J0JA 4PYUA 3PZ7A 4ARCA 1K53A 2JSVX 2K8CA 3PVLA 3KLSX 1XD3B 4G50A 3C0RB 1TBEA 1YN4A 2ICIA 3ZJUA 2LUEA 3NRZA 1NBFC 2IYDB 3KUCB 2JRIB 2WXOA 1ZUD2 4F8CB 1GC7A 2SAKA 1N60A 4XZ4A 2LVPA 1QOFA 2ONQA 2MA9B 4GIVA 1L0VB 2VRRB 4AOFA 3EUB2 2JYEA 2FNJB 3V3XA 4J6IA 3ZTDA 3PZDA 1FFUA 2AEHA 5TR5A 2KANA 3Q2AC 4IWOA 5EE0A 3BVZA 2DZJA 1F0ZA 5EDSA 2BWFA 1FM0D 1T0YA 2R61A 1N5XA 2JQRB 4BBNC 4PS3A 2D3AA 5JZEB 4YWGG 2WHIA 5E6NA 2KHWB 4WJQA 1JQ4A 4EEWA 4KIKB 4BBNF 1QT9A 1WF9A 1CMXB 3AMZA 2ZVNA 2WX1A 5C3JB 1V1PA 2LXAA 3EC8A 4I6NB 3M95A 1YQBA 1LQBA 1T6BX 2LGYA 2QHOA 4HXDA 2DHZA 4GDKB 1TS4A 4C00A 3RI7C 4W9LA 1VRAB 3VUWA 5IAAC 2IGHA 1GG3A 4W9IA 4M0WB 4K81A 1WXMA 1UD7A 4IG7B 3RNEC 1CQVA 3RNAC 3VTWA 2JXTA 4GN1A 2V3NA 1UWMA 3PLUA 2WNMA 1F2RC 2NR2A 1JCKB 1GTHA 3V05A 4ZHPA 3Q3FA 5AZGA 3ABVB 2QEJC 4EZJA 1D5ZC 3B9JA 3HM3A 1P98A 3PV1A 1E8XA 2Z0DB 1FFVA 3BK2A 1A5RA 4OVVA 3UI3A 3P4RB 2WYQA 4JE3B 1TS3A 1XXGA 3OAWA 2JY6A 1UELA 4LNIA 3TMPB 1FRDA 1M4VA 4MGIE 5JH5C 5D7GA 2GBRA 1IP9A 4XGAB 5CHFA 2D3CA 1HQRD 2ZEQA 1WXVA 2JF5A 3I63C 4FN2A 5FKAC 4JLCA 4HKQA 1VZ8A 3ZNHB 4MSQB 2W82A 2QIEB 1GPXA 1WXAA 2KFJA 2PVOD 3N3KB 2WXGA 2RMMA 2LHDA 2W3RA 2KWCA 3CSTA 1FCCC 4NAMA 2OEDA 1LO5D 1C3TA 4B0MA 3N1XC 3DDCB 2O6VB 4KKIA 1V97A 3GZNI 3R7QA 3UIOB 2WQYB 2KFKA 4WWOA 3ZQ4A 3WA0A 2W9NA 4D2KA 1WWTA 2D3BA 1OGWA 4K7WA 4L2YA 4RH6A 4W9DA 4ICUA 3PRPB 1E7PB 4KSLC 3J9CA 3I57A 4HVBA 3NZUA 2RR9A 2MLBA 3ML9A 2JWZA 4OHJA 4RGMA 1EU4A 2NCNA 2PPHA 1HE8A 2QCZA 2WXHA 4NQKE 2LJIA 4WQMA 4K7UA 2X38A 2N0SB 3ZXRA 1VR9A 2X8XX 3TIXA 3DBLB 2FAZA 1MVKA 2A5UA 1YD8U 2D3GA 2MQJA 2V0GA 2L0FA 1I4PA 1TZ1A 4BKSA 3U7ZA 1EM7A 4OZCA 3ZVVA 3Q8CA 1WGGA 3ZO5B 3EGRA 4HKZE 2QILA 1YX6B 3O13A 4USAA 4BFRA 4LCDE 3AEBB 2LASA 3I5JC 1GUAB 4EZKA 2J4XA 2DX5B 1HXYD 2IJ0A 1TT5B 1L0XB 2N9LA 2N9KA 2LVQA 3L08A 4L23A 4RF1A 1P3QU 2B76B 4GLSC 1KLUD 2E3TA 1LFDA 4ASWC 1UH6A 1IYFA 2WXFA 2BPSA 3B0AA 3DVNU 5DCNA 1WM2A 2EKIA 3AU4A 4MSMB 3NVVA 4KVGB 2CU1A 3TJPA 2NBUA 1QILA 2DZIA 3V6EB 1ZXIA 4UDUC 5AUKA 2IZVB 2KTFA 1N63A 2IPKD 1MFWA 2PW9A 3A9KA 2C7MB 1SJHD 2MBQA 3B2GA 1FNUA 2LJ5A 2MBEA 1SBBB 4MDKE 1L7YA 4AWJA 1F1HA 3CWIA 1IBXA 1YJJA 4FJYA 2KTRA 3Q3JA 1STEA 2WX0A 3DBHI 1WJUA 1S3SG 2BT6A 1N5WA 1T0QC 1I35A 1GJZA 4REZA 4YL8A 2KT7A 4FHJA 4OZBA 2XNAC 2LRUA 5IO9A 3VTVA 1WYWB 4K3BA 3P4QB 1WY8A 4M8NA 5CTRC 2O2VB 1N61A 2G1EA 2QMTA 3L54A 1N6ZA 3R2TA 2BWES 5HFYA 3AEAB 4JWUC 4NJ7A 4HPMB 2K0PA 3APDA 2LRWA 5KHOA 4BKGA 4HPLB 2RDHA 2FE8A 1YIWA 2E6XA 3WAPA 3AECB 3MFGA 1QF6A 3V6CB 3LJ3A 2HTHA 1I4XA 1NVID 2L83A 2PLPA 3JW0X 1SE3A 1WX9A 2ZVOA 1ZGUB 4E74A 3N9YC 4N6EB 4LDTB 4NZLB 5CHVC 3DWGC 4US8A 4LNOA 3SHQA 1WRIA 3JSVA 2INCC 2TSSA 3HIZA 4HK2A 3HRDD 3RNFC 5FR6A 2Y5CA 4K1RB 2JZPA 5CHWA 1HZ5A 2JXXA 2LHEA 4PS7A 1R7SA 1GB4A 3HVZA 1JMLA 3IHPC 2KMAA 4KV2A 1MG8A 3AE6B 3DBLI 1IGDA 5D2MB 4ANXA 4P7IA 4YTMB 3AEDB 3UINB 3RT3B 4US9A 4IDIA 4DXAB 2PE9A 5BO4B 3V61A 5IP4D 1EO6A 4WJNA 2WXIA 4RMAA 2BW2A 4DXGA 4OVUA 4ACFA 3P42A 1WX8A 2ZCBA 2L1AA 5BMHA 4RCOA 1TGZB 3QX1A 3UIPB 4HDQA 3P4SB 2WXPA 1MHXA 5LNK1 2OHFA 1T3QA 3U2SC 1J7AA 2KN4A 1ET6A 5IOIA 3PSEB 2D10A 4DDID 4H2AA 1SXTA 1I42A 3ZDMC 1P1AA 3OG5A 3NZSA 2WXQA 1PDXA 1UGJA 3VAWA 1Q1OA 2IY0B 1R4MI 4NNJB 4GDLA 4RGOS 2MJ3A 2V1YA 4KDIC 2PE6B 2V3SA 1C79A 4KSKC 4KGTA 2DAFA 3FAHA 1MG4A 3UQAA 2WDVB 3PREA 3KYCD 3RYTA 3K9OB 1F9JA 2A4ZA 3FKYA 1TIFA 4F1SA 4C4VA 1V81A 2MCNB 4MELA 4BOSC 3A1QA 4ARIA 1CK1A 1WMHB 4MJSA 5H92C 4EFOA 1NYQA 1R4NB 3V62A 3H6NA 4IUMB 4ZRIA 2PTLA 1ACCA 1SE9A 1SEBD 1VDVA 2SEBD 3H7PB 2KLCA 3P2BA 4IWQA 4RFBA 1KM7A 4YSXB 3QK0A 4KZ0A 4G11A 1C9FA 2FCMA 3AN1A 4IOIE 4OZAA 2AYOB 2CJNA 2KDFB
chains in the Genus database with same CATH topology
5E6JA 1OQRA 1CQVA 2WXRA 1L4ZB 2JXTA 1VZ6A 1ZXHA 2V3NA 2QSDA 1UWMA 1SE4A 1ZDVA 5D3DA 1FNWA 2WNMA 3BYYB 1F2RC 5G5GA 3TEXA 1JCKB 1N62A 2M56B 1IUEA 1GTHA 4FXCA 3VRAB 2VZKB 4PT5A 3V05A 3AE1B 4YSYB 2INPE 4ZHPA 4HRSA 1YQ4B 2INNE 1TJEA 3VR8B 3ABVB 2QEJC 4A6QA 4A55A 3IT6B 1PUTA 1D5ZC 1L5PA 3B9JA 1K50A 4YXDB 2WLBA 2GI9A 2W54A 2WS3B 2LEKA 1FFVA 2AQ3B 3BK2A 2BS4B 3UI3A 3GB1A 3P4RB 4C56C 1AW7A 2DYMA 4JE3B 1TKEA 1TS3A 1XXGA 4XWTA 3BZDB 2LMCA 5EE9A 5BYRA 1JWSD 1FRDA 1M4VA 3Q8BA 1ZE3D 5D7GA 5GXGB 1KRHA 1P7FA 1F77A 1TZOA 4ZRQA 1E6EB 1HQRD 4N59A 2M19A 1ROEA 2LUMA 2K22A 5FKAC 2PIAA 2HDEA 5H8YE 4C7ZA 4HKQA 3ZYYX 1VZ8A 3R8BA 2W82A 2QIEB 1JROA 1JWMD 1D6EC 1GPXA 1FD6A 2HTME 2PVOD 2LFIA 2NMQA 2WXGA 2RMMA 1D5MC 2LHDA 1HA5A 2W3RA 5JXVA 3AV8A 2K3UA 1FCCC 2BB5A 3SFDB 1CZPA 2AQ2B 3P63A 4NAMA 3H8HA 2CU3A 1AN8A 2BYTA 1YJIA 4RGTA 2OEDA 4ZYSA 1LO5D 5BYQA 4B0MA 2JU6X 1H7XA 1YQ3B 4YSZB 5BYSA 4KKIA 2MEKA 1V97A 4A9AA 1NI3A 4YTPB 2WQYB 4KKJA 3ZQ4A 2H89B 1AWDA 2JX5A 3CF4A 1ZDXA 4D2KA 1WWTA 3BYTB 1ET9A 2NTTA 3VQIA 1EU3A 3ZJVA 1Q10A 2KQ4X 4TMAB 3SEBA 4NJCA 3W5VB 1GB1A 5BMGA 4L2YA 1QOBA 4RH6A 4L1BA 1K52A 1E7PB 2WDRB 3IAS1 3J9CA 3I57A 3NVWA 1AYFA 1L0YB 2ZW1A 3AEGB 4TSSA 4C80A 4OHJA 2WU5B 4RGMA 1EU4A 1P7EA 3W1SA 4MH8A 1UUPA 1WGKA 1RWSA 3U52E 1FCLA 1L6VA 3E9SA 3URYA 1FNVA 2K9XA 2WXHA 3RFZB 1Y56A 2LJIA 4ITKA 2XN9C 4AS1A 4WQMA 1KTKA 4JWSC 4KGSA 1FXIA 2X38A 5FK9C 1C76A 1TKGA 2N0SB 1VR9A 2IDYA 2CJOA 3I9V1 3AEFB 1MVKA 1I4QA 5HG2A 3AE7B 1L6UA 1TKYA 3CIRB 1JALA 3BIID 3DWMA 5BMIA 3LB8C 3Q8FA 3AH7A 2V0GA 3P4PB 1I4PA 4XE0A 5D3IB 1XLQA 3U7ZA 1EM7A 3KWVA 4OZCA 1DGJA 1DYQA 3ETRA 1FO4A 4WIPA 4ZOHC 2LGIA 3Q8CA 1QOGA 3B2FA 3EGRA 1XLOA 4HKZE 1CJEA 2QILA 3O13A 4USAA 2N7JA 1XO3A 3AEBB 2VZKD 2W3SA 2YEPB 2J4XA 1HXYD 2IJ0A 4OVZA 5C2TB 1L0XB 2DBYA 2MH7A 1PGBA 1K51A 1XF5L 2N9LA 1JW9D 3HVDA 2N9KA 1HEZE 4L23A 4RF1A 3T3NA 2V4IB 2B76B 4GLSC 1KLUD 2PVGC 1FMAD 2E3TA 1DOXA 1IGCA 2WXFA 1ZP0B 2EKIA 4RNAA 3IXSA 3AE4B 1YNTE 1J7BA 4IKGA 3NVVA 2PKOA 3W2DA 1JWUD 1ZOYB 1OQQA 1QQRA 1QILA 1JWAD 1B1ZA 3AEEB 1T5XD 4CQNA 1YMHE 1D5XC 1ZXIA 3KQ4A 5FR3A 2JWUA 4UDUC 5AUKA 3NVZA 1N63A 2IPKD 2K5PA 4LLGM 4WURA 1TS5A 2PW9A 1XEEA 3SFEB 1SJHD 3B2GA 1XLNA 3MP9A 2BS2B 4JX1C 2J42A 1YN3A 3VRBB 4P16A 4KX6B 1GAQB 4MACA 1FNUA 3TEWA 4C7YA 3RPFC 5MPOA 3NUHB 2MJEA 2ACZB 3NS1A 4JPSA 1SBBB 3NZ3A 1MI0A 3CWIA 2ZW0A 1IBXA 3E56A 1BMLC 1EWCA 3FILA 4KGRA 1OFFA 1YJJA 1A70A 1VZ7A 4A90A 4MM3B 3ZGZA 1E0ZA 1STEA 5EE3A 4XDDA 3MJ5A 1PYWD 5AUIA 2PMVA 1GTEA 4HROA 2BT6A 1QLBB 1KF6B 1N5WA 1SIJA 3TUOA 2V3PA 4REZA 3P1MA 1I7HA 4OZBA 2XNAC 4RGNA 1C4AA 1SSNA 1UNSA 2Y5PA 1I4HA 3P4QB 3AE2B 1N61A 2G1EA 3Q8EA 1IBXB 1BUIC 2QMTA 3FILB 1WXQA 2KACA 3R2TA 3LYYA 1QKZA 1EWYC 4LTUA 5HFYA 4MT5A 3AEAB 4JWUC 1XLPA 1NYRA 2IGDA 2K0PA 4WH4A 5HI1A 3TEZA 1MHHE 1TY2A 2MJDA 4OW0A 2RDHA 2RPVA 2J52A 1C4CA 2BTEA 2FE8A 3HUIA 2E6XA 5EE1A 3AECB 3Q69A 3MFGA 3EA6A 2DLBA 4DXFA 1QF6A 2KWDA 1I4GA 3AB5A 1I4XA 1TS2A 1XCQL 1NVID 2L83A 2PLPA 3GS2A 1QOAA 2WDQB 3BVGA 1SE3A 3T3OA 1FRRA 2QJLA 2M0AA 3C8YA 1GOZA 3NVYA 3N9YC 2WU2B 4N6EB 4NZLB 1FIQA 2NTSA 3DWGC 4P6VF 4O1NA 1E10A 4US8A 2WXKA 1C78A 3PO0A 4WWMA 3WCQA 2H88B 1WRIA 4N58A 4TQ0A 4ZHOA 2TSSA 1BXTA 3HRDD 1DOYA 1B9RA 2Y5CA 1RFKA 3TEYA 2Q5WD 5T8IA 3VR9B 1C77A 1J7CA 2JZPA 1HZ5A 1RYJA 3AE3B 1C4PA 1XCTL 1FXAA 1KFYB 3AE8B 2WP9B 1NENB 2LHEA 4AQ7A 1WYGA 2EELA 1R7SA 1SB3C 2GB1A 3ZJTA 4XDCA 4B0EA 1GB4A 3HVZA 1JMLA 2AX5A 1JWBD 2G9HD 3BK1A 3AE6B 4HEA1 4DQOC 5TSSA 4YTNB 1IGDA 4Q2JA 4YTMB 3L4PA 2IGGA 3AEDB 4HJGE 5G5HA 1VLBA 2D5GA 2Z8LA 4IDIA 4US9A 3U4EG 1H7WA 3FC4A 3AE5B 3AE9B 1RM6C 2WXIA 2BW2A 5HHDG 4R3DA 4DXGA 3PZ7A 1JRPA 4ARCA 1K53A 2JSVX 1KH0A 3GP7A 3P42A 3W5UB 4YT0B 1FEHA 1MPEA 3KLSX 4EE2A 2L1AA 1YN4A 2ICIA 1GT8A 3NRZA 4RCOA 5BMHA 3ZJUA 2FUG1 2L32A 3P4SB 2WXPA 1MHXA 2WXOA 1ZUD2 1ZPSA 5LNK1 4XWWA 2OHFA 1T3QA 3U2SC 2SAKA 1J7AA 1N60A 2KN4A 1NEKB 1I4RA 1ET6A 4LK0M 1QOFA 2ONQA 3BWUD 3KWLA 3OWEB 1E9MA 3BVMA 1TY0A 2WXMA 1L0VB 3AM9A 4H2AA 1SXTA 3MHZA 2J53A 4J3OD 3EUB2 2DYOA 2JYEA 3V3XA 1V8CA 2DWQA 2I2YA 1UWXA 3IT4B 2WXQA 1FFUA 1DOIA 2BB6A 2BBCA 1PDXA 1UGJA 1SJED 1TYGB 5EE0A 3BVZA 4WAFA 1PFDA 1F0ZA 4RGOS 2MJ3A 4RF0A 1YN5A 1FM0D 3IAM1 2R61A 2RDGA 1N5XA 1D4BA 2JQRB 2YEPF 1PGXA 1C79A 3LXFA 2AQ1B 3R2IA 4KGTA 1WSPA 3FAHA 2Y3AA 4ZRPA 2WDVB 1ESFA 4YWGG 2WXJA 3MC0B 2ON8A 1JQ4A 1QT9A 1KLGD 3AMZA 2I38A 4GDLB 2WXLA 4ARIA 1L4DB 5C3JB 1CK1A 1V1PA 2WXNA 5H92C 1NYQA 4M0WA 3SR6A 1ENFA 5I4DA 2L52A 1T6BX 3TSSA 1F2RI 2PTLA 1ACCA 2GRIA 2W55A 4GDKB 1V1OA 1SEBD 1TS4A 1VDVA 2KDMA 2SEBD 1HZ6A 4RFBA 1VRAB 1SE2A 2IGHA 1PGAA 4YSXB 1V1PB 3PZ8A 2FBWB 2JYTA 1C9FA 4A8XC 1VJKA 4NAWB 3AN1A 3W9CB 4IOIE 2KAJA 2BS3B 2KMMA 4OZAA 4TQ1A 3Q8AA 2CJNA 1SF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQR A;  4WQM A;  1E0Z A;  4JWS C;  5EE3 A;  3W5U B;  4YT0 B;  1FXI A;  5AUI A;  1UWM A;  5G5G A;  1GTE A;  4HRO A;  1GT8 A;  1N62 A;  2M56 B;  1IUE A;  1GTH A;  1TKG A;  3VRA B;  1QLB B;  1KF6 B;  1N5W A;  3AE1 B;  4YSY B;  1SIJ A;  2BT6 A;  2N0S B;  4HRS A;  1YQ4 B;  1TJE A;  3P1M A;  2CJO A;  1I7H A;  3AEF B;  3VR8 B;  3ABV B;  3P4S B;  1ZUD 2;  3AE7 B;  1L6U A;  1PUT A;  3CIR B;  1TKY A;  1L5P A;  1JAL A;  3B9J A;  3BII D;  3P4Q B;  3AE2 B;  4YXD B;  2OHF A;  3DWM A;  2WLB A;  1T3Q A;  1N61 A;  2G1E A;  2W54 A;  1J7A A;  2WS3 B;  1N60 A;  1FFV A;  1NEK B;  1WXQ A;  2BS4 B;  3P4P B;  2LEK A;  3AH7 A;  3P4R B;  1EWY C;  1QOF A;  1XLQ A;  3KWL A;  4LTU A;  3AEA B;  1E9M A;  4JWU C;  1XLP A;  1TKE A;  1NYR A;  1DGJ A;  1L0V B;  3AM9 A;  3ETR A;  1FO4 A;  4ZHP A;  4ZOH C;  3EUB 2;  5EE9 A;  1FRD A;  2MJD A;  5GXG B;  1V8C A;  1QOG A;  3B2F A;  1KRH A;  2DWQ A;  1XLO A;  3HUI A;  1CJE A;  1FFU A;  1DOI A;  5EE1 A;  3AEC B;  1PDX A;  1E6E B;  4USA A;  4N59 A;  1QF6 A;  1XO3 A;  3AEB B;  2M19 A;  2W3S A;  1ROE A;  3AB5 A;  1NVI D;  1TYG B;  2L83 A;  5EE0 A;  2K22 A;  1QOA A;  2PIA A;  5H8Y E;  2WDQ B;  1PFD A;  1F0Z A;  4C7Z A;  1FRR A;  2MJ3 A;  2QJL A;  3ZYY X;  5C2T B;  3NVY A;  1FM0 D;  2QIE B;  2DBY A;  1JRO A;  2MH7 A;  1GPX A;  2WU2 B;  4N6E B;  1N5X A;  1JW9 D;  2HTM E;  1FIQ A;  2JQR B;  2PVO D;  3LXF A;  3DWG C;  4P6V F;  3FAH A;  1E10 A;  4US8 A;  2W3R A;  2B76 B;  3PO0 A;  3AV8 A;  2WDV B;  4WWM A;  2PVG C;  1FMA D;  2E3T A;  3WCQ A;  1DOX A;  2H88 B;  1WRI A;  4N58 A;  3SFD B;  1CZP A;  3P63 A;  4ZHO A;  2CU3 A;  1YJI A;  1JQ4 A;  3HRD D;  1DOY A;  1ZP0 B;  1QT9 A;  1B9R A;  2EKI A;  2Y5C A;  3AMZ A;  1RFK A;  4FXC A;  3AE4 B;  2Q5W D;  1J7B A;  3VR9 B;  3NVV A;  1J7C A;  1H7X A;  1YQ3 B;  4YSZ B;  2PKO A;  1RYJ A;  1ZOY B;  3AE3 B;  1V97 A;  4A9A A;  1OQQ A;  5C3J B;  4YTP B;  2WQY B;  1FXA A;  1NI3 A;  1KFY B;  2H89 B;  3AE8 B;  2WP9 B;  1NEN B;  3AEE B;  1AWD A;  3CF4 A;  1JWA D;  1NYQ A;  1ZXI A;  2JX5 A;  3NRZ A;  5H92 C;  1WYG A;  3SR6 A;  1R7S A;  2L52 A;  1WWT A;  1SB3 C;  5AUK A;  3LB8 C;  3NVZ A;  1N63 A;  2K5P A;  2W55 A;  3HVZ A;  3SFE B;  1JWB D;  2AX5 A;  1VDV A;  3W5V B;  3AE6 B;  3B2G A;  1QOB A;  1XLN A;  2BS2 B;  4YTN B;  4JX1 C;  1E7P B;  4YTM B;  2WDR B;  3L4P A;  3AED B;  3VRB B;  1AYF A;  3NVW A;  5G5H A;  3AEG B;  4KX6 B;  1GAQ B;  4C80 A;  1VLB A;  4US9 A;  3RPF C;  4IDI A;  4C7Y A;  5MPO A;  4YSX B;  2ACZ B;  2MJE A;  2WU5 B;  3NS1 A;  1H7W A;  2FBW B;  3FC4 A;  3AE5 B;  3AE9 B;  1RM6 C;  1WGK A;  3CWI A;  1RWS A;  1L6V A;  1VJK A;  1OFF A;  1YJJ A;  3AN1 A;  2CJN A;  3W9C B;  2KAJ A;  2BS3 B;  2KMM A;  2K9X A;  1A70 A;  4ITK A;  1JRP A;  1SF0 A; 
#chains in the Genus database with same CATH topology
 2WXR A;  4ZRK A;  1P9D U;  4M00 A;  2QSD A;  2KNB A;  5D3D A;  5G5G A;  3BYY B;  5HKH A;  3EFC A;  4BOZ B;  4PT5 A;  3VRA B;  4HRS A;  4KDL B;  2MHJ A;  2DZM A;  1V6E A;  4A6Q A;  3WAL A;  1K50 A;  4YXD B;  2CHX A;  2V9H A;  3ZIM A;  3UGB B;  3BZD B;  4RM9 A;  2JPH A;  1KRH A;  3DBS A;  1F77 A;  2NPT B;  3UF8 A;  1V49 A;  1ROE A;  2LUM A;  2L0T A;  4C7Z A;  4TV3 A;  4LNK A;  3DQV A;  1D5M C;  2K3U A;  2AQ2 B;  3RNC C;  3H8H A;  2CU3 A;  1AN8 A;  3X23 A;  2BYT A;  1YJI A;  2KC1 A;  4ZYS A;  3Q6B A;  1H7X A;  1HTQ A;  4HPP A;  2MEK A;  3SU8 X;  1NI3 A;  1LXD A;  4KKJ A;  1G6J A;  2JX5 A;  1ZDX A;  3ZNI D;  2WWZ A;  3VQI A;  1EU3 A;  1Q10 A;  4TMA B;  3QA8 A;  3W5V B;  3DBR B;  5E6P A;  4GXB A;  4TSS A;  4W9F A;  2ZW1 A;  4C80 A;  3ZDT A;  2LXC A;  2JRH A;  1P7E A;  2RD0 A;  3W1S A;  1E7U A;  2AL3 A;  1WGK A;  1RWS A;  1L6V A;  3U30 A;  3E9S A;  2QDF A;  2CS4 A;  1FNV A;  4AS1 A;  1KTK A;  3IG3 A;  2GOW A;  5G55 A;  4BZA A;  3ZLZ A;  4XX5 A;  4CHK A;  4M02 A;  4WWP A;  1I4Q A;  3AE7 B;  3CIR B;  2YLM A;  4DHJ B;  2VH1 A;  4XYC A;  3AH7 A;  3P4P B;  4XE0 A;  5D3I B;  3TCA A;  1KOT A;  1SIF A;  1V9J A;  3ETR A;  4ZOH C;  2JZ3 B;  2LGI A;  3AUL A;  1QOG A;  3IBE A;  2KZR A;  2MP2 A;  3N1Z C;  4FUL A;  2N7J A;  2VZK D;  2W3S A;  1GNU A;  3PHW B;  1R4N I;  1RLF A;  3B1L X;  1E5W A;  3AXC A;  3HVD A;  4HCP B;  3A4R A;  2V4I B;  2KDI A;  2N7D A;  2PVG C;  1FMA D;  5D6J B;  3DVN V;  4P1B C;  2REX A;  1IGC A;  3QIJ A;  1ZP0 B;  4JIO U;  1L2N A;  1E8W A;  4RNA A;  3IXS A;  1YNT E;  2KKC A;  4IKG A;  3RUL A;  1ZOY B;  1QQR A;  1WZ0 A;  2L76 A;  3AEE B;  1D5X C;  3TBL D;  4WQO B;  2UYZ B;  3UQB A;  2K5P A;  4LLG M;  1C1Y B;  1TS5 A;  3L0W B;  4JX1 C;  2J0K A;  1YN3 A;  4M01 A;  3DVG X;  3VRB B;  4KX6 B;  3TEW A;  3RPF C;  3NUH B;  2ACZ B;  2HE7 A;  3NS1 A;  4JPS A;  2N4F A;  2FCS A;  3PLV A;  3RCZ A;  3E56 A;  3FIL A;  3NG0 A;  1OFF A;  2K1F A;  4A90 A;  4MM3 B;  4FBJ B;  3QAR A;  3PGE A;  1E0Z A;  4RM8 A;  4XDD A;  1ZKH A;  3MJ5 A;  2V4L A;  5AUI A;  2PMV A;  2LGS A;  1WJN A;  4GU2 A;  4MGZ E;  3TUO A;  2V3P A;  2G4S A;  5G2N A;  4RGN A;  4FLH A;  1SSN A;  1UNS A;  1I4H A;  3AE2 B;  4IM0 A;  3Q8E A;  1BUI C;  1UBI A;  2ZPN A;  3AU5 A;  1EWY C;  2ZZP B;  1NYR A;  2GBK A;  2C7N B;  2WGS A;  4FAD A;  2MW5 A;  1TY2 A;  4NJ6 A;  2MJD A;  2GLS A;  2J52 A;  3HUI A;  5EE1 A;  2N7E A;  3Q69 A;  3APF A;  1WR1 A;  2KWD A;  2AL6 A;  1TS2 A;  3U7D A;  2G4D B;  2WDQ B;  3BVG A;  5JHA A;  1V2Y A;  1WI0 A;  2NTS A;  2M17 A;  1E7V A;  2EMT A;  4P6V F;  3ZTC A;  4ZYN A;  1E10 A;  3DBR I;  2WXK A;  1C78 A;  1WGD A;  4N58 A;  4ZHO A;  2DNF A;  2D2Q A;  1FXT B;  1X1M A;  3MTN B;  1DOY A;  1B9R A;  2K6D B;  1KJT A;  3TEY A;  5T8I A;  4IWP A;  3AE3 B;  1ISN A;  1KFY B;  2WP9 B;  1EUV B;  2KMC A;  4AQ7 A;  3ZNG C;  2ZJD A;  4WJP A;  2GB1 A;  3OLM D;  2GMI C;  2IO2 B;  4B0E A;  2XK5 B;  2AX5 A;  1JWB D;  3L4P A;  5G5H A;  2LD9 A;  3PS6 A;  2EMS A;  3U4E G;  2I1K A;  2Y5B B;  1Q5W B;  4LNF A;  3HHM A;  3AE9 B;  1RM6 C;  4ANW A;  5HHD G;  5GMV A;  1KH0 A;  3W5U B;  4YT0 B;  2R2O A;  4EE2 A;  1GT8 A;  5J18 A;  3NJT A;  3DPD A;  4URK A;  3NOB A;  5LXH A;  1HTO A;  2HJ1 A;  3WAM A;  4K7S A;  3PTF C;  1V5O A;  1D3Z A;  3W1S C;  3VFK A;  1I4R A;  4LK0 M;  2RDB C;  3BWU D;  3OWE B;  1E9M A;  2BVC A;  4X57 B;  3BVM A;  5J17 A;  3AM9 A;  3MHZ A;  3ALB A;  2KC2 A;  2DWQ A;  1KLV A;  1UWX A;  3NHE B;  4MGY E;  3L16 A;  5LLI A;  4KIK A;  2L05 A;  1SJE D;  5C23 A;  1J0G A;  1PFD A;  2XEW A;  3IAM 1;  2RDG A;  2YEP F;  1Z5S B;  2AQ1 B;  1WSP A;  4E3C A;  4ZRP A;  1ESF A;  2WXJ A;  3MC0 B;  3ZRC A;  2L3Z A;  4GDK A;  2ON8 A;  1U4A A;  2KOX A;  3RNG C;  2I38 A;  3VHT C;  3VH4 B;  1L4D B;  3R66 C;  4M0W A;  1XQQ A;  3SR6 A;  1F2R I;  4TUU A;  4NQL B;  2GRI A;  2FUH B;  1V1O A;  2KDM A;  3DHI C;  1HZ6 A;  1SE2 A;  4PK1 A;  1V1P B;  3PZ8 A;  2FBW B;  2JYT A;  2NVU I;  4A8X C;  2D11 A;  1VJK A;  3QCA A;  5L95 C;  2KAJ A;  2BS3 B;  2KMM A;  4BKS D;  5E6J A;  1OQR A;  3U8Z A;  2N9E B;  1VZ6 A;  1ZW7 A;  4N9F 4;  2KD0 A;  1ZXH A;  3ZUN A;  1ZDV A;  1SE4 A;  1FNW A;  3CF6 E;  2M56 B;  1RFA A;  2INP E;  4YSY B;  4DBG A;  4W9E A;  1TJE A;  3VR8 B;  4MGK E;  3H1U A;  3IT6 B;  2ASQ A;  2W54 A;  2LEK A;  2AQ3 B;  2BS4 B;  2BGF A;  2MRP A;  3GB1 A;  4FA6 A;  2DYM A;  4XWT A;  4JQW C;  1E8Z A;  1Q0W B;  2LMC A;  5BYR A;  2IO1 B;  1P7F A;  2FIF A;  3IFW B;  3ZNZ B;  1TZO A;  4ZRQ A;  4A3O A;  4N59 A;  2M19 A;  1LGR A;  4M8M A;  2O6V A;  4G3X B;  3D32 A;  1D6E C;  3I3T B;  3JVZ X;  2NMQ A;  4MM3 A;  5DPW A;  4DWF A;  3HK0 A;  2MX2 A;  4AJY B;  3P63 A;  3S2A A;  4RGT A;  2JU6 X;  3BY4 B;  1YQ3 B;  5BYS A;  3QQ8 B;  2EKE C;  2QC8 A;  2H89 B;  1AWD A;  3A33 B;  3R7R A;  4GSW A;  3BYT B;  2J7Q B;  2NTT A;  2HJ8 A;  4NJC A;  1QOB A;  1WR6 E;  1K52 A;  3RUI B;  3IAS 1;  1AYF A;  3MC8 A;  4GB9 A;  2KFK B;  4AP4 C;  2IY1 B;  4EUT A;  1UUP A;  3Q3M C;  4WWN A;  3URY A;  4GGQ A;  2K9X A;  3RFZ B;  1Y56 A;  4B6W A;  4JWS C;  4KGS A;  3DVG Y;  1FXI A;  4B9K A;  1E8Y A;  3W1Y A;  1WJ6 A;  2OOB B;  1TKG A;  4MEM A;  2NBW B;  5HG2 A;  1L6U A;  1TKY A;  1JAL A;  2L7R A;  2OJW A;  5BMI A;  3Q8F A;  2KWU B;  3MHS D;  2KN5 A;  2LGX A;  1DGJ A;  1FO4 A;  4BAX A;  3OJ4 B;  1VD2 A;  1YOV B;  3B2F A;  1UGM A;  1XO3 A;  4JGH B;  2BYV E;  3KUD B;  3L10 B;  3PHX B;  4OVZ A;  4FJV B;  2DBY A;  1PGB A;  1XF5 L;  4I6L B;  4B95 A;  1M94 A;  1K8R B;  3M63 B;  2KYW A;  2B3A A;  2XBB C;  3Q14 C;  3PT2 B;  2Z59 B;  2BYE A;  1J7B A;  3W2D A;  4PS8 A;  1JWU D;  1Y8R C;  1V5T A;  1OQQ A;  2GBN A;  1JWA D;  1B1Z A;  1T5X D;  2NBV B;  2MBB B;  2IO3 B;  2LI5 A;  3O65 B;  3NVZ A;  2JVC A;  1PQS A;  2KJR A;  3L13 A;  5IN7 A;  3T9L A;  4ANV A;  4K3C A;  4LNN A;  4P16 A;  2PEA A;  3C19 A;  1GAQ B;  4MAC A;  4P1C C;  2K6Q A;  3B08 A;  4ZRJ A;  2KQS A;  2UWQ A;  1MI0 A;  2N1W A;  2O6V D;  2LGD A;  3A4S C;  2O2V A;  2ZW0 A;  3DOW A;  1BML C;  1EWC A;  4KGR A;  3A9J B;  4MH0 E;  1WGR A;  3ZGZ A;  3A9K B;  2YVC A;  3CMM B;  2FID A;  1H4R A;  1PYW D;  1UF0 A;  3N32 A;  4W9J A;  1WH3 A;  3P1M A;  3VVW B;  1C4A A;  2Y5P A;  2IND C;  4GOC A;  1IBX B;  1EF5 A;  1WXQ A;  4MT5 A;  2BYF A;  2KTR B;  2N9X A;  2IGD A;  4WH4 A;  5HI1 A;  1MHH E;  4EZL A;  1EF1 A;  3QJZ A;  4IM3 A;  3ZRF A;  2ZNV C;  1C4C A;  5LXI B;  3EA6 A;  2DLB A;  5DPR A;  1XCQ L;  4IW0 A;  3EHV A;  3T3O A;  2QJL A;  3LDZ E;  4S17 A;  1GOZ A;  2K8B A;  3DHH C;  1MJD A;  1FIQ A;  2MBO A;  3VUX A;  4O1N A;  4DDG D;  3PO0 A;  4WWM A;  3WCQ A;  1J19 A;  4BVU C;  1BXT A;  4JL9 A;  5IA7 A;  1RFK A;  3VR9 B;  1WRD B;  3MC9 A;  1XCT L;  1FXA A;  4HWI B;  1NEN B;  2M4N A;  1WYG A;  3QC8 B;  2KX0 A;  4DK5 A;  5CX3 A;  1SB3 C;  2D07 B;  3ZJT A;  4XDC A;  2GBJ A;  3JSV B;  3BK1 A;  2HD5 B;  5TSS A;  4YTN B;  4Q2J A;  2KO3 A;  1RRB A;  2K8H A;  1LM8 B;  2BKR B;  3OJ3 A;  1VLB A;  2D5G A;  2FCQ A;  2Z8L A;  4DHZ B;  1WZ3 A;  2C9W B;  3WAN A;  1WX7 A;  1JRU A;  2C7H A;  3AE5 B;  1WFY A;  1OEY J;  2N9P C;  1UBQ A;  5AEK B;  2M0X A;  1JRP A;  4AJW A;  2L8J A;  3GP7 A;  1FEH A;  1MPE A;  2ZNV B;  3DBH B;  3KW5 B;  1SGH A;  2FUG 1;  3Q3N C;  2L32 A;  4HJK A;  3ENE A;  4NPN A;  1ZPS A;  1AAR A;  5AZH A;  4XWW A;  3N30 A;  4WJO A;  4F7Z A;  1WJ4 A;  1NEK B;  3APC A;  4IC7 B;  3KWL A;  1S1Q B;  1TY0 A;  2WXM A;  1OQY A;  4J3O D;  2J53 A;  2DYO A;  1V8C A;  3ECI A;  2I2Y A;  3IT4 B;  5D94 A;  3HM6 X;  1DOI A;  2BB6 A;  2BBC A;  3ZKJ C;  4GMV A;  1TYG B;  4WAF A;  5DPS A;  1YX5 B;  2DEN B;  4RF0 A;  3EEC A;  1YN5 A;  1WMH A;  3T8M A;  1D4B A;  1PGX A;  4AUQ C;  3LXF A;  3R2I A;  2Y3A A;  4EOY A;  3L17 A;  2LWP A;  1WE7 A;  2MBH A;  3H7P A;  1KLG D;  2I1J A;  3KYD D;  1NI2 A;  3PRM B;  1GC6 A;  4FHK A;  4GDL B;  2WXL A;  2C60 A;  3QHT A;  1E90 A;  2WXN A;  2VH2 A;  1ENF A;  5I4D A;  2L52 A;  2AWT A;  2IBI B;  2KLG A;  3TSS A;  1XT9 B;  4LDT D;  1OTR B;  3RZW C;  2W55 A;  4C4V B;  2DAJ A;  4ICV A;  5E6O A;  4CO7 A;  4S0R A;  3A1Q B;  1PGA A;  2J0M A;  3BIN A;  4MJS B;  2BF8 B;  2IO0 B;  1Z2M A;  3VDZ A;  1WXS A;  3DHG C;  2BKF A;  2KK8 A;  3N1Y C;  4NAW B;  3W9C B;  3RMK C;  4TQ1 A;  3Q8A A;  3ML8 A;  1SF0 A;  4C56 C;  1H8C A;  1L4Z B;  4FJZ A;  2KVZ A;  1YJ1 A;  3TEX A;  1N62 A;  1IUE A;  4FXC A;  2VZK B;  3AE1 B;  1YQ4 B;  2INN E;  2NPT A;  3QWZ B;  4A55 A;  3DCG A;  1PUT A;  1L5P A;  2ZCC A;  2WLB A;  2KXJ A;  2GI9 A;  2WS3 B;  4BKT A;  4KZC A;  3ONS A;  1AW7 A;  4E71 A;  1TKE A;  2R2Q A;  4TKN A;  3KH0 A;  3M3J A;  3X0W A;  2PJH A;  5EE9 A;  1JWS D;  3Q8B A;  1ZE3 D;  5GXG B;  1E6E B;  2CR5 A;  2K22 A;  2PIA A;  2HDE A;  3KVF B;  5H8Y E;  1T0S C;  2RPQ A;  5JHB A;  3ZYY X;  1R4M B;  3R8B A;  2L00 B;  1JRO A;  1JWM D;  1FD6 A;  2HTM E;  5IKC M;  2LFI A;  3A9J A;  1HA5 A;  4EKU A;  2NS5 A;  3AV8 A;  5JXV A;  3RN9 C;  2BB5 A;  3SFD B;  1CZP A;  1V80 A;  3PPA A;  3M62 B;  2MWS B;  1WE6 A;  4LJP B;  5DPT A;  2CKH B;  4LJO B;  5BYQ A;  4YSZ B;  4A9A A;  3WIM A;  4YTP B;  3CF4 A;  5L83 A;  3GOE A;  1ET9 A;  3MJW A;  1OEY A;  3ZJV A;  2KQ4 X;  2M8S A;  3SEB A;  5J2R A;  1P0R A;  1GB1 A;  5BMG A;  1T0R C;  4L1B A;  3V60 A;  4G0N B;  2WDR B;  5KHQ A;  2KJ6 A;  3NVW A;  1L0Y B;  3AEG B;  3SDL C;  2WU5 B;  4MH8 A;  2FCN A;  3U52 E;  1FCL A;  3Q3O C;  3H7S A;  4ITK A;  2XN9 C;  2Z0E B;  3NS8 A;  2KX3 A;  5FK9 C;  1C76 A;  3EFU A;  3GE8 C;  2IDY A;  1TTN A;  2KQ7 A;  2CJO A;  2WDT B;  3I9V 1;  3AEF B;  1BT0 A;  2RGF A;  3BII D;  2OJR A;  3DWM A;  2G3Q B;  2KDE B;  3LB8 C;  3IVF A;  3ZXV A;  1XLQ A;  4ANU A;  3KWV A;  1DYQ A;  1V86 A;  4WIP A;  4HDO A;  3RZF A;  1XLO A;  3KUZ A;  1CJE A;  4II3 B;  4W9H A;  3PRZ A;  2YEP B;  3WAO A;  2JZZ A;  3VH3 B;  2MSE D;  4A3P A;  5C2T B;  2LVO A;  2MH7 A;  4QAY A;  1K51 A;  1JW9 D;  2K25 A;  1HEZ E;  1IPG A;  4NY0 A;  3T3N A;  1DOX A;  2MP2 B;  3RD2 A;  2LZ6 A;  2N1V A;  3AE4 B;  1FPY A;  2PKO A;  3VXW A;  2CHW A;  3SD5 A;  4CQN A;  1YMH E;  3KQ4 A;  2ZPY A;  5FR3 A;  2JWU A;  2K39 A;  4WUR A;  1XEE A;  2JUO A;  3SFE B;  3QAQ A;  1XLN A;  3MP9 A;  2BS2 B;  2J42 A;  4CYE A;  3K9P B;  3VTU A;  3CSF A;  4C7Y A;  5MPO A;  3GE3 C;  2MJE A;  3NZ3 A;  2BQQ A;  4I6P A;  4HLE A;  1A70 A;  1WGY A;  1VZ7 A;  5EE3 A;  2KWV B;  1GTE A;  4HRO A;  2JT4 B;  1QLB B;  1KF6 B;  1SIJ A;  4HCN B;  1I7H A;  1RAX A;  4II2 B;  1QZE A;  3FIL B;  2KAC A;  5C1Z A;  3LYY A;  1UZX B;  1QKZ A;  1VCB A;  4LTU A;  1XLP A;  3R3M A;  3TEZ A;  3VUY A;  4OW0 A;  2RPV A;  2BTE A;  4DHZ E;  3RNB C;  2M1M A;  4DXF A;  1F52 A;  1I4G A;  3AB5 A;  3GS2 A;  1QOA A;  3H9D A;  4PYZ A;  1FRR A;  2M0A A;  3C8Y A;  4DHJ D;  3NVY A;  2DZK A;  2WU2 B;  4NAW A;  3TL5 A;  1NDD A;  2GBM A;  4W9C A;  2CHZ A;  1WM3 A;  4W9K A;  2G45 B;  2H88 B;  4TQ0 A;  2XK5 A;  4A20 A;  4XC2 A;  2DYB A;  2Q5W D;  1C77 A;  1J7C A;  3AI5 A;  1RYJ A;  1C4P A;  2KVR A;  4W9G A;  2KJH B;  3AE8 B;  3ZW3 A;  2EEL A;  4ZDV A;  3N20 C;  3JYU A;  2G9H D;  2KDB A;  4HEA 1;  4DQO C;  3NY5 A;  2IGG A;  4HJG E;  2C5L C;  2RSU A;  1WIA A;  4WAA A;  2UU7 A;  4IM2 A;  1H7W A;  1WGH A;  1J8C A;  3FC4 A;  5AZF A;  3GZN B;  4R3D A;  2J0J A;  4PYU A;  3PZ7 A;  4ARC A;  1K53 A;  2JSV X;  2K8C A;  3PVL A;  3KLS X;  1XD3 B;  4G50 A;  3C0R B;  1TBE A;  1YN4 A;  2ICI A;  3ZJU A;  2LUE A;  3NRZ A;  1NBF C;  2IYD B;  3KUC B;  2JRI B;  2WXO A;  1ZUD 2;  4F8C B;  1GC7 A;  2SAK A;  1N60 A;  4XZ4 A;  2LVP A;  1QOF A;  2ONQ A;  2MA9 B;  4GIV A;  1L0V B;  2VRR B;  4AOF A;  3EUB 2;  2JYE A;  2FNJ B;  3V3X A;  4J6I A;  3ZTD A;  3PZD A;  1FFU A;  2AEH A;  5TR5 A;  2KAN A;  3Q2A C;  4IWO A;  5EE0 A;  3BVZ A;  2DZJ A;  1F0Z A;  5EDS A;  2BWF A;  1FM0 D;  1T0Y A;  2R61 A;  1N5X A;  2JQR B;  4BBN C;  4PS3 A;  2D3A A;  5JZE B;  4YWG G;  2WHI A;  5E6N A;  2KHW B;  4WJQ A;  1JQ4 A;  4EEW A;  4KIK B;  4BBN F;  1QT9 A;  1WF9 A;  1CMX B;  3AMZ A;  2ZVN A;  2WX1 A;  5C3J B;  1V1P A;  2LXA A;  3EC8 A;  4I6N B;  3M95 A;  1YQB A;  1LQB A;  1T6B X;  2LGY A;  2QHO A;  4HXD A;  2DHZ A;  4GDK B;  1TS4 A;  4C00 A;  3RI7 C;  4W9L A;  1VRA B;  3VUW A;  5IAA C;  2IGH A;  1GG3 A;  4W9I A;  4M0W B;  4K81 A;  1WXM A;  1UD7 A;  4IG7 B;  3RNE C;  1CQV A;  3RNA C;  3VTW A;  2JXT A;  4GN1 A;  2V3N A;  1UWM A;  3PLU A;  2WNM A;  1F2R C;  2NR2 A;  1JCK B;  1GTH A;  3V05 A;  4ZHP A;  3Q3F A;  5AZG A;  3ABV B;  2QEJ C;  4EZJ A;  1D5Z C;  3B9J A;  3HM3 A;  1P98 A;  3PV1 A;  1E8X A;  2Z0D B;  1FFV A;  3BK2 A;  1A5R A;  4OVV A;  3UI3 A;  3P4R B;  2WYQ A;  4JE3 B;  1TS3 A;  1XXG A;  3OAW A;  2JY6 A;  1UEL A;  4LNI A;  3TMP B;  1FRD A;  1M4V A;  4MGI E;  5JH5 C;  5D7G A;  2GBR A;  1IP9 A;  4XGA B;  5CHF A;  2D3C A;  1HQR D;  2ZEQ A;  1WXV A;  2JF5 A;  3I63 C;  4FN2 A;  5FKA C;  4JLC A;  4HKQ A;  1VZ8 A;  3ZNH B;  4MSQ B;  2W82 A;  2QIE B;  1GPX A;  1WXA A;  2KFJ A;  2PVO D;  3N3K B;  2WXG A;  2RMM A;  2LHD A;  2W3R A;  2KWC A;  3CST A;  1FCC C;  4NAM A;  2OED A;  1LO5 D;  1C3T A;  4B0M A;  3N1X C;  3DDC B;  2O6V B;  4KKI A;  1V97 A;  3GZN I;  3R7Q A;  3UIO B;  2WQY B;  2KFK A;  4WWO A;  3ZQ4 A;  3WA0 A;  2W9N A;  4D2K A;  1WWT A;  2D3B A;  1OGW A;  4K7W A;  4L2Y A;  4RH6 A;  4W9D A;  4ICU A;  3PRP B;  1E7P B;  4KSL C;  3J9C A;  3I57 A;  4HVB A;  3NZU A;  2RR9 A;  2MLB A;  3ML9 A;  2JWZ A;  4OHJ A;  4RGM A;  1EU4 A;  2NCN A;  2PPH A;  1HE8 A;  2QCZ A;  2WXH A;  4NQK E;  2LJI A;  4WQM A;  4K7U A;  2X38 A;  2N0S B;  3ZXR A;  1VR9 A;  2X8X X;  3TIX A;  3DBL B;  2FAZ A;  1MVK A;  2A5U A;  1YD8 U;  2D3G A;  2MQJ A;  2V0G A;  2L0F A;  1I4P A;  1TZ1 A;  4BKS A;  3U7Z A;  1EM7 A;  4OZC A;  3ZVV A;  3Q8C A;  1WGG A;  3ZO5 B;  3EGR A;  4HKZ E;  2QIL A;  1YX6 B;  3O13 A;  4USA A;  4BFR A;  4LCD E;  3AEB B;  2LAS A;  3I5J C;  1GUA B;  4EZK A;  2J4X A;  2DX5 B;  1HXY D;  2IJ0 A;  1TT5 B;  1L0X B;  2N9L A;  2N9K A;  2LVQ A;  3L08 A;  4L23 A;  4RF1 A;  1P3Q U;  2B76 B;  4GLS C;  1KLU D;  2E3T A;  1LFD A;  4ASW C;  1UH6 A;  1IYF A;  2WXF A;  2BPS A;  3B0A A;  3DVN U;  5DCN A;  1WM2 A;  2EKI A;  3AU4 A;  4MSM B;  3NVV A;  4KVG B;  2CU1 A;  3TJP A;  2NBU A;  1QIL A;  2DZI A;  3V6E B;  1ZXI A;  4UDU C;  5AUK A;  2IZV B;  2KTF A;  1N63 A;  2IPK D;  1MFW A;  2PW9 A;  3A9K A;  2C7M B;  1SJH D;  2MBQ A;  3B2G A;  1FNU A;  2LJ5 A;  2MBE A;  1SBB B;  4MDK E;  1L7Y A;  4AWJ A;  1F1H A;  3CWI A;  1IBX A;  1YJJ A;  4FJY A;  2KTR A;  3Q3J A;  1STE A;  2WX0 A;  3DBH I;  1WJU A;  1S3S G;  2BT6 A;  1N5W A;  1T0Q C;  1I35 A;  1GJZ A;  4REZ A;  4YL8 A;  2KT7 A;  4FHJ A;  4OZB A;  2XNA C;  2LRU A;  5IO9 A;  3VTV A;  1WYW B;  4K3B A;  3P4Q B;  1WY8 A;  4M8N A;  5CTR C;  2O2V B;  1N61 A;  2G1E A;  2QMT A;  3L54 A;  1N6Z A;  3R2T A;  2BWE S;  5HFY A;  3AEA B;  4JWU C;  4NJ7 A;  4HPM B;  2K0P A;  3APD A;  2LRW A;  5KHO A;  4BKG A;  4HPL B;  2RDH A;  2FE8 A;  1YIW A;  2E6X A;  3WAP A;  3AEC B;  3MFG A;  1QF6 A;  3V6C B;  3LJ3 A;  2HTH A;  1I4X A;  1NVI D;  2L83 A;  2PLP A;  3JW0 X;  1SE3 A;  1WX9 A;  2ZVO A;  1ZGU B;  4E74 A;  3N9Y C;  4N6E B;  4LDT B;  4NZL B;  5CHV C;  3DWG C;  4US8 A;  4LNO A;  3SHQ A;  1WRI A;  3JSV A;  2INC C;  2TSS A;  3HIZ A;  4HK2 A;  3HRD D;  3RNF C;  5FR6 A;  2Y5C A;  4K1R B;  2JZP A;  5CHW A;  1HZ5 A;  2JXX A;  2LHE A;  4PS7 A;  1R7S A;  1GB4 A;  3HVZ A;  1JML A;  3IHP C;  2KMA A;  4KV2 A;  1MG8 A;  3AE6 B;  3DBL I;  1IGD A;  5D2M B;  4ANX A;  4P7I A;  4YTM B;  3AED B;  3UIN B;  3RT3 B;  4US9 A;  4IDI A;  4DXA B;  2PE9 A;  5BO4 B;  3V61 A;  5IP4 D;  1EO6 A;  4WJN A;  2WXI A;  4RMA A;  2BW2 A;  4DXG A;  4OVU A;  4ACF A;  3P42 A;  1WX8 A;  2ZCB A;  2L1A A;  5BMH A;  4RCO A;  1TGZ B;  3QX1 A;  3UIP B;  4HDQ A;  3P4S B;  2WXP A;  1MHX A;  5LNK 1;  2OHF A;  1T3Q A;  3U2S C;  1J7A A;  2KN4 A;  1ET6 A;  5IOI A;  3PSE B;  2D10 A;  4DDI D;  4H2A A;  1SXT A;  1I42 A;  3ZDM C;  1P1A A;  3OG5 A;  3NZS A;  2WXQ A;  1PDX A;  1UGJ A;  3VAW A;  1Q1O A;  2IY0 B;  1R4M I;  4NNJ B;  4GDL A;  4RGO S;  2MJ3 A;  2V1Y A;  4KDI C;  2PE6 B;  2V3S A;  1C79 A;  4KSK C;  4KGT A;  2DAF A;  3FAH A;  1MG4 A;  3UQA A;  2WDV B;  3PRE A;  3KYC D;  3RYT A;  3K9O B;  1F9J A;  2A4Z A;  3FKY A;  1TIF A;  4F1S A;  4C4V A;  1V81 A;  2MCN B;  4MEL A;  4BOS C;  3A1Q A;  4ARI A;  1CK1 A;  1WMH B;  4MJS A;  5H92 C;  4EFO A;  1NYQ A;  1R4N B;  3V62 A;  3H6N A;  4IUM B;  4ZRI A;  2PTL A;  1ACC A;  1SE9 A;  1SEB D;  1VDV A;  2SEB D;  3H7P B;  2KLC A;  3P2B A;  4IWQ A;  4RFB A;  1KM7 A;  4YSX B;  3QK0 A;  4KZ0 A;  4G11 A;  1C9F A;  2FCM A;  3AN1 A;  4IOI E;  4OZA A;  2AYO B;  2CJN A;  2KDF B; 
#chains in the Genus database with same CATH homology
 5E6J A;  1OQR A;  1CQV A;  2WXR A;  1L4Z B;  2JXT A;  1VZ6 A;  1ZXH A;  2V3N A;  2QSD A;  1UWM A;  1SE4 A;  1ZDV A;  5D3D A;  1FNW A;  2WNM A;  3BYY B;  1F2R C;  5G5G A;  3TEX A;  1JCK B;  1N62 A;  2M56 B;  1IUE A;  1GTH A;  4FXC A;  3VRA B;  2VZK B;  4PT5 A;  3V05 A;  3AE1 B;  4YSY B;  2INP E;  4ZHP A;  4HRS A;  1YQ4 B;  2INN E;  1TJE A;  3VR8 B;  3ABV B;  2QEJ C;  4A6Q A;  4A55 A;  3IT6 B;  1PUT A;  1D5Z C;  1L5P A;  3B9J A;  1K50 A;  4YXD B;  2WLB A;  2GI9 A;  2W54 A;  2WS3 B;  2LEK A;  1FFV A;  2AQ3 B;  3BK2 A;  2BS4 B;  3UI3 A;  3GB1 A;  3P4R B;  4C56 C;  1AW7 A;  2DYM A;  4JE3 B;  1TKE A;  1TS3 A;  1XXG A;  4XWT A;  3BZD B;  2LMC A;  5EE9 A;  5BYR A;  1JWS D;  1FRD A;  1M4V A;  3Q8B A;  1ZE3 D;  5D7G A;  5GXG B;  1KRH A;  1P7F A;  1F77 A;  1TZO A;  4ZRQ A;  1E6E B;  1HQR D;  4N59 A;  2M19 A;  1ROE A;  2LUM A;  2K22 A;  5FKA C;  2PIA A;  2HDE A;  5H8Y E;  4C7Z A;  4HKQ A;  3ZYY X;  1VZ8 A;  3R8B A;  2W82 A;  2QIE B;  1JRO A;  1JWM D;  1D6E C;  1GPX A;  1FD6 A;  2HTM E;  2PVO D;  2LFI A;  2NMQ A;  2WXG A;  2RMM A;  1D5M C;  2LHD A;  1HA5 A;  2W3R A;  5JXV A;  3AV8 A;  2K3U A;  1FCC C;  2BB5 A;  3SFD B;  1CZP A;  2AQ2 B;  3P63 A;  4NAM A;  3H8H A;  2CU3 A;  1AN8 A;  2BYT A;  1YJI A;  4RGT A;  2OED A;  4ZYS A;  1LO5 D;  5BYQ A;  4B0M A;  2JU6 X;  1H7X A;  1YQ3 B;  4YSZ B;  5BYS A;  4KKI A;  2MEK A;  1V97 A;  4A9A A;  1NI3 A;  4YTP B;  2WQY B;  4KKJ A;  3ZQ4 A;  2H89 B;  1AWD A;  2JX5 A;  3CF4 A;  1ZDX A;  4D2K A;  1WWT A;  3BYT B;  1ET9 A;  2NTT A;  3VQI A;  1EU3 A;  3ZJV A;  1Q10 A;  2KQ4 X;  4TMA B;  3SEB A;  4NJC A;  3W5V B;  1GB1 A;  5BMG A;  4L2Y A;  1QOB A;  4RH6 A;  4L1B A;  1K52 A;  1E7P B;  2WDR B;  3IAS 1;  3J9C A;  3I57 A;  3NVW A;  1AYF A;  1L0Y B;  2ZW1 A;  3AEG B;  4TSS A;  4C80 A;  4OHJ A;  2WU5 B;  4RGM A;  1EU4 A;  1P7E A;  3W1S A;  4MH8 A;  1UUP A;  1WGK A;  1RWS A;  3U52 E;  1FCL A;  1L6V A;  3E9S A;  3URY A;  1FNV A;  2K9X A;  2WXH A;  3RFZ B;  1Y56 A;  2LJI A;  4ITK A;  2XN9 C;  4AS1 A;  4WQM A;  1KTK A;  4JWS C;  4KGS A;  1FXI A;  2X38 A;  5FK9 C;  1C76 A;  1TKG A;  2N0S B;  1VR9 A;  2IDY A;  2CJO A;  3I9V 1;  3AEF B;  1MVK A;  1I4Q A;  5HG2 A;  3AE7 B;  1L6U A;  1TKY A;  3CIR B;  1JAL A;  3BII D;  3DWM A;  5BMI A;  3LB8 C;  3Q8F A;  3AH7 A;  2V0G A;  3P4P B;  1I4P A;  4XE0 A;  5D3I B;  1XLQ A;  3U7Z A;  1EM7 A;  3KWV A;  4OZC A;  1DGJ A;  1DYQ A;  3ETR A;  1FO4 A;  4WIP A;  4ZOH C;  2LGI A;  3Q8C A;  1QOG A;  3B2F A;  3EGR A;  1XLO A;  4HKZ E;  1CJE A;  2QIL A;  3O13 A;  4USA A;  2N7J A;  1XO3 A;  3AEB B;  2VZK D;  2W3S A;  2YEP B;  2J4X A;  1HXY D;  2IJ0 A;  4OVZ A;  5C2T B;  1L0X B;  2DBY A;  2MH7 A;  1PGB A;  1K51 A;  1XF5 L;  2N9L A;  1JW9 D;  3HVD A;  2N9K A;  1HEZ E;  4L23 A;  4RF1 A;  3T3N A;  2V4I B;  2B76 B;  4GLS C;  1KLU D;  2PVG C;  1FMA D;  2E3T A;  1DOX A;  1IGC A;  2WXF A;  1ZP0 B;  2EKI A;  4RNA A;  3IXS A;  3AE4 B;  1YNT E;  1J7B A;  4IKG A;  3NVV A;  2PKO A;  3W2D A;  1JWU D;  1ZOY B;  1OQQ A;  1QQR A;  1QIL A;  1JWA D;  1B1Z A;  3AEE B;  1T5X D;  4CQN A;  1YMH E;  1D5X C;  1ZXI A;  3KQ4 A;  5FR3 A;  2JWU A;  4UDU C;  5AUK A;  3NVZ A;  1N63 A;  2IPK D;  2K5P A;  4LLG M;  4WUR A;  1TS5 A;  2PW9 A;  1XEE A;  3SFE B;  1SJH D;  3B2G A;  1XLN A;  3MP9 A;  2BS2 B;  4JX1 C;  2J42 A;  1YN3 A;  3VRB B;  4P16 A;  4KX6 B;  1GAQ B;  4MAC A;  1FNU A;  3TEW A;  4C7Y A;  3RPF C;  5MPO A;  3NUH B;  2MJE A;  2ACZ B;  3NS1 A;  4JPS A;  1SBB B;  3NZ3 A;  1MI0 A;  3CWI A;  2ZW0 A;  1IBX A;  3E56 A;  1BML C;  1EWC A;  3FIL A;  4KGR A;  1OFF A;  1YJJ A;  1A70 A;  1VZ7 A;  4A90 A;  4MM3 B;  3ZGZ A;  1E0Z A;  1STE A;  5EE3 A;  4XDD A;  3MJ5 A;  1PYW D;  5AUI A;  2PMV A;  1GTE A;  4HRO A;  2BT6 A;  1QLB B;  1KF6 B;  1N5W A;  1SIJ A;  3TUO A;  2V3P A;  4REZ A;  3P1M A;  1I7H A;  4OZB A;  2XNA C;  4RGN A;  1C4A A;  1SSN A;  1UNS A;  2Y5P A;  1I4H A;  3P4Q B;  3AE2 B;  1N61 A;  2G1E A;  3Q8E A;  1IBX B;  1BUI C;  2QMT A;  3FIL B;  1WXQ A;  2KAC A;  3R2T A;  3LYY A;  1QKZ A;  1EWY C;  4LTU A;  5HFY A;  4MT5 A;  3AEA B;  4JWU C;  1XLP A;  1NYR A;  2IGD A;  2K0P A;  4WH4 A;  5HI1 A;  3TEZ A;  1MHH E;  1TY2 A;  2MJD A;  4OW0 A;  2RDH A;  2RPV A;  2J52 A;  1C4C A;  2BTE A;  2FE8 A;  3HUI A;  2E6X A;  5EE1 A;  3AEC B;  3Q69 A;  3MFG A;  3EA6 A;  2DLB A;  4DXF A;  1QF6 A;  2KWD A;  1I4G A;  3AB5 A;  1I4X A;  1TS2 A;  1XCQ L;  1NVI D;  2L83 A;  2PLP A;  3GS2 A;  1QOA A;  2WDQ B;  3BVG A;  1SE3 A;  3T3O A;  1FRR A;  2QJL A;  2M0A A;  3C8Y A;  1GOZ A;  3NVY A;  3N9Y C;  2WU2 B;  4N6E B;  4NZL B;  1FIQ A;  2NTS A;  3DWG C;  4P6V F;  4O1N A;  1E10 A;  4US8 A;  2WXK A;  1C78 A;  3PO0 A;  4WWM A;  3WCQ A;  2H88 B;  1WRI A;  4N58 A;  4TQ0 A;  4ZHO A;  2TSS A;  1BXT A;  3HRD D;  1DOY A;  1B9R A;  2Y5C A;  1RFK A;  3TEY A;  2Q5W D;  5T8I A;  3VR9 B;  1C77 A;  1J7C A;  2JZP A;  1HZ5 A;  1RYJ A;  3AE3 B;  1C4P A;  1XCT L;  1FXA A;  1KFY B;  3AE8 B;  2WP9 B;  1NEN B;  2LHE A;  4AQ7 A;  1WYG A;  2EEL A;  1R7S A;  1SB3 C;  2GB1 A;  3ZJT A;  4XDC A;  4B0E A;  1GB4 A;  3HVZ A;  1JML A;  2AX5 A;  1JWB D;  2G9H D;  3BK1 A;  3AE6 B;  4HEA 1;  4DQO C;  5TSS A;  4YTN B;  1IGD A;  4Q2J A;  4YTM B;  3L4P A;  2IGG A;  3AED B;  4HJG E;  5G5H A;  1VLB A;  2D5G A;  2Z8L A;  4IDI A;  4US9 A;  3U4E G;  1H7W A;  3FC4 A;  3AE5 B;  3AE9 B;  1RM6 C;  2WXI A;  2BW2 A;  5HHD G;  4R3D A;  4DXG A;  3PZ7 A;  1JRP A;  4ARC A;  1K53 A;  2JSV X;  1KH0 A;  3GP7 A;  3P42 A;  3W5U B;  4YT0 B;  1FEH A;  1MPE A;  3KLS X;  4EE2 A;  2L1A A;  1YN4 A;  2ICI A;  1GT8 A;  3NRZ A;  4RCO A;  5BMH A;  3ZJU A;  2FUG 1;  2L32 A;  3P4S B;  2WXP A;  1MHX A;  2WXO A;  1ZUD 2;  1ZPS A;  5LNK 1;  4XWW A;  2OHF A;  1T3Q A;  3U2S C;  2SAK A;  1J7A A;  1N60 A;  2KN4 A;  1NEK B;  1I4R A;  1ET6 A;  4LK0 M;  1QOF A;  2ONQ A;  3BWU D;  3KWL A;  3OWE B;  1E9M A;  3BVM A;  1TY0 A;  2WXM A;  1L0V B;  3AM9 A;  4H2A A;  1SXT A;  3MHZ A;  2J53 A;  4J3O D;  3EUB 2;  2DYO A;  2JYE A;  3V3X A;  1V8C A;  2DWQ A;  2I2Y A;  1UWX A;  3IT4 B;  2WXQ A;  1FFU A;  1DOI A;  2BB6 A;  2BBC A;  1PDX A;  1UGJ A;  1SJE D;  1TYG B;  5EE0 A;  3BVZ A;  4WAF A;  1PFD A;  1F0Z A;  4RGO S;  2MJ3 A;  4RF0 A;  1YN5 A;  1FM0 D;  3IAM 1;  2R61 A;  2RDG A;  1N5X A;  1D4B A;  2JQR B;  2YEP F;  1PGX A;  1C79 A;  3LXF A;  2AQ1 B;  3R2I A;  4KGT A;  1WSP A;  3FAH A;  2Y3A A;  4ZRP A;  2WDV B;  1ESF A;  4YWG G;  2WXJ A;  3MC0 B;  2ON8 A;  1JQ4 A;  1QT9 A;  1KLG D;  3AMZ A;  2I38 A;  4GDL B;  2WXL A;  4ARI A;  1L4D B;  5C3J B;  1CK1 A;  1V1P A;  2WXN A;  5H92 C;  1NYQ A;  4M0W A;  3SR6 A;  1ENF A;  5I4D A;  2L52 A;  1T6B X;  3TSS A;  1F2R I;  2PTL A;  1ACC A;  2GRI A;  2W55 A;  4GDK B;  1V1O A;  1SEB D;  1TS4 A;  1VDV A;  2KDM A;  2SEB D;  1HZ6 A;  4RFB A;  1VRA B;  1SE2 A;  2IGH A;  1PGA A;  4YSX B;  1V1P B;  3PZ8 A;  2FBW B;  2JYT A;  1C9F A;  4A8X C;  1VJK A;  4NAW B;  3AN1 A;  3W9C B;  4IOI E;  2KAJ A;  2BS3 B;  2KMM A;  4OZA A;  4TQ1 A;  3Q8A A;  2CJN A;  1SF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...