3SFEB

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and thiabendazole
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
APRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3sfeB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sfeB01
2BS3B 1OQRA 5MPOA 2WU5B 1E6EB 2WQYB 1WYGA 1L6UA 4N59A 2PKOA 1RM6C 2EKIA 3AV8A 1FFVA 2HTME 2WDVB 3ZYYX 4ZHPA 3ABVB 1NENB 4YTPB 2PIAA 2WDRB 2QJLA 1IUEA 2KAJA 1N63A 4C7YA 3B2FA 1FO4A 3AE6B 2L52A 4US8A 3W9CB 2OHFA 3BIID 2ACZB 1KF6B 3HRDD 2DWQA 2BS2B 1FXAA 1I7HA 1QT9A 2CU3A 1JQ4A 1GPXA 1E0ZA 1NVID 5EE1A 1QOAA 1SB3C 1JWBD 3NVYA 1XO3A 4FXCA 1N60A 1SIJA 3AN1A 1FIQA 1L5PA 1TKYA 3B2GA 5G5GA 1RFKA 1L6VA 1ZUD2 4US9A 1JRPA 1NYRA 1WRIA 2L83A 2FBWB 3AECB 3AMZA 2MJDA 2Q5WD 5GXGB 2BS4B 1VDVA 3CF4A 1WXQA 1AWDA 2MH7A 3AEAB 2PVOD 3CWIA 2DBYA 1E10A 2W3SA 1GTEA 3VR9B 3FAHA 3W5VB 1PFDA 2CJOA 3L4PA 4YXDB 1FRRA 1E7PB 3VRBB 1TJEA 2MJEA 1NEKB 3AE3B 1OQQA 1FRDA 1QOBA 4JWUC 4N58A 2LEKA 3HUIA 5AUKA 5H8YE 1FXIA 1V8CA 1QOFA 1N5WA 1RYJA 2W3RA 2N0SB 1N5XA 1T3QA 2WS3B 1YJJA 1YJIA 5EE3A 3AEGB 4JX1C 1B9RA 1H7WA 5H92C 1PDXA 2WP9B 3AB5A 4YT0B 3B9JA 4C7ZA 3AEEB 4C80A 4HROA 1XLOA 1EWYC 1FM0D 3ETRA 2PVGC 1J7CA 2JX5A 2WLBA 3AM9A 1CJEA 1JROA 2H88B 4YSYB 3AEFB 3AEBB 1ZOYB 1J7AA 4KX6B 2E3TA 3AE9B 3AE4B 3P4QB 1KFYB 2K22A 1JWAD 5EE0A 1TYGB 1PUTA 3AE5B 2KMMA 1FMAD 2BT6A 3FC4A 3HVZA 5C2TB 2MJ3A 1XLPA 3PO0A 1VJKA 3P4RB 2JQRB 1RWSA 1N62A 4YSXB 4P6VF 3SR6A 4USAA 1XLQA 2AX5A 3LB8C 1J7BA 3W5UB 3NVVA 2W54A 3KWLA 3NRZA 4WWMA 3P63A 1WWTA 2G1EA 3NVZA 5AUIA 3AE8B 4YTMB 4ITKA 1YQ4B 1F0ZA 1N61A 1DOIA 3VRAB 3SFDB 3CIRB 1TKEA 1ZXIA 1A70A 2W55A 1QF6A 2K9XA 4JWSC 3AE1B 1XLNA 1L0VB 3P4SB 4ZHOA 2WU2B 1SF0A 1DOXA 2H89B 1DGJA 2B76B 2CJNA 3AH7A 3P1MA 4LTUA 1OFFA 4N6EB 3DWGC 2WDQB 4ZOHC 1CZPA 1WGKA 4A9AA 3P4PB 3AE7B 1E9MA 1QLBB 1KRHA 3DWMA 1R7SA 1TKGA 4WQMA 1JW9D 4HRSA 1JALA 2M19A 2M56B 4IDIA 4YTNB 1ZP0B 1QOGA 3NS1A 3NVWA 3AE2B 1DOYA 3SFEB 5EE9A 3RPFC 1NYQA 2K5PA 1VLBA 4YSZB 3LXFA 3AEDB 1GAQB 2Y5CA 1NI3A 3EUB2 1H7XA 1YQ3B 1V97A 1ROEA 1UWMA 5C3JB 1FFUA 1GT8A 1GTHA 3WCQA 3VR8B 5G5HA 2QIEB 1AYFA
chains in the Genus database with same CATH superfamily
1MPEA 2JXTA 3VAWA 2V9HA 1UGJA 4OVZA 1V1PA 2ZCCA 4ZHPA 4C7YA 1IUEA 1N63A 1FO4A 1FNVA 2LJ5A 2IDYA 1BT0A 4IWPA 4WIPA 1YN5A 3T9LA 4W9JA 4ICVA 2MLBA 4PT5A 3MC8A 2FUG1 3EFUA 3I9V1 2L0TA 3ZO5B 3L13A 5FKAC 5HHDG 2K3UA 1L0YB 3N9YC 1V5OA 1FRDA 1T0SC 2N9KA 1QILA 2MBQA 2N0SB 1SXTA 2FCQA 2L3ZA 2LVPA 3GS2A 3DBLI 2WP9B 2RDGA 4RNAA 5CHFA 1FD6A 3WAOA 4RM8A 3PHWB 3DVNU 2LUEA 1JROA 3UQBA 2BQQA 3AE9B 3AE4B 1SE4A 4BAXA 2IO2B 4XC2A 5C2TB 1WI0A 1UNSA 3R2IA 3ZTDA 4DDGD 4IWQA 4YSXB 4ARIA 1J7BA 3ECIA 3NG0A 1WF9A 3TBLD 4XX5A 3A9KA 1E5WA 3SFDB 2SAKA 2PW9A 1XLNA 3V61A 1YMHE 1K53A 2KDEB 3ZXRA 2DZKA 2JZZA 4BBNF 1OFFA 4ZYNA 3PLUA 4KDLB 2IO0B 2K6DB 1Q10A 1JALA 1UUPA 4HKZE 2IGDA 2WXIA 3VHTC 1NBFC 3W2DA 5EE9A 1D4BA 1K51A 4RMAA 1NI2A 2PLPA 4DBGA 3VR8B 2I38A 3U8ZA 4GDLA 5G55A 1WZ0A 3HM6X 1FPYA 4FADA 4P7IA 2LGIA 3ZTCA 3BVGA 2XEWA 3ZUNA 4RF1A 3TEZA 3PRZA 2DX5B 4GGQA 3FAHA 1E7PB 1V49A 2LEKA 1V8CA 1WFYA 2JF5A 4WJQA 2K6QA 3N20C 4EKUA 2WGSA 4KSLC 3AEEB 4LDTB 3SEBA 4OZCA 5J18A 3I63C 1JRUA 1OEYJ 4W9EA 3AEFB 1ZOYB 3DHGC 4KX6B 4M0WA 2E3TA 1CQVA 4GLSC 4PS3A 2ZNVC 5C1ZA 1HZ6A 2O6VA 2LHEA 1N62A 1F2RC 5D6JB 1WGDA 1WM3A 2D3BA 2M1MA 4HVBA 4MSMB 1MI0A 2KYWA 2JPHA 2Z8LA 3I57A 4XDCA 1MVKA 3PSEB 2WU2B 4P1BC 4JE3B 2QCZA 2BTEA 2WDQB 2QMTA 5FK9C 3AE7B 2IJ0A 3UIOB 2JRHA 1T5XD 4YTNB 1ZP0B 2BWFA 2IY0B 3MTNB 2TSSA 4DQOC 2JU6X 3SFEB 1E8XA 2K5PA 1WSPA 4IM2A 5KHOA 1NI3A 2MRPA 3EECA 2LJIA 3W1YA 5JHAA 3VFKA 4ANXA 1C76A 2JVCA 4ICUA 2DLBA 2N7JA 1Q0WB 4LNIA 2PE9A 5AZFA 1YQBA 4A8XC 3EGRA 2KDFB 2KFJA 1P1AA 3AN1A 1ZW7A 3GE8C 2G4DB 1YIWA 2GLSA 2BYTA 5HFYA 1WY8A 1LGRA 1LM8B 1NDDA 3EA6A 4PYUA 3H6NA 1EWCA 2DNFA 3C0RB 3WALA 3Q8FA 2JX5A 3B1LX 2KFKA 1EO6A 2ZVNA 3P42A 2EMTA 5BO4B 1ZXHA 1V81A 4DHJD 1C78A 1OGWA 3DBRB 2YVCA 2MWSB 4GXBA 3DVGY 4XE0A 1V86A 1HTQA 4GDKB 3NVZA 3X0WA 1Q1OA 3PZ8A 3IFWB 4RFBA 1YQ4B 1F0ZA 2VH2A 3CSTA 2B3AA 3E9SA 3ZJVA 1DGJA 2WWZA 2V0GA 4EZJA 5TSSA 1D3ZA 3NY5A 2Z0EB 4IC7B 3AI5A 3VTWA 2AQ1B 3RD2A 1NYQA 1OEYA 4LNNA 1GAQB 2Y5CA 1H7XA 4DXAB 2JZPA 4RH6A 4BVUC 4FA6A 1IGCA 2INNE 4M00A 1E6EB 2DYBA 2IY1B 2EKIA 2PIAA 4HLEA 2CHXA 1WXAA 2KVZA 1SGHA 4GOCA 2W82A 2BYEA 2A4ZA 2MA9B 3FILA 2ON8A 2QSDA 1N60A 1T0RC 2XK5B 3B2GA 1L6VA 5FR3A 2I2YA 2K39A 1WXQA 3HVDA 2HJ1A 2W3SA 3APDA 4YXDB 3ZDTA 4MEMA 3AE3B 1ZGUB 1FXIA 1N6ZA 1N5WA 2PJHA 3ONSA 3AEGB 1SEBD 1C3TA 1PDXA 3AU4A 3NZ3A 4YT0B 4HROA 2NBVB 3P2BA 2N1VA 3AM9A 2LXAA 4YSYB 2ZNVB 4B6WA 3K9PB 1ENFA 1TS3A 1PUTA 3FC4A 1XCQL 3HIZA 1VZ8A 1VJKA 3RZFA 3MJWA 4LK0M 1XEEA 2W54A 2DYOA 1WMHA 1GC7A 1WWTA 2GB1A 2M17A 5IAAC 4JIOU 1HXYD 2KT7A 1L0XB 2IO1B 5J17A 4ZHOA 1SE2A 3P1MA 2HD5B 4ZDVA 4LTUA 4YL8A 5TR5A 2BPSA 2JYEA 1QOGA 2O2VB 2C9WB 1DOYA 2WHIA 3N1XC 4HXDA 3O65B 4L2YA 4W9HA 3PV1A 4ZRJA 4EEWA 2Z0DB 3JVZX 3URYA 1SJHD 2WXQA 5BMGA 1FFVA 1I4RA 3APFA 2WXFA 2GRIA 3OWEB 4JL9A 5AZHA 3U7ZA 1E0ZA 3QCAA 2CR5A 4IKGA 3NVYA 2NMQA 2KC1A 1STEA 3I5JC 2KDMA 1ZUD2 3Q6BA 1VD2A 4HCNB 2KWUB 2N9EB 4CYEA 2FCNA 2V3NA 2JRIB 2C7HA 3M95A 2MHJA 2OEDA 3E56A 4W9FA 1MG8A 3PREA 3ZJTA 4C7ZA 5JZEB 3Q3OC 1CJEA 2KQSA 2JYTA 3Q8EA 1J7AA 2MBOA 5JH5C 3M3JA 1F77A 1I42A 2Y5BB 1WM2A 5L95C 2MX2A 1DYQA 3KUDB 2N7EA 4NJ6A 3P4RB 4GB9A 4EUTA 2LFIA 3W5UB 4A20A 3IBEA 4AP4C 3VTUA 1A70A 4S0RA 2V4IB 2MSED 1L0VB 3P4SB 2X38A 3UI3A 2B76B 2KQ4X 1XF5L 3IXSA 4A9AA 1HQRD 1YJ1A 1YX6B 2D10A 4IDIA 5CHVC 5CHWA 3QWZB 4DHJB 1I35A 1TBEA 1TGZB 1WJ6A 3L08A 3DBRI 4KZ0A 3QARA 2J42A 5C3JB 1FFUA 1P3QU 4KVGB 5G5HA 1GUAB 3T8MA 4N59A 5GMVA 3PHXB 4YTPB 3H8HA 1EU3A 4PK1A 1FCCC 2BS2B 3EC8A 2KN5A 4MGKE 4TUUA 2MW5A 2R2OA 1QOAA 1UWXA 2WXHA 3V6CB 5GXGB 4CHKA 3KLSX 2HJ8A 3JYUA 2MP2B 2DBYA 1J0GA 1YN4A 1RAXA 2MJEA 1UF0A 3N32A 4W9CA 3B08A 1B9RA 2LUMA 3RMKC 3AB5A 2LMCA 1GG3A 2AL3A 3R7QA 4ZYSA 5L83A 1SE3A 3PLVA 3TSSA 1IP9A 1JCKB 1WR6E 2G9HD 3Q8AA 3PO0A 5IP4D 3R2TA 2DZMA 3N3KB 4LNKA 3IVFA 4IWOA 5LNK1 2QC8A 2NBUA 3Q8CA 1JWSD 1UZXB 1N61A 1TKEA 3VTVA 3AU5A 1R4NI 2FUHB 2KQ7A 3ML9A 1WIAA 2ZVOA 3QAQA 1QLBB 2DAFA 4WQMA 1JW9D 2KJ6A 3KWVA 4BOZB 2LGYA 4N9F4 3BVZA 2LGXA 2E6XA 3M63B 2RD0A 1KLUD 2WQYB 1WYGA 1PGAA 3AV8A 4A90A 4NAMA 4BZAA 4HK2A 2D07B 2JY6A 4ACFA 4DWFA 2ACZB 3U4EG 2WX0A 5EE1A 2KDBA 3C19A 3VH3B 1KLVA 4QAYA 4US9A 4FJZA 4W9IA 3AEAB 4PS7A 2KD0A 3L16A 3RCZA 1F1HA 4JPSA 1NEKB 2M0AA 2NPTA 4KZCA 4AQ7A 4MGIE 2V4LA 2NBWB 4IOIE 2REXA 4IG7B 2BVCA 4GSWA 4DHZB 3GZNB 4GDKA 3AULA 3H7PA 1H4RA 5LLIA 3DHIC 2KLGA 3AEBB 2IGGA 3FKYA 4LJOB 3P4QB 4ZRQA 4A6QA 2DENB 1U4AA 3U52E 1TYGB 2KNBA 2BT6A 3HVZA 4TKNA 1M94A 5I4DA 3DBHI 2XK5A 3RNCC 4AS1A 1TT5B 1TZ1A 3RI7C 1TTNA 1D6EC 2WXGA 4MACA 5JXVA 3HK0A 5AEKB 4MDKE 1AARA 2KX3A 2D3GA 3OJ4B 2H89B 4ZRKA 5E6JA 2YEPB 1AW7A 1CZPA 4A3OA 2FCSA 2N7DA 2GBNA 2HDEA 3QX1A 4J6IA 4CQNA 4RM9A 1GB1A 1UGMA 2JXXA 5G5GA 3R7RA 1E8YA 2NVUI 1WZ3A 4RGTA 4L1BA 2LGDA 2K8CA 2HTME 3ZYYX 4KDIC 2QJLA 3VXWA 1C4AA 2DYMA 4C4VB 4US8A 4ZRPA 4EOYA 1S1QB 4WAAA 4K3CA 4JQWC 2AL6A 1WRDB 4E3CA 2YLMA 4AJYB 3M62B 3TCAA 2FBWB 3EHVA 2JT4B 2MH7A 3UF8A 3W5VB 1GOZA 3L4PA 2KVRA 1K52A 3VRBB 2IYDB 1LFDA 1QOFA 2GOWA 2W3RA 3A1QA 2BYVE 1TS4A 2I1JA 3QJZA 3WAMA 4HPLB 3PRMB 2LZ6A 2DAJA 2BKFA 3DPDA 4AUQC 2FCMA 5J2RA 3MFGA 2J7QB 1J19A 1JWUD 2KN4A 5JHBA 1WH3A 1JMLA 2YEPF 1D5MC 3WANA 4JLCA 1HZ5A 3KWLA 3DBHB 2UWQA 3PS6A 3VRAB 4P16A 2K9XA 4JWSC 2IO3B 4C56C 4MGYE 2N1WA 1WGKA 3BK2A 3PZDA 1V1PB 4HJKA 3NZUA 1K50A 3MC9A 4I6LB 4TV3A 1MG4A 4B0MA 2KJHB 1ROEA 1WXMA 3WCQA 2N9PC 2QIEB 3LDZE 2K8BA 2IBIB 1TS5A 3BZDB 4NQKE 3RNAC 2BBCA 4BKSD 1RM6C 1XXGA 4EZLA 2WDRB 2WDTB 4W9KA 1PGXA 3QA8A 3UINB 4I6PA 4FLHA 2RSUA 4ANUA 2MBEA 1FNWA 1KTKA 3ZNGC 1R4MB 4OZAA 2O6VB 1IYFA 1YOVB 4UDUC 3AMZA 3UGBB 3UQAA 2AQ2B 4WWOA 4NNJB 3N30A 3TEWA 1UELA 4JWUC 4N58A 1C4CA 5H8YE 2M4NA 1WGYA 1VZ7A 5E6NA 4P1CC 4FJVB 3PPAA 4JX1C 4RGOS 3VUXA 4DXGA 4C80A 3BWUD 1EWYC 2LGSA 2PVGC 4KGRA 2WXLA 3A9JB 3H1UA 4PYZA 3V6EB 3TEYA 3KYCD 2MJ3A 2ASQA 4S17A 2AEHA 4HKQA 4HPMB 2LI5A 4K7SA 2GBJA 3RZWC 4A55A 4RGMA 3X23A 5LXHA 1ZXIA 3TMPB 2EELA 2ZPYA 3Q8BA 1YNTE 4HDOA 3SHQA 3ZNZB 2JWZA 4GIVA 2RGFA 2LRWA 3IAS1 5AZGA 4BBNC 1E9MA 3L54A 2LVQA 2M19A 2ZZPB 3LYYA 3NS1A 4AJWA 4LLGM 1Y56A 4CO7A 3PRPB 4C4VA 2RDBC 1L4ZB 1F52A 4YSZB 4TQ1A 3V05A 1KH0A 1GT8A 3KUZA 2D3AA 2L1AA 1IPGA 4LNFA 3ZIMA 2QHOA 2WDVB 2VZKB 3RNBC 2KFKB 3VQIA 3W9CB 1XQQA 4G50A 3T3NA 2I1KA 4RF0A 1LXDA 4IW0A 1L7YA 1NVID 1SB3C 1E7UA 2INPE 5DPRA 3CSFA 3J9CA 1UH6A 2MEKA 3RNGC 3IT4B 2MJDA 2Q5WD 1QZEA 4FBJB 1OTRB 2PTLA 4X57B 3A33B 3RYTA 4WQOB 3A4SC 3GZNI 2BYFA 3PZ7A 4MM3A 3KH0A 3JSVA 1OQYA 5IOIA 3VH4B 2QDFA 5C23A 3IG3A 4W9GA 4K81A 5E6OA 2FE8A 2L7RA 3L10B 4BOSC 1HTOA 2OOBB 1V1OA 1JWMD 2LHDA 2IGHA 5BYSA 4WJNA 5HKHA 2GBRA 4FN2A 2JUOA 2LD9A 1BUIC 2XNAC 4USAA 1XLQA 2MBBB 4M8NA 4WWPA 5D2MB 4ANVA 2WX1A 4M01A 2W55A 4B95A 2N9LA 2V1YA 4E74A 2ZJDA 2MBHA 4EE2A 2V3PA 4FJYA 3Q2AC 2PEAA 3EUB2 4HEA1 1I4XA 2LRUA 3KQ4A 1AYFA 1V6EA 1EF5A 2WU5B 2N9XA 1L6UA 1EU4A 4FHJA 2WXOA 1T6BX 2O2VA 4MSQB 5CTRC 3OJ3A 1QT9A 2NTSA 4ANWA 1WXVA 2C7MB 2WXNA 2KX0A 2KO3A 1EM7A 1WRIA 1XCTL 2BS4B 1VDVA 1S3SG 1BXTA 3VUYA 2DZIA 1PFDA 2CJOA 2FNJB 2KACA 2PPHA 3Q3FA 2KC2A 1K8RB 5LXIB 1WJUA 2ZW1A 2LWPA 1YJIA 1KJTA 3B9JA 3CF6E 3VVWB 4HCPB 4HWIB 1IBXA 3MJ5A 2XBBC 3A9KB 3MHZA 2DZJA 2BF8B 2BW2A 2R2QA 2K22A 4II3B 3N1ZC 2KWCA 1FMAD 2LVOA 1Q5WB 1IGDA 1CK1A 1XLPA 1L4DB 3SR6A 3MC0B 3U2SC 2KK8A 2L32A 2KJRA 3H7PB 3NZSA 5HI1A 1P7FA 3WA0A 3NUHB 3TIXA 3ZRCA 3AE1B 3IHPC 3PGEA 4MM3B 4OVVA 2NR2A 4RGNA 5T8IA 2D5GA 2EMSA 3TJPA 4KIKB 2M56B 2DHZA 3NVWA 1T0YA 3MHSD 1VLBA 4G3XB 4D2KA 1E8WA 3U30A 3GP7A 3RNFC 3R8BA 4FULA 2UU7A 3BK1A 3Q3JA 4KKIA 1P0RA 2L00B 2CHZA 2M0XA 3BY4B 1NENB 2BB6A 2GI9A 2WXMA 1GB4A 3AE6B 2L52A 1WGGA 2OHFA 4TQ0A 4BKSA 1MJDA 4EZKA 3D32A 1GPXA 2L76A 4MH8A 2W9NA 1EF1A 2AQ3B 1RFKA 3ZKJC 4M8MA 1F2RI 2KMCA 2NCNA 1PQSA 1T0QC 2KANA 2FAZA 3ZNID 4NY0A 1E10A 1GTEA 2K1FA 2VRRB 4HDQA 3SDLC 4NJ7A 5AUKA 2RMMA 3T3OA 1WJNA 2VZKD 4MJSB 3ZDMC 3U7DA 1H7WA 1D5ZC 2AWTA 2J4XA 5D3IB 1XLOA 2R61A 1YX5B 3ETRA 5DCNA 4B9KA 4E71A 4XWTA 2H88B 2WYQA 3Q14C 1JWAD 5BYRA 1P98A 1V2YA 2NS5A 3AE5B 3OAWA 4KKJA 4ZRIA 1VR9A 3I3TB 4XGAB 1GNUA 2JQRB 2IZVB 3NS8A 3LB8C 3QQ8B 3PTFC 3ZVVA 3NRZA 2J52A 4YTMB 3O13A 1B1ZA 1DOIA 1UBQA 3NHEB 3TL5A 1GC6A 2RPVA 2PMVA 1ET6A 1SF0A 3HM3A 1M4VA 1SE9A 2N4FA 3TEXA 5DPTA 2CHWA 3DWMA 1P7EA 3HHMA 3WIMA 5BMHA 3VUWA 1WMHB 1Y8RC 4MELA 3ENEA 3KVFB 4OZBA 3W1SC 1UWMA 1GTHA 2KTFA 1YN3A 3N1YC 4MH0E 5MPOA 4F7ZA 4XZ4A 2PKOA 3OG5A 2FIFA 1A5RA 1WX7A 3ABVB 1VRAB 2KAJA 3BIID 2BKRB 5EDSA 2CU3A 2X8XX 2G45B 1JWBD 2WNMA 2NPTB 3RUIB 4IM0A 4URKA 5D3DA 2L83A 2RPQA 3A4RA 2J0KA 3GOEA 1HE8A 4XYCA 2ZEQA 3CF4A 2Y3AA 1SBBB 4IM3A 2UYZB 3ZXVA 3DDCB 1FRRA 3LJ3A 2AYOB 1QOBA 3HUIA 1EUVB 2ZW0A 4K3BA 1V5TA 1E7VA 1YJJA 4GDLB 4PS8A 4ASWC 1ZDXA 1MHHE 4KV2A 1RLFA 2C7NB 2HTHA 5D94A 4BFRA 4KSKC 4NZLB 1KFYB 1I4HA 2KLCA 3DHHC 3ZJUA 2KWDA 2NTTA 2A5UA 3KW5B 1RWSA 1KOTA 4YWGG 1R4NB 2INDC 1QKZA 3DQVA 2EKEC 4TSSA 3R66C 3ML8A 5BMIA 2CU1A 1LO5D 4LDTD 1PYWD 3V62A 1VZ6A 3JSVB 2V3SA 4N6EB 3DWGC 2GMIC 4GN1A 4I6NB 3QK0A 4HJGE 2XN9C 3Q3NC 3H9DA 3ZW3A 1C1YB 3LXFA 3V3XA 1TIFA 2KDIA 4GU2A 4M02A 3V60A 1QQRA 4NAWB 3DBSA 1X1MA 4MGZE 2WXPA 5BYQA 2KOXA 3BINA 2JSVX 3L0WB 1TZOA 3UIPB 2Z59B 1TS2A 1WE6A 4C00A 3ZRFA 1FIQA 3ZLZA 1V80A 3Q3MC 2RDHA 3DCGA 3B0AA 1CMXB 4EFOA 1AWDA 4GMVA 1WX9A 1V9JA 2PVOD 3CWIA 3VR9B 2PE6B 2OJWA 2ZCBA 2K25A 4W9DA 1ACCA 2QEJC 1RRBA 1OQQA 3IAM1 3RFZB 3PVLA 1RYJA 1N5XA 3S2AA 4NPNA 1HA5A 3RNEC 3JW0X 1KM7A 1SIFA 3H7SA 4WAFA 1MFWA 1ZPSA 1WX8A 2D3CA 4DDID 4XDDA 4NAWA 1UD7A 1C4PA 2KMMA 4MJSA 4WJPA 1D5XC 4G11A 1L2NA 3KYDD 1LQBA 3EFCA 4WWMA 2ZPNA 3BYYB 2WXRA 4ITKA 2J53A 4M0WB 1ESFA 2KMAA 3APCA 2WXJA 4DXFA 4ZOHC 5IA7A 3C8YA 1KRHA 2C5LC 1VCBA 2L8JA 1ET9A 4AWJA 3DBLB 2GBMA 2GBKA 4O1NA 4LJPB 3QIJA 1KLGD 3NJTA 4L23A 1YQ3B 1C9FA 2M8SA 3ALBA 4R3DA 5KHQA 1C77A 3NOBA 2L0FA 1P9DU 5D7GA 4WURA 3ZQ4A 1DOXA 2BB5A 3B2FA 5HG2A 1TY2A 2C60A 3OLMD 1H8CA 1KF6B 1WJ4A 3HRDD 1FXAA 5DPSA 3BVMA 2LASA 4A3PA 4FXCA 4B0EA 3R3MA 1FCLA 1L5PA 1TKYA 4FHKA 1WXSA 1JRPA 1NYRA 4DHZE 4J3OD 4K1RB 4TMAB 4WJOA 1GJZA 3DOWA 1TY0A 2BGFA 1R4MI 3K9OB 2D11A 3VDZA 5CX3A 1T3QA 2WS3B 3BYTB 3SD5A 2JZ3B 1WGRA 2LXCA 4RCOA 2K0PA 1FM0D 2KTRA 1J7CA 2BWES 2O6VD 2CKHB 4JGHB 2J0MA 3FILB 2JWUA 3DVNV 4II2B 1WYWB 1FEHA 4LNOA 1XD3B 4DK5A 2J0JA 3P63A 2G1EA 5AUIA 1MHXA 4AOFA 3QC8B 4K7UA 3GE3C 3AH7A 3L17A 1AN8A 3IT6B 1TKGA 5G2NA 4HRSA 4ARCA 3RT3B 1RFAA 2KXJA 1BMLC 2KKCA 5E6PA 2SEBD 3AEDB 2G4SA 1V97A 4WWNA 3PT2B 2BS3B 2RR9A 4BKTA 3SU8X 5IN7A 1HEZE 4Q2JA 1OQRA 1FNUA 3Q69A 2MQJA 2MCNB 3GB1A 4KIKA 1ISNA 2MP2A 2CS4A 2HE7A 1WR1A 2INCC 2DWQA 3ZNHB 1I7HA 4KGSA 1Z5SB 1JQ4A 4NQLB 1UBIA 1XO3A 2KWVB 4XWWA 1SIJA 3TUOA 2L05A 3RN9C 3AECB 4F8CB 2Y5PA 4OVUA 1XT9B 2OJRA 5IO9A 1TJEA 2K8HA 1ZKHA 4HPPA 2WXKA 2ICIA 1YD8U 5EE3A 4W9LA 3QHTA 1I4PA 5H92C 2VH1A 1WGHA 1F9JA 1SJED 3RULA 4BKGA 2IPKD 1I4GA 2WLBA 1E90A 1J8CA 1E8ZA 1SSNA 3DVGX 5EE0A 2KHWB 1C79A 4IUMB 1Z2MA 2D2QA 3AXCA 2KZRA 4P6VF 5FR6A 4F1SA 2AX5A 3NVVA 2FIDA 4WH4A 2QILA 4G0NB 4OW0A 3AE8B 5IKCM 1FXTB 3CMMB 3CIRB 1QF6A 1ZDVA 3W1SA 4LCDE 1ZE3D 2CJNA 3WAPA 1I4QA 4H2AA 4KGTA 3KUCB 4K7WA 2ONQA 4REZA 3P4PB 1PGBA 1R7SA 4NJCA 3ZGZA 1G6JA 3MP9A 4OHJA 5DPWA 3AE2B 1IBXB 4MT5A 3RPFC 2KTRB 1WE7A 3A9JA 2G3QB 3A1QB
chains in the Genus database with same CATH topology
1MPEA 1TS5A 2JXTA 3BZDB 5MPOA 3URYA 2BBCA 1SJHD 2PKOA 2WXQA 1RM6C 1XXGA 5BMGA 1FFVA 1I4RA 1UGJA 1V1PA 4OVZA 4ZHPA 3ABVB 4C7YA 2WDRB 1IUEA 1VRAB 1N63A 2KAJA 1FO4A 1FNVA 2WXFA 1PGXA 2GRIA 3BIID 2IDYA 3OWEB 2CU3A 4WIPA 1YN5A 1FNWA 3U7ZA 1KTKA 1E0ZA 4IKGA 1JWBD 2WNMA 3NVYA 2NMQA 4OZAA 1STEA 2KDMA 5D3DA 1ZUD2 2L83A 4UDUC 4PT5A 3AMZA 2FUG1 3I9V1 3CF4A 2Y3AA 1SBBB 2AQ2B 5FKAC 5HHDG 2K3UA 1L0YB 3N9YC 2V3NA 3TEWA 1FRRA 4JWUC 1QOBA 1FRDA 4N58A 1C4CA 3HUIA 5H8YE 2N9KA 1QILA 2ZW0A 2OEDA 1VZ7A 2N0SB 3E56A 1YJJA 1SXTA 4GDLB 4JX1C 3GS2A 1ZDXA 1MHHE 2WP9B 2RDGA 4RGOS 4RNAA 4C7ZA 3ZJTA 1FD6A 4DXGA 4C80A 3BWUD 1EWYC 2PVGC 4KGRA 2WXLA 1CJEA 2JYTA 3Q8EA 1JROA 1J7AA 4NZLB 3AE9B 3AE4B 1SE4A 1KFYB 1I4HA 1F77A 3ZJUA 3TEYA 2KWDA 5C2TB 2MJ3A 1DYQA 1UNSA 2NTTA 3R2IA 3P4RB 4HKQA 1RWSA 4YSXB 4ARIA 2LFIA 3W5UB 1J7BA 4YWGG 1QKZA 4TSSA 4A55A 4RGMA 3SFDB 1ZXIA 1A70A 2EELA 2PW9A 2SAKA 3Q8BA 1YNTE 5BMIA 2V4IB 1XLNA 1YMHE 1L0VB 3P4SB 1K53A 1LO5D 2X38A 3UI3A 1PYWD 2B76B 1VZ6A 2KQ4X 1OFFA 1XF5L 3DWGC 3IXSA 4N6EB 4A9AA 3IAS1 1E9MA 4HJGE 2XN9C 1HQRD 1Q10A 1JALA 2M19A 4IDIA 1UUPA 3LYYA 3NS1A 2IGDA 2WXIA 4HKZE 4LLGM 1Y56A 3W2DA 5EE9A 1L4ZB 1D4BA 3LXFA 4YSZB 4TQ1A 3V3XA 1K51A 3V05A 2J42A 1KH0A 5C3JB 1FFUA 1GT8A 2PLPA 3VR8B 2I38A 1QQRA 5G5HA 4NAWB 2L1AA 2WXPA 5BYQA 4N59A 2WDVB 4YTPB 2VZKB 3H8HA 1EU3A 2JSVX 3VQIA 3W9CB 3T3NA 1TZOA 1FCCC 2BS2B 4RF0A 1TS2A 2LGIA 1NVID 1QOAA 1SB3C 1FIQA 2INPE 3BVGA 1UWXA 3J9CA 2MEKA 3IT4B 4RF1A 3TEZA 2RDHA 2MJDA 2Q5WD 2WXHA 5GXGB 2PTLA 1AWDA 3KLSX 2PVOD 3CWIA 2DBYA 3FAHA 3VR9B 1E7PB 1ACCA 1YN4A 2QEJC 2MJEA 1OQQA 3IAM1 2LEKA 3PZ7A 3RFZB 1V8CA 1RYJA 1N5XA 1HA5A 1B9RA 2LUMA 3AB5A 2LMCA 3AEEB 4ZYSA 3SEBA 2FE8A 4OZCA 1SE3A 4WAFA 1ZPSA 3AEFB 3TSSA 1ZOYB 4KX6B 4M0WA 2E3TA 1CQVA 4XDDA 1V1OA 1JWMD 2LHDA 1JCKB 4GLSC 2IGHA 5BYSA 1C4PA 2G9HD 2KMMA 3Q8AA 3PO0A 3R2TA 1HZ6A 2LHEA 1D5XC 1BUIC 1N62A 1F2RC 2XNAC 4USAA 1XLQA 5LNK1 4WWMA 3Q8CA 1JWSD 3BYYB 2WXRA 4ITKA 1N61A 2J53A 1MI0A 1TKEA 2W55A 2Z8LA 3I57A 1ESFA 4XDCA 1MVKA 2WU2B 2N9LA 2WXJA 4DXFA 4JE3B 4ZOHC 2BTEA 2WDQB 2QMTA 3C8YA 5FK9C 3AE7B 1QLBB 1KRHA 2IJ0A 4WQMA 1JW9D 1ET9A 4EE2A 1T5XD 4YTNB 4O1NA 1ZP0B 2V3PA 2TSSA 4DQOC 2JU6X 3SFEB 3KWVA 1KLGD 2K5PA 1WSPA 1NI3A 3EUB2 4L23A 1YQ3B 1C9FA 4R3DA 4HEA1 1I4XA 1C77A 3BVZA 3KQ4A 1AYFA 2LJIA 2E6XA 2WU5B 1KLUD 5D7GA 2WQYB 1WYGA 1L6UA 1PGAA 4WURA 1EU4A 3ZQ4A 3AV8A 1DOXA 1C76A 2BB5A 4A90A 4NAMA 2WXOA 1T6BX 2DLBA 3B2FA 2N7JA 5HG2A 1TY2A 2ACZB 1KF6B 3HRDD 1FXAA 1QT9A 2NTSA 4A8XC 3U4EG 2WXNA 3EGRA 3BVMA 5EE1A 4FXCA 4B0EA 1FCLA 3AN1A 1L5PA 1TKYA 1EM7A 4US9A 1JRPA 1NYRA 1WRIA 4J3OD 1XCTL 2BS4B 1VDVA 4TMAB 2BYTA 3AEAB 1BXTA 5HFYA 1PFDA 2CJOA 2KACA 4JPSA 1TY0A 1NEKB 2M0AA 2ZW1A 3EA6A 4AQ7A 1T3QA 2WS3B 3BYTB 1EWCA 1YJIA 4IOIE 3B9JA 4RCOA 2K0PA 1IBXA 1FM0D 1J7CA 3MJ5A 3Q8FA 2JX5A 3MHZA 3AEBB 2BW2A 3P42A 2IGGA 1ZXHA 3P4QB 4ZRQA 2K22A 4A6QA 3U52E 3FILB 1TYGB 2JWUA 1C78A 1FMAD 2BT6A 3HVZA 5I4DA 1IGDA 1CK1A 1XLPA 1FEHA 1L4DB 3SR6A 4AS1A 3MC0B 4XE0A 3U2SC 2L32A 4GDKB 3P63A 2G1EA 3NVZA 5AUIA 3PZ8A 1D6EC 2WXGA 4MACA 4RFBA 5JXVA 1YQ4B 1F0ZA 5HI1A 1P7FA 1MHXA 3NUHB 3AE1B 3E9SA 3ZJVA 2H89B 1DGJA 4MM3B 3AH7A 2V0GA 1AN8A 5E6JA 2YEPB 1AW7A 1CZPA 5TSSA 4RGNA 3IT6B 5T8IA 2D5GA 1TKGA 4HRSA 2M56B 2HDEA 4ARCA 3NVWA 2AQ1B 1BMLC 1NYQA 4CQNA 1VLBA 2SEBD 3AEDB 1GAQB 2Y5CA 4D2KA 1H7XA 1V97A 1GB1A 3GP7A 2JZPA 5G5GA 3R8BA 2BS3B 4RH6A 3BK1A 1IGCA 1HEZE 2INNE 4KKIA 1OQRA 4Q2JA 1E6EB 1FNUA 3Q69A 4RGTA 4L1BA 2EKIA 2HTME 3GB1A 3ZYYX 1NENB 2BB6A 2PIAA 2QJLA 2GI9A 1C4AA 2DYMA 3AE6B 2L52A 2WXMA 1GB4A 4US8A 2OHFA 4ZRPA 4TQ0A 2DWQA 2W82A 1I7HA 3FILA 4KGSA 1JQ4A 1GPXA 2ON8A 2QSDA 1XO3A 4XWWA 1N60A 1SIJA 4MH8A 3B2GA 2AQ3B 1RFKA 3TUOA 1L6VA 5FR3A 1F2RI 2I2YA 2FBWB 3AECB 1WXQA 2Y5PA 3HVDA 2MH7A 1E10A 2W3SA 1GTEA 3W5VB 1GOZA 3L4PA 4YXDB 1K52A 3VRBB 1TJEA 3AE3B 5AUKA 2RMMA 3T3OA 2WXKA 1FXIA 2VZKD 1QOFA 1N5WA 2ICIA 2W3RA 5EE3A 3AEGB 1TS4A 1SEBD 1I4PA 1H7WA 5H92C 1PDXA 3NZ3A 1D5ZC 4YT0B 1SJED 2J4XA 5D3IB 4HROA 1XLOA 2R61A 3ETRA 2IPKD 1I4GA 2WLBA 3AM9A 3MFGA 4XWTA 2H88B 4YSYB 1JWUD 1SSNA 2KN4A 5EE0A 1JWAD 5BYRA 1ENFA 1TS3A 1PUTA 3AE5B 1C79A 3FC4A 4KKJA 1JMLA 1XCQL 1VZ8A 2YEPF 1VJKA 1VR9A 1D5MC 2JQRB 4P6VF 4LK0M 1XEEA 2AX5A 3LB8C 1HZ5A 2W54A 3NVVA 3KWLA 4WH4A 3NRZA 2QILA 2DYOA 1WWTA 2GB1A 4OW0A 1HXYD 3AE8B 4YTMB 1L0XB 2J52A 3O13A 1B1ZA 1DOIA 3VRAB 4P16A 3CIRB 1QF6A 2K9XA 1ZDVA 4JWSC 3W1SA 2RPVA 2PMVA 4C56C 4ZHOA 1ET6A 1SE2A 1SF0A 1ZE3D 2CJNA 1M4VA 1I4QA 3P1MA 4H2AA 4KGTA 4LTUA 2ONQA 4REZA 1WGKA 3P4PB 1PGBA 3TEXA 3DWMA 1P7EA 1R7SA 3BK2A 4NJCA 3ZGZA 1V1PB 2JYEA 5BMHA 3MP9A 4OHJA 1QOGA 1K50A 3AE2B 1IBXB 4B0MA 4MT5A 1DOYA 3RPFC 4OZBA 1ROEA 1UWMA 3WCQA 1GTHA 4L2YA 2QIEB 1YN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BS3 B;  1OQR A;  5MPO A;  2WU5 B;  1E6E B;  2WQY B;  1WYG A;  1L6U A;  4N59 A;  2PKO A;  1RM6 C;  2EKI A;  3AV8 A;  1FFV A;  2HTM E;  2WDV B;  3ZYY X;  4ZHP A;  3ABV B;  1NEN B;  4YTP B;  2PIA A;  2WDR B;  2QJL A;  1IUE A;  2KAJ A;  1N63 A;  4C7Y A;  3B2F A;  1FO4 A;  3AE6 B;  2L52 A;  4US8 A;  3W9C B;  2OHF A;  3BII D;  2ACZ B;  1KF6 B;  3HRD D;  2DWQ A;  2BS2 B;  1FXA A;  1I7H A;  1QT9 A;  2CU3 A;  1JQ4 A;  1GPX A;  1E0Z A;  1NVI D;  5EE1 A;  1QOA A;  1SB3 C;  1JWB D;  3NVY A;  1XO3 A;  4FXC A;  1N60 A;  1SIJ A;  3AN1 A;  1FIQ A;  1L5P A;  1TKY A;  3B2G A;  5G5G A;  1RFK A;  1L6V A;  1ZUD 2;  4US9 A;  1JRP A;  1NYR A;  1WRI A;  2L83 A;  2FBW B;  3AEC B;  3AMZ A;  2MJD A;  2Q5W D;  5GXG B;  2BS4 B;  1VDV A;  3CF4 A;  1WXQ A;  1AWD A;  2MH7 A;  3AEA B;  2PVO D;  3CWI A;  2DBY A;  1E10 A;  2W3S A;  1GTE A;  3VR9 B;  3FAH A;  3W5V B;  1PFD A;  2CJO A;  3L4P A;  4YXD B;  1FRR A;  1E7P B;  3VRB B;  1TJE A;  2MJE A;  1NEK B;  3AE3 B;  1OQQ A;  1FRD A;  1QOB A;  4JWU C;  4N58 A;  2LEK A;  3HUI A;  5AUK A;  5H8Y E;  1FXI A;  1V8C A;  1QOF A;  1N5W A;  1RYJ A;  2W3R A;  2N0S B;  1N5X A;  1T3Q A;  2WS3 B;  1YJJ A;  1YJI A;  5EE3 A;  3AEG B;  4JX1 C;  1B9R A;  1H7W A;  5H92 C;  1PDX A;  2WP9 B;  3AB5 A;  4YT0 B;  3B9J A;  4C7Z A;  3AEE B;  4C80 A;  4HRO A;  1XLO A;  1EWY C;  1FM0 D;  3ETR A;  2PVG C;  1J7C A;  2JX5 A;  2WLB A;  3AM9 A;  1CJE A;  1JRO A;  2H88 B;  4YSY B;  3AEF B;  3AEB B;  1ZOY B;  1J7A A;  4KX6 B;  2E3T A;  3AE9 B;  3AE4 B;  3P4Q B;  1KFY B;  2K22 A;  1JWA D;  5EE0 A;  1TYG B;  1PUT A;  3AE5 B;  2KMM A;  1FMA D;  2BT6 A;  3FC4 A;  3HVZ A;  5C2T B;  2MJ3 A;  1XLP A;  3PO0 A;  1VJK A;  3P4R B;  2JQR B;  1RWS A;  1N62 A;  4YSX B;  4P6V F;  3SR6 A;  4USA A;  1XLQ A;  2AX5 A;  3LB8 C;  1J7B A;  3W5U B;  3NVV A;  2W54 A;  3KWL A;  3NRZ A;  4WWM A;  3P63 A;  1WWT A;  2G1E A;  3NVZ A;  5AUI A;  3AE8 B;  4YTM B;  4ITK A;  1YQ4 B;  1F0Z A;  1N61 A;  1DOI A;  3VRA B;  3SFD B;  3CIR B;  1TKE A;  1ZXI A;  1A70 A;  2W55 A;  1QF6 A;  2K9X A;  4JWS C;  3AE1 B;  1XLN A;  1L0V B;  3P4S B;  4ZHO A;  2WU2 B;  1SF0 A;  1DOX A;  2H89 B;  1DGJ A;  2B76 B;  2CJN A;  3AH7 A;  3P1M A;  4LTU A;  1OFF A;  4N6E B;  3DWG C;  2WDQ B;  4ZOH C;  1CZP A;  1WGK A;  4A9A A;  3P4P B;  3AE7 B;  1E9M A;  1QLB B;  1KRH A;  3DWM A;  1R7S A;  1TKG A;  4WQM A;  1JW9 D;  4HRS A;  1JAL A;  2M19 A;  2M56 B;  4IDI A;  4YTN B;  1ZP0 B;  1QOG A;  3NS1 A;  3NVW A;  3AE2 B;  1DOY A;  3SFE B;  5EE9 A;  3RPF C;  1NYQ A;  2K5P A;  1VLB A;  4YSZ B;  3LXF A;  3AED B;  1GAQ B;  2Y5C A;  1NI3 A;  3EUB 2;  1H7X A;  1YQ3 B;  1V97 A;  1ROE A;  1UWM A;  5C3J B;  1FFU A;  1GT8 A;  1GTH A;  3WCQ A;  3VR8 B;  5G5H A;  2QIE B;  1AYF A; 
#chains in the Genus database with same CATH topology
 1MPE A;  2JXT A;  3VAW A;  2V9H A;  1UGJ A;  4OVZ A;  1V1P A;  2ZCC A;  4ZHP A;  4C7Y A;  1IUE A;  1N63 A;  1FO4 A;  1FNV A;  2LJ5 A;  2IDY A;  1BT0 A;  4IWP A;  4WIP A;  1YN5 A;  3T9L A;  4W9J A;  4ICV A;  2MLB A;  4PT5 A;  3MC8 A;  2FUG 1;  3EFU A;  3I9V 1;  2L0T A;  3ZO5 B;  3L13 A;  5FKA C;  5HHD G;  2K3U A;  1L0Y B;  3N9Y C;  1V5O A;  1FRD A;  1T0S C;  2N9K A;  1QIL A;  2MBQ A;  2N0S B;  1SXT A;  2FCQ A;  2L3Z A;  2LVP A;  3GS2 A;  3DBL I;  2WP9 B;  2RDG A;  4RNA A;  5CHF A;  1FD6 A;  3WAO A;  4RM8 A;  3PHW B;  3DVN U;  2LUE A;  1JRO A;  3UQB A;  2BQQ A;  3AE9 B;  3AE4 B;  1SE4 A;  4BAX A;  2IO2 B;  4XC2 A;  5C2T B;  1WI0 A;  1UNS A;  3R2I A;  3ZTD A;  4DDG D;  4IWQ A;  4YSX B;  4ARI A;  1J7B A;  3ECI A;  3NG0 A;  1WF9 A;  3TBL D;  4XX5 A;  3A9K A;  1E5W A;  3SFD B;  2SAK A;  2PW9 A;  1XLN A;  3V61 A;  1YMH E;  1K53 A;  2KDE B;  3ZXR A;  2DZK A;  2JZZ A;  4BBN F;  1OFF A;  4ZYN A;  3PLU A;  4KDL B;  2IO0 B;  2K6D B;  1Q10 A;  1JAL A;  1UUP A;  4HKZ E;  2IGD A;  2WXI A;  3VHT C;  1NBF C;  3W2D A;  5EE9 A;  1D4B A;  1K51 A;  4RMA A;  1NI2 A;  2PLP A;  4DBG A;  3VR8 B;  2I38 A;  3U8Z A;  4GDL A;  5G55 A;  1WZ0 A;  3HM6 X;  1FPY A;  4FAD A;  4P7I A;  2LGI A;  3ZTC A;  3BVG A;  2XEW A;  3ZUN A;  4RF1 A;  3TEZ A;  3PRZ A;  2DX5 B;  4GGQ A;  3FAH A;  1E7P B;  1V49 A;  2LEK A;  1V8C A;  1WFY A;  2JF5 A;  4WJQ A;  2K6Q A;  3N20 C;  4EKU A;  2WGS A;  4KSL C;  3AEE B;  4LDT B;  3SEB A;  4OZC A;  5J18 A;  3I63 C;  1JRU A;  1OEY J;  4W9E A;  3AEF B;  1ZOY B;  3DHG C;  4KX6 B;  4M0W A;  2E3T A;  1CQV A;  4GLS C;  4PS3 A;  2ZNV C;  5C1Z A;  1HZ6 A;  2O6V A;  2LHE A;  1N62 A;  1F2R C;  5D6J B;  1WGD A;  1WM3 A;  2D3B A;  2M1M A;  4HVB A;  4MSM B;  1MI0 A;  2KYW A;  2JPH A;  2Z8L A;  3I57 A;  4XDC A;  1MVK A;  3PSE B;  2WU2 B;  4P1B C;  4JE3 B;  2QCZ A;  2BTE A;  2WDQ B;  2QMT A;  5FK9 C;  3AE7 B;  2IJ0 A;  3UIO B;  2JRH A;  1T5X D;  4YTN B;  1ZP0 B;  2BWF A;  2IY0 B;  3MTN B;  2TSS A;  4DQO C;  2JU6 X;  3SFE B;  1E8X A;  2K5P A;  1WSP A;  4IM2 A;  5KHO A;  1NI3 A;  2MRP A;  3EEC A;  2LJI A;  3W1Y A;  5JHA A;  3VFK A;  4ANX A;  1C76 A;  2JVC A;  4ICU A;  2DLB A;  2N7J A;  1Q0W B;  4LNI A;  2PE9 A;  5AZF A;  1YQB A;  4A8X C;  3EGR A;  2KDF B;  2KFJ A;  1P1A A;  3AN1 A;  1ZW7 A;  3GE8 C;  2G4D B;  1YIW A;  2GLS A;  2BYT A;  5HFY A;  1WY8 A;  1LGR A;  1LM8 B;  1NDD A;  3EA6 A;  4PYU A;  3H6N A;  1EWC A;  2DNF A;  3C0R B;  3WAL A;  3Q8F A;  2JX5 A;  3B1L X;  2KFK A;  1EO6 A;  2ZVN A;  3P42 A;  2EMT A;  5BO4 B;  1ZXH A;  1V81 A;  4DHJ D;  1C78 A;  1OGW A;  3DBR B;  2YVC A;  2MWS B;  4GXB A;  3DVG Y;  4XE0 A;  1V86 A;  1HTQ A;  4GDK B;  3NVZ A;  3X0W A;  1Q1O A;  3PZ8 A;  3IFW B;  4RFB A;  1YQ4 B;  1F0Z A;  2VH2 A;  3CST A;  2B3A A;  3E9S A;  3ZJV A;  1DGJ A;  2WWZ A;  2V0G A;  4EZJ A;  5TSS A;  1D3Z A;  3NY5 A;  2Z0E B;  4IC7 B;  3AI5 A;  3VTW A;  2AQ1 B;  3RD2 A;  1NYQ A;  1OEY A;  4LNN A;  1GAQ B;  2Y5C A;  1H7X A;  4DXA B;  2JZP A;  4RH6 A;  4BVU C;  4FA6 A;  1IGC A;  2INN E;  4M00 A;  1E6E B;  2DYB A;  2IY1 B;  2EKI A;  2PIA A;  4HLE A;  2CHX A;  1WXA A;  2KVZ A;  1SGH A;  4GOC A;  2W82 A;  2BYE A;  2A4Z A;  2MA9 B;  3FIL A;  2ON8 A;  2QSD A;  1N60 A;  1T0R C;  2XK5 B;  3B2G A;  1L6V A;  5FR3 A;  2I2Y A;  2K39 A;  1WXQ A;  3HVD A;  2HJ1 A;  2W3S A;  3APD A;  4YXD B;  3ZDT A;  4MEM A;  3AE3 B;  1ZGU B;  1FXI A;  1N6Z A;  1N5W A;  2PJH A;  3ONS A;  3AEG B;  1SEB D;  1C3T A;  1PDX A;  3AU4 A;  3NZ3 A;  4YT0 B;  4HRO A;  2NBV B;  3P2B A;  2N1V A;  3AM9 A;  2LXA A;  4YSY B;  2ZNV B;  4B6W A;  3K9P B;  1ENF A;  1TS3 A;  1PUT A;  3FC4 A;  1XCQ L;  3HIZ A;  1VZ8 A;  1VJK A;  3RZF A;  3MJW A;  4LK0 M;  1XEE A;  2W54 A;  2DYO A;  1WMH A;  1GC7 A;  1WWT A;  2GB1 A;  2M17 A;  5IAA C;  4JIO U;  1HXY D;  2KT7 A;  1L0X B;  2IO1 B;  5J17 A;  4ZHO A;  1SE2 A;  3P1M A;  2HD5 B;  4ZDV A;  4LTU A;  4YL8 A;  5TR5 A;  2BPS A;  2JYE A;  1QOG A;  2O2V B;  2C9W B;  1DOY A;  2WHI A;  3N1X C;  4HXD A;  3O65 B;  4L2Y A;  4W9H A;  3PV1 A;  4ZRJ A;  4EEW A;  2Z0D B;  3JVZ X;  3URY A;  1SJH D;  2WXQ A;  5BMG A;  1FFV A;  1I4R A;  3APF A;  2WXF A;  2GRI A;  3OWE B;  4JL9 A;  5AZH A;  3U7Z A;  1E0Z A;  3QCA A;  2CR5 A;  4IKG A;  3NVY A;  2NMQ A;  2KC1 A;  1STE A;  3I5J C;  2KDM A;  1ZUD 2;  3Q6B A;  1VD2 A;  4HCN B;  2KWU B;  2N9E B;  4CYE A;  2FCN A;  2V3N A;  2JRI B;  2C7H A;  3M95 A;  2MHJ A;  2OED A;  3E56 A;  4W9F A;  1MG8 A;  3PRE A;  3ZJT A;  4C7Z A;  5JZE B;  3Q3O C;  1CJE A;  2KQS A;  2JYT A;  3Q8E A;  1J7A A;  2MBO A;  5JH5 C;  3M3J A;  1F77 A;  1I42 A;  2Y5B B;  1WM2 A;  5L95 C;  2MX2 A;  1DYQ A;  3KUD B;  2N7E A;  4NJ6 A;  3P4R B;  4GB9 A;  4EUT A;  2LFI A;  3W5U B;  4A20 A;  3IBE A;  4AP4 C;  3VTU A;  1A70 A;  4S0R A;  2V4I B;  2MSE D;  1L0V B;  3P4S B;  2X38 A;  3UI3 A;  2B76 B;  2KQ4 X;  1XF5 L;  3IXS A;  4A9A A;  1HQR D;  1YJ1 A;  1YX6 B;  2D10 A;  4IDI A;  5CHV C;  5CHW A;  3QWZ B;  4DHJ B;  1I35 A;  1TBE A;  1TGZ B;  1WJ6 A;  3L08 A;  3DBR I;  4KZ0 A;  3QAR A;  2J42 A;  5C3J B;  1FFU A;  1P3Q U;  4KVG B;  5G5H A;  1GUA B;  3T8M A;  4N59 A;  5GMV A;  3PHX B;  4YTP B;  3H8H A;  1EU3 A;  4PK1 A;  1FCC C;  2BS2 B;  3EC8 A;  2KN5 A;  4MGK E;  4TUU A;  2MW5 A;  2R2O A;  1QOA A;  1UWX A;  2WXH A;  3V6C B;  5GXG B;  4CHK A;  3KLS X;  2HJ8 A;  3JYU A;  2MP2 B;  2DBY A;  1J0G A;  1YN4 A;  1RAX A;  2MJE A;  1UF0 A;  3N32 A;  4W9C A;  3B08 A;  1B9R A;  2LUM A;  3RMK C;  3AB5 A;  2LMC A;  1GG3 A;  2AL3 A;  3R7Q A;  4ZYS A;  5L83 A;  1SE3 A;  3PLV A;  3TSS A;  1IP9 A;  1JCK B;  1WR6 E;  2G9H D;  3Q8A A;  3PO0 A;  5IP4 D;  3R2T A;  2DZM A;  3N3K B;  4LNK A;  3IVF A;  4IWO A;  5LNK 1;  2QC8 A;  2NBU A;  3Q8C A;  1JWS D;  1UZX B;  1N61 A;  1TKE A;  3VTV A;  3AU5 A;  1R4N I;  2FUH B;  2KQ7 A;  3ML9 A;  1WIA A;  2ZVO A;  3QAQ A;  1QLB B;  2DAF A;  4WQM A;  1JW9 D;  2KJ6 A;  3KWV A;  4BOZ B;  2LGY A;  4N9F 4;  3BVZ A;  2LGX A;  2E6X A;  3M63 B;  2RD0 A;  1KLU D;  2WQY B;  1WYG A;  1PGA A;  3AV8 A;  4A90 A;  4NAM A;  4BZA A;  4HK2 A;  2D07 B;  2JY6 A;  4ACF A;  4DWF A;  2ACZ B;  3U4E G;  2WX0 A;  5EE1 A;  2KDB A;  3C19 A;  3VH3 B;  1KLV A;  4QAY A;  4US9 A;  4FJZ A;  4W9I A;  3AEA B;  4PS7 A;  2KD0 A;  3L16 A;  3RCZ A;  1F1H A;  4JPS A;  1NEK B;  2M0A A;  2NPT A;  4KZC A;  4AQ7 A;  4MGI E;  2V4L A;  2NBW B;  4IOI E;  2REX A;  4IG7 B;  2BVC A;  4GSW A;  4DHZ B;  3GZN B;  4GDK A;  3AUL A;  3H7P A;  1H4R A;  5LLI A;  3DHI C;  2KLG A;  3AEB B;  2IGG A;  3FKY A;  4LJO B;  3P4Q B;  4ZRQ A;  4A6Q A;  2DEN B;  1U4A A;  3U52 E;  1TYG B;  2KNB A;  2BT6 A;  3HVZ A;  4TKN A;  1M94 A;  5I4D A;  3DBH I;  2XK5 A;  3RNC C;  4AS1 A;  1TT5 B;  1TZ1 A;  3RI7 C;  1TTN A;  1D6E C;  2WXG A;  4MAC A;  5JXV A;  3HK0 A;  5AEK B;  4MDK E;  1AAR A;  2KX3 A;  2D3G A;  3OJ4 B;  2H89 B;  4ZRK A;  5E6J A;  2YEP B;  1AW7 A;  1CZP A;  4A3O A;  2FCS A;  2N7D A;  2GBN A;  2HDE A;  3QX1 A;  4J6I A;  4CQN A;  4RM9 A;  1GB1 A;  1UGM A;  2JXX A;  5G5G A;  3R7R A;  1E8Y A;  2NVU I;  1WZ3 A;  4RGT A;  4L1B A;  2LGD A;  2K8C A;  2HTM E;  3ZYY X;  4KDI C;  2QJL A;  3VXW A;  1C4A A;  2DYM A;  4C4V B;  4US8 A;  4ZRP A;  4EOY A;  1S1Q B;  4WAA A;  4K3C A;  4JQW C;  2AL6 A;  1WRD B;  4E3C A;  2YLM A;  4AJY B;  3M62 B;  3TCA A;  2FBW B;  3EHV A;  2JT4 B;  2MH7 A;  3UF8 A;  3W5V B;  1GOZ A;  3L4P A;  2KVR A;  1K52 A;  3VRB B;  2IYD B;  1LFD A;  1QOF A;  2GOW A;  2W3R A;  3A1Q A;  2BYV E;  1TS4 A;  2I1J A;  3QJZ A;  3WAM A;  4HPL B;  3PRM B;  2LZ6 A;  2DAJ A;  2BKF A;  3DPD A;  4AUQ C;  2FCM A;  5J2R A;  3MFG A;  2J7Q B;  1J19 A;  1JWU D;  2KN4 A;  5JHB A;  1WH3 A;  1JML A;  2YEP F;  1D5M C;  3WAN A;  4JLC A;  1HZ5 A;  3KWL A;  3DBH B;  2UWQ A;  3PS6 A;  3VRA B;  4P16 A;  2K9X A;  4JWS C;  2IO3 B;  4C56 C;  4MGY E;  2N1W A;  1WGK A;  3BK2 A;  3PZD A;  1V1P B;  4HJK A;  3NZU A;  1K50 A;  3MC9 A;  4I6L B;  4TV3 A;  1MG4 A;  4B0M A;  2KJH B;  1ROE A;  1WXM A;  3WCQ A;  2N9P C;  2QIE B;  3LDZ E;  2K8B A;  2IBI B;  1TS5 A;  3BZD B;  4NQK E;  3RNA C;  2BBC A;  4BKS D;  1RM6 C;  1XXG A;  4EZL A;  2WDR B;  2WDT B;  4W9K A;  1PGX A;  3QA8 A;  3UIN B;  4I6P A;  4FLH A;  2RSU A;  4ANU A;  2MBE A;  1FNW A;  1KTK A;  3ZNG C;  1R4M B;  4OZA A;  2O6V B;  1IYF A;  1YOV B;  4UDU C;  3AMZ A;  3UGB B;  3UQA A;  2AQ2 B;  4WWO A;  4NNJ B;  3N30 A;  3TEW A;  1UEL A;  4JWU C;  4N58 A;  1C4C A;  5H8Y E;  2M4N A;  1WGY A;  1VZ7 A;  5E6N A;  4P1C C;  4FJV B;  3PPA A;  4JX1 C;  4RGO S;  3VUX A;  4DXG A;  4C80 A;  3BWU D;  1EWY C;  2LGS A;  2PVG C;  4KGR A;  2WXL A;  3A9J B;  3H1U A;  4PYZ A;  3V6E B;  3TEY A;  3KYC D;  2MJ3 A;  2ASQ A;  4S17 A;  2AEH A;  4HKQ A;  4HPM B;  2LI5 A;  4K7S A;  2GBJ A;  3RZW C;  4A55 A;  4RGM A;  3X23 A;  5LXH A;  1ZXI A;  3TMP B;  2EEL A;  2ZPY A;  3Q8B A;  1YNT E;  4HDO A;  3SHQ A;  3ZNZ B;  2JWZ A;  4GIV A;  2RGF A;  2LRW A;  3IAS 1;  5AZG A;  4BBN C;  1E9M A;  3L54 A;  2LVQ A;  2M19 A;  2ZZP B;  3LYY A;  3NS1 A;  4AJW A;  4LLG M;  1Y56 A;  4CO7 A;  3PRP B;  4C4V A;  2RDB C;  1L4Z B;  1F52 A;  4YSZ B;  4TQ1 A;  3V05 A;  1KH0 A;  1GT8 A;  3KUZ A;  2D3A A;  2L1A A;  1IPG A;  4LNF A;  3ZIM A;  2QHO A;  2WDV B;  2VZK B;  3RNB C;  2KFK B;  3VQI A;  3W9C B;  1XQQ A;  4G50 A;  3T3N A;  2I1K A;  4RF0 A;  1LXD A;  4IW0 A;  1L7Y A;  1NVI D;  1SB3 C;  1E7U A;  2INP E;  5DPR A;  3CSF A;  3J9C A;  1UH6 A;  2MEK A;  3RNG C;  3IT4 B;  2MJD A;  2Q5W D;  1QZE A;  4FBJ B;  1OTR B;  2PTL A;  4X57 B;  3A33 B;  3RYT A;  4WQO B;  3A4S C;  3GZN I;  2BYF A;  3PZ7 A;  4MM3 A;  3KH0 A;  3JSV A;  1OQY A;  5IOI A;  3VH4 B;  2QDF A;  5C23 A;  3IG3 A;  4W9G A;  4K81 A;  5E6O A;  2FE8 A;  2L7R A;  3L10 B;  4BOS C;  1HTO A;  2OOB B;  1V1O A;  1JWM D;  2LHD A;  2IGH A;  5BYS A;  4WJN A;  5HKH A;  2GBR A;  4FN2 A;  2JUO A;  2LD9 A;  1BUI C;  2XNA C;  4USA A;  1XLQ A;  2MBB B;  4M8N A;  4WWP A;  5D2M B;  4ANV A;  2WX1 A;  4M01 A;  2W55 A;  4B95 A;  2N9L A;  2V1Y A;  4E74 A;  2ZJD A;  2MBH A;  4EE2 A;  2V3P A;  4FJY A;  3Q2A C;  2PEA A;  3EUB 2;  4HEA 1;  1I4X A;  2LRU A;  3KQ4 A;  1AYF A;  1V6E A;  1EF5 A;  2WU5 B;  2N9X A;  1L6U A;  1EU4 A;  4FHJ A;  2WXO A;  1T6B X;  2O2V A;  4MSQ B;  5CTR C;  3OJ3 A;  1QT9 A;  2NTS A;  4ANW A;  1WXV A;  2C7M B;  2WXN A;  2KX0 A;  2KO3 A;  1EM7 A;  1WRI A;  1XCT L;  2BS4 B;  1VDV A;  1S3S G;  1BXT A;  3VUY A;  2DZI A;  1PFD A;  2CJO A;  2FNJ B;  2KAC A;  2PPH A;  3Q3F A;  2KC2 A;  1K8R B;  5LXI B;  1WJU A;  2ZW1 A;  2LWP A;  1YJI A;  1KJT A;  3B9J A;  3CF6 E;  3VVW B;  4HCP B;  4HWI B;  1IBX A;  3MJ5 A;  2XBB C;  3A9K B;  3MHZ A;  2DZJ A;  2BF8 B;  2BW2 A;  2R2Q A;  2K22 A;  4II3 B;  3N1Z C;  2KWC A;  1FMA D;  2LVO A;  1Q5W B;  1IGD A;  1CK1 A;  1XLP A;  1L4D B;  3SR6 A;  3MC0 B;  3U2S C;  2KK8 A;  2L32 A;  2KJR A;  3H7P B;  3NZS A;  5HI1 A;  1P7F A;  3WA0 A;  3NUH B;  3TIX A;  3ZRC A;  3AE1 B;  3IHP C;  3PGE A;  4MM3 B;  4OVV A;  2NR2 A;  4RGN A;  5T8I A;  2D5G A;  2EMS A;  3TJP A;  4KIK B;  2M56 B;  2DHZ A;  3NVW A;  1T0Y A;  3MHS D;  1VLB A;  4G3X B;  4D2K A;  1E8W A;  3U30 A;  3GP7 A;  3RNF C;  3R8B A;  4FUL A;  2UU7 A;  3BK1 A;  3Q3J A;  4KKI A;  1P0R A;  2L00 B;  2CHZ A;  2M0X A;  3BY4 B;  1NEN B;  2BB6 A;  2GI9 A;  2WXM A;  1GB4 A;  3AE6 B;  2L52 A;  1WGG A;  2OHF A;  4TQ0 A;  4BKS A;  1MJD A;  4EZK A;  3D32 A;  1GPX A;  2L76 A;  4MH8 A;  2W9N A;  1EF1 A;  2AQ3 B;  1RFK A;  3ZKJ C;  4M8M A;  1F2R I;  2KMC A;  2NCN A;  1PQS A;  1T0Q C;  2KAN A;  2FAZ A;  3ZNI D;  4NY0 A;  1E10 A;  1GTE A;  2K1F A;  2VRR B;  4HDQ A;  3SDL C;  4NJ7 A;  5AUK A;  2RMM A;  3T3O A;  1WJN A;  2VZK D;  4MJS B;  3ZDM C;  3U7D A;  1H7W A;  1D5Z C;  2AWT A;  2J4X A;  5D3I B;  1XLO A;  2R61 A;  1YX5 B;  3ETR A;  5DCN A;  4B9K A;  4E71 A;  4XWT A;  2H88 B;  2WYQ A;  3Q14 C;  1JWA D;  5BYR A;  1P98 A;  1V2Y A;  2NS5 A;  3AE5 B;  3OAW A;  4KKJ A;  4ZRI A;  1VR9 A;  3I3T B;  4XGA B;  1GNU A;  2JQR B;  2IZV B;  3NS8 A;  3LB8 C;  3QQ8 B;  3PTF C;  3ZVV A;  3NRZ A;  2J52 A;  4YTM B;  3O13 A;  1B1Z A;  1DOI A;  1UBQ A;  3NHE B;  3TL5 A;  1GC6 A;  2RPV A;  2PMV A;  1ET6 A;  1SF0 A;  3HM3 A;  1M4V A;  1SE9 A;  2N4F A;  3TEX A;  5DPT A;  2CHW A;  3DWM A;  1P7E A;  3HHM A;  3WIM A;  5BMH A;  3VUW A;  1WMH B;  1Y8R C;  4MEL A;  3ENE A;  3KVF B;  4OZB A;  3W1S C;  1UWM A;  1GTH A;  2KTF A;  1YN3 A;  3N1Y C;  4MH0 E;  5MPO A;  4F7Z A;  4XZ4 A;  2PKO A;  3OG5 A;  2FIF A;  1A5R A;  1WX7 A;  3ABV B;  1VRA B;  2KAJ A;  3BII D;  2BKR B;  5EDS A;  2CU3 A;  2X8X X;  2G45 B;  1JWB D;  2WNM A;  2NPT B;  3RUI B;  4IM0 A;  4URK A;  5D3D A;  2L83 A;  2RPQ A;  3A4R A;  2J0K A;  3GOE A;  1HE8 A;  4XYC A;  2ZEQ A;  3CF4 A;  2Y3A A;  1SBB B;  4IM3 A;  2UYZ B;  3ZXV A;  3DDC B;  1FRR A;  3LJ3 A;  2AYO B;  1QOB A;  3HUI A;  1EUV B;  2ZW0 A;  4K3B A;  1V5T A;  1E7V A;  1YJJ A;  4GDL B;  4PS8 A;  4ASW C;  1ZDX A;  1MHH E;  4KV2 A;  1RLF A;  2C7N B;  2HTH A;  5D94 A;  4BFR A;  4KSK C;  4NZL B;  1KFY B;  1I4H A;  2KLC A;  3DHH C;  3ZJU A;  2KWD A;  2NTT A;  2A5U A;  3KW5 B;  1RWS A;  1KOT A;  4YWG G;  1R4N B;  2IND C;  1QKZ A;  3DQV A;  2EKE C;  4TSS A;  3R66 C;  3ML8 A;  5BMI A;  2CU1 A;  1LO5 D;  4LDT D;  1PYW D;  3V62 A;  1VZ6 A;  3JSV B;  2V3S A;  4N6E B;  3DWG C;  2GMI C;  4GN1 A;  4I6N B;  3QK0 A;  4HJG E;  2XN9 C;  3Q3N C;  3H9D A;  3ZW3 A;  1C1Y B;  3LXF A;  3V3X A;  1TIF A;  2KDI A;  4GU2 A;  4M02 A;  3V60 A;  1QQR A;  4NAW B;  3DBS A;  1X1M A;  4MGZ E;  2WXP A;  5BYQ A;  2KOX A;  3BIN A;  2JSV X;  3L0W B;  1TZO A;  3UIP B;  2Z59 B;  1TS2 A;  1WE6 A;  4C00 A;  3ZRF A;  1FIQ A;  3ZLZ A;  1V80 A;  3Q3M C;  2RDH A;  3DCG A;  3B0A A;  1CMX B;  4EFO A;  1AWD A;  4GMV A;  1WX9 A;  1V9J A;  2PVO D;  3CWI A;  3VR9 B;  2PE6 B;  2OJW A;  2ZCB A;  2K25 A;  4W9D A;  1ACC A;  2QEJ C;  1RRB A;  1OQQ A;  3IAM 1;  3RFZ B;  3PVL A;  1RYJ A;  1N5X A;  3S2A A;  4NPN A;  1HA5 A;  3RNE C;  3JW0 X;  1KM7 A;  1SIF A;  3H7S A;  4WAF A;  1MFW A;  1ZPS A;  1WX8 A;  2D3C A;  4DDI D;  4XDD A;  4NAW A;  1UD7 A;  1C4P A;  2KMM A;  4MJS A;  4WJP A;  1D5X C;  4G11 A;  1L2N A;  3KYD D;  1LQB A;  3EFC A;  4WWM A;  2ZPN A;  3BYY B;  2WXR A;  4ITK A;  2J53 A;  4M0W B;  1ESF A;  2KMA A;  3APC A;  2WXJ A;  4DXF A;  4ZOH C;  5IA7 A;  3C8Y A;  1KRH A;  2C5L C;  1VCB A;  2L8J A;  1ET9 A;  4AWJ A;  3DBL B;  2GBM A;  2GBK A;  4O1N A;  4LJP B;  3QIJ A;  1KLG D;  3NJT A;  4L23 A;  1YQ3 B;  1C9F A;  2M8S A;  3ALB A;  4R3D A;  5KHQ A;  1C77 A;  3NOB A;  2L0F A;  1P9D U;  5D7G A;  4WUR A;  3ZQ4 A;  1DOX A;  2BB5 A;  3B2F A;  5HG2 A;  1TY2 A;  2C60 A;  3OLM D;  1H8C A;  1KF6 B;  1WJ4 A;  3HRD D;  1FXA A;  5DPS A;  3BVM A;  2LAS A;  4A3P A;  4FXC A;  4B0E A;  3R3M A;  1FCL A;  1L5P A;  1TKY A;  4FHK A;  1WXS A;  1JRP A;  1NYR A;  4DHZ E;  4J3O D;  4K1R B;  4TMA B;  4WJO A;  1GJZ A;  3DOW A;  1TY0 A;  2BGF A;  1R4M I;  3K9O B;  2D11 A;  3VDZ A;  5CX3 A;  1T3Q A;  2WS3 B;  3BYT B;  3SD5 A;  2JZ3 B;  1WGR A;  2LXC A;  4RCO A;  2K0P A;  1FM0 D;  2KTR A;  1J7C A;  2BWE S;  2O6V D;  2CKH B;  4JGH B;  2J0M A;  3FIL B;  2JWU A;  3DVN V;  4II2 B;  1WYW B;  1FEH A;  4LNO A;  1XD3 B;  4DK5 A;  2J0J A;  3P63 A;  2G1E A;  5AUI A;  1MHX A;  4AOF A;  3QC8 B;  4K7U A;  3GE3 C;  3AH7 A;  3L17 A;  1AN8 A;  3IT6 B;  1TKG A;  5G2N A;  4HRS A;  4ARC A;  3RT3 B;  1RFA A;  2KXJ A;  1BML C;  2KKC A;  5E6P A;  2SEB D;  3AED B;  2G4S A;  1V97 A;  4WWN A;  3PT2 B;  2BS3 B;  2RR9 A;  4BKT A;  3SU8 X;  5IN7 A;  1HEZ E;  4Q2J A;  1OQR A;  1FNU A;  3Q69 A;  2MQJ A;  2MCN B;  3GB1 A;  4KIK A;  1ISN A;  2MP2 A;  2CS4 A;  2HE7 A;  1WR1 A;  2INC C;  2DWQ A;  3ZNH B;  1I7H A;  4KGS A;  1Z5S B;  1JQ4 A;  4NQL B;  1UBI A;  1XO3 A;  2KWV B;  4XWW A;  1SIJ A;  3TUO A;  2L05 A;  3RN9 C;  3AEC B;  4F8C B;  2Y5P A;  4OVU A;  1XT9 B;  2OJR A;  5IO9 A;  1TJE A;  2K8H A;  1ZKH A;  4HPP A;  2WXK A;  2ICI A;  1YD8 U;  5EE3 A;  4W9L A;  3QHT A;  1I4P A;  5H92 C;  2VH1 A;  1WGH A;  1F9J A;  1SJE D;  3RUL A;  4BKG A;  2IPK D;  1I4G A;  2WLB A;  1E90 A;  1J8C A;  1E8Z A;  1SSN A;  3DVG X;  5EE0 A;  2KHW B;  1C79 A;  4IUM B;  1Z2M A;  2D2Q A;  3AXC A;  2KZR A;  4P6V F;  5FR6 A;  4F1S A;  2AX5 A;  3NVV A;  2FID A;  4WH4 A;  2QIL A;  4G0N B;  4OW0 A;  3AE8 B;  5IKC M;  1FXT B;  3CMM B;  3CIR B;  1QF6 A;  1ZDV A;  3W1S A;  4LCD E;  1ZE3 D;  2CJN A;  3WAP A;  1I4Q A;  4H2A A;  4KGT A;  3KUC B;  4K7W A;  2ONQ A;  4REZ A;  3P4P B;  1PGB A;  1R7S A;  4NJC A;  3ZGZ A;  1G6J A;  3MP9 A;  4OHJ A;  5DPW A;  3AE2 B;  1IBX B;  4MT5 A;  3RPF C;  2KTR B;  1WE7 A;  3A9J A;  2G3Q B;  3A1Q B; 
#chains in the Genus database with same CATH homology
 1MPE A;  1TS5 A;  2JXT A;  3BZD B;  5MPO A;  3URY A;  2BBC A;  1SJH D;  2PKO A;  2WXQ A;  1RM6 C;  1XXG A;  5BMG A;  1FFV A;  1I4R A;  1UGJ A;  1V1P A;  4OVZ A;  4ZHP A;  3ABV B;  4C7Y A;  2WDR B;  1IUE A;  1VRA B;  1N63 A;  2KAJ A;  1FO4 A;  1FNV A;  2WXF A;  1PGX A;  2GRI A;  3BII D;  2IDY A;  3OWE B;  2CU3 A;  4WIP A;  1YN5 A;  1FNW A;  3U7Z A;  1KTK A;  1E0Z A;  4IKG A;  1JWB D;  2WNM A;  3NVY A;  2NMQ A;  4OZA A;  1STE A;  2KDM A;  5D3D A;  1ZUD 2;  2L83 A;  4UDU C;  4PT5 A;  3AMZ A;  2FUG 1;  3I9V 1;  3CF4 A;  2Y3A A;  1SBB B;  2AQ2 B;  5FKA C;  5HHD G;  2K3U A;  1L0Y B;  3N9Y C;  2V3N A;  3TEW A;  1FRR A;  4JWU C;  1QOB A;  1FRD A;  4N58 A;  1C4C A;  3HUI A;  5H8Y E;  2N9K A;  1QIL A;  2ZW0 A;  2OED A;  1VZ7 A;  2N0S B;  3E56 A;  1YJJ A;  1SXT A;  4GDL B;  4JX1 C;  3GS2 A;  1ZDX A;  1MHH E;  2WP9 B;  2RDG A;  4RGO S;  4RNA A;  4C7Z A;  3ZJT A;  1FD6 A;  4DXG A;  4C80 A;  3BWU D;  1EWY C;  2PVG C;  4KGR A;  2WXL A;  1CJE A;  2JYT A;  3Q8E A;  1JRO A;  1J7A A;  4NZL B;  3AE9 B;  3AE4 B;  1SE4 A;  1KFY B;  1I4H A;  1F77 A;  3ZJU A;  3TEY A;  2KWD A;  5C2T B;  2MJ3 A;  1DYQ A;  1UNS A;  2NTT A;  3R2I A;  3P4R B;  4HKQ A;  1RWS A;  4YSX B;  4ARI A;  2LFI A;  3W5U B;  1J7B A;  4YWG G;  1QKZ A;  4TSS A;  4A55 A;  4RGM A;  3SFD B;  1ZXI A;  1A70 A;  2EEL A;  2PW9 A;  2SAK A;  3Q8B A;  1YNT E;  5BMI A;  2V4I B;  1XLN A;  1YMH E;  1L0V B;  3P4S B;  1K53 A;  1LO5 D;  2X38 A;  3UI3 A;  1PYW D;  2B76 B;  1VZ6 A;  2KQ4 X;  1OFF A;  1XF5 L;  3DWG C;  3IXS A;  4N6E B;  4A9A A;  3IAS 1;  1E9M A;  4HJG E;  2XN9 C;  1HQR D;  1Q10 A;  1JAL A;  2M19 A;  4IDI A;  1UUP A;  3LYY A;  3NS1 A;  2IGD A;  2WXI A;  4HKZ E;  4LLG M;  1Y56 A;  3W2D A;  5EE9 A;  1L4Z B;  1D4B A;  3LXF A;  4YSZ B;  4TQ1 A;  3V3X A;  1K51 A;  3V05 A;  2J42 A;  1KH0 A;  5C3J B;  1FFU A;  1GT8 A;  2PLP A;  3VR8 B;  2I38 A;  1QQR A;  5G5H A;  4NAW B;  2L1A A;  2WXP A;  5BYQ A;  4N59 A;  2WDV B;  4YTP B;  2VZK B;  3H8H A;  1EU3 A;  2JSV X;  3VQI A;  3W9C B;  3T3N A;  1TZO A;  1FCC C;  2BS2 B;  4RF0 A;  1TS2 A;  2LGI A;  1NVI D;  1QOA A;  1SB3 C;  1FIQ A;  2INP E;  3BVG A;  1UWX A;  3J9C A;  2MEK A;  3IT4 B;  4RF1 A;  3TEZ A;  2RDH A;  2MJD A;  2Q5W D;  2WXH A;  5GXG B;  2PTL A;  1AWD A;  3KLS X;  2PVO D;  3CWI A;  2DBY A;  3FAH A;  3VR9 B;  1E7P B;  1ACC A;  1YN4 A;  2QEJ C;  2MJE A;  1OQQ A;  3IAM 1;  2LEK A;  3PZ7 A;  3RFZ B;  1V8C A;  1RYJ A;  1N5X A;  1HA5 A;  1B9R A;  2LUM A;  3AB5 A;  2LMC A;  3AEE B;  4ZYS A;  3SEB A;  2FE8 A;  4OZC A;  1SE3 A;  4WAF A;  1ZPS A;  3AEF B;  3TSS A;  1ZOY B;  4KX6 B;  4M0W A;  2E3T A;  1CQV A;  4XDD A;  1V1O A;  1JWM D;  2LHD A;  1JCK B;  4GLS C;  2IGH A;  5BYS A;  1C4P A;  2G9H D;  2KMM A;  3Q8A A;  3PO0 A;  3R2T A;  1HZ6 A;  2LHE A;  1D5X C;  1BUI C;  1N62 A;  1F2R C;  2XNA C;  4USA A;  1XLQ A;  5LNK 1;  4WWM A;  3Q8C A;  1JWS D;  3BYY B;  2WXR A;  4ITK A;  1N61 A;  2J53 A;  1MI0 A;  1TKE A;  2W55 A;  2Z8L A;  3I57 A;  1ESF A;  4XDC A;  1MVK A;  2WU2 B;  2N9L A;  2WXJ A;  4DXF A;  4JE3 B;  4ZOH C;  2BTE A;  2WDQ B;  2QMT A;  3C8Y A;  5FK9 C;  3AE7 B;  1QLB B;  1KRH A;  2IJ0 A;  4WQM A;  1JW9 D;  1ET9 A;  4EE2 A;  1T5X D;  4YTN B;  4O1N A;  1ZP0 B;  2V3P A;  2TSS A;  4DQO C;  2JU6 X;  3SFE B;  3KWV A;  1KLG D;  2K5P A;  1WSP A;  1NI3 A;  3EUB 2;  4L23 A;  1YQ3 B;  1C9F A;  4R3D A;  4HEA 1;  1I4X A;  1C77 A;  3BVZ A;  3KQ4 A;  1AYF A;  2LJI A;  2E6X A;  2WU5 B;  1KLU D;  5D7G A;  2WQY B;  1WYG A;  1L6U A;  1PGA A;  4WUR A;  1EU4 A;  3ZQ4 A;  3AV8 A;  1DOX A;  1C76 A;  2BB5 A;  4A90 A;  4NAM A;  2WXO A;  1T6B X;  2DLB A;  3B2F A;  2N7J A;  5HG2 A;  1TY2 A;  2ACZ B;  1KF6 B;  3HRD D;  1FXA A;  1QT9 A;  2NTS A;  4A8X C;  3U4E G;  2WXN A;  3EGR A;  3BVM A;  5EE1 A;  4FXC A;  4B0E A;  1FCL A;  3AN1 A;  1L5P A;  1TKY A;  1EM7 A;  4US9 A;  1JRP A;  1NYR A;  1WRI A;  4J3O D;  1XCT L;  2BS4 B;  1VDV A;  4TMA B;  2BYT A;  3AEA B;  1BXT A;  5HFY A;  1PFD A;  2CJO A;  2KAC A;  4JPS A;  1TY0 A;  1NEK B;  2M0A A;  2ZW1 A;  3EA6 A;  4AQ7 A;  1T3Q A;  2WS3 B;  3BYT B;  1EWC A;  1YJI A;  4IOI E;  3B9J A;  4RCO A;  2K0P A;  1IBX A;  1FM0 D;  1J7C A;  3MJ5 A;  3Q8F A;  2JX5 A;  3MHZ A;  3AEB B;  2BW2 A;  3P42 A;  2IGG A;  1ZXH A;  3P4Q B;  4ZRQ A;  2K22 A;  4A6Q A;  3U52 E;  3FIL B;  1TYG B;  2JWU A;  1C78 A;  1FMA D;  2BT6 A;  3HVZ A;  5I4D A;  1IGD A;  1CK1 A;  1XLP A;  1FEH A;  1L4D B;  3SR6 A;  4AS1 A;  3MC0 B;  4XE0 A;  3U2S C;  2L32 A;  4GDK B;  3P63 A;  2G1E A;  3NVZ A;  5AUI A;  3PZ8 A;  1D6E C;  2WXG A;  4MAC A;  4RFB A;  5JXV A;  1YQ4 B;  1F0Z A;  5HI1 A;  1P7F A;  1MHX A;  3NUH B;  3AE1 B;  3E9S A;  3ZJV A;  2H89 B;  1DGJ A;  4MM3 B;  3AH7 A;  2V0G A;  1AN8 A;  5E6J A;  2YEP B;  1AW7 A;  1CZP A;  5TSS A;  4RGN A;  3IT6 B;  5T8I A;  2D5G A;  1TKG A;  4HRS A;  2M56 B;  2HDE A;  4ARC A;  3NVW A;  2AQ1 B;  1BML C;  1NYQ A;  4CQN A;  1VLB A;  2SEB D;  3AED B;  1GAQ B;  2Y5C A;  4D2K A;  1H7X A;  1V97 A;  1GB1 A;  3GP7 A;  2JZP A;  5G5G A;  3R8B A;  2BS3 B;  4RH6 A;  3BK1 A;  1IGC A;  1HEZ E;  2INN E;  4KKI A;  1OQR A;  4Q2J A;  1E6E B;  1FNU A;  3Q69 A;  4RGT A;  4L1B A;  2EKI A;  2HTM E;  3GB1 A;  3ZYY X;  1NEN B;  2BB6 A;  2PIA A;  2QJL A;  2GI9 A;  1C4A A;  2DYM A;  3AE6 B;  2L52 A;  2WXM A;  1GB4 A;  4US8 A;  2OHF A;  4ZRP A;  4TQ0 A;  2DWQ A;  2W82 A;  1I7H A;  3FIL A;  4KGS A;  1JQ4 A;  1GPX A;  2ON8 A;  2QSD A;  1XO3 A;  4XWW A;  1N60 A;  1SIJ A;  4MH8 A;  3B2G A;  2AQ3 B;  1RFK A;  3TUO A;  1L6V A;  5FR3 A;  1F2R I;  2I2Y A;  2FBW B;  3AEC B;  1WXQ A;  2Y5P A;  3HVD A;  2MH7 A;  1E10 A;  2W3S A;  1GTE A;  3W5V B;  1GOZ A;  3L4P A;  4YXD B;  1K52 A;  3VRB B;  1TJE A;  3AE3 B;  5AUK A;  2RMM A;  3T3O A;  2WXK A;  1FXI A;  2VZK D;  1QOF A;  1N5W A;  2ICI A;  2W3R A;  5EE3 A;  3AEG B;  1TS4 A;  1SEB D;  1I4P A;  1H7W A;  5H92 C;  1PDX A;  3NZ3 A;  1D5Z C;  4YT0 B;  1SJE D;  2J4X A;  5D3I B;  4HRO A;  1XLO A;  2R61 A;  3ETR A;  2IPK D;  1I4G A;  2WLB A;  3AM9 A;  3MFG A;  4XWT A;  2H88 B;  4YSY B;  1JWU D;  1SSN A;  2KN4 A;  5EE0 A;  1JWA D;  5BYR A;  1ENF A;  1TS3 A;  1PUT A;  3AE5 B;  1C79 A;  3FC4 A;  4KKJ A;  1JML A;  1XCQ L;  1VZ8 A;  2YEP F;  1VJK A;  1VR9 A;  1D5M C;  2JQR B;  4P6V F;  4LK0 M;  1XEE A;  2AX5 A;  3LB8 C;  1HZ5 A;  2W54 A;  3NVV A;  3KWL A;  4WH4 A;  3NRZ A;  2QIL A;  2DYO A;  1WWT A;  2GB1 A;  4OW0 A;  1HXY D;  3AE8 B;  4YTM B;  1L0X B;  2J52 A;  3O13 A;  1B1Z A;  1DOI A;  3VRA B;  4P16 A;  3CIR B;  1QF6 A;  2K9X A;  1ZDV A;  4JWS C;  3W1S A;  2RPV A;  2PMV A;  4C56 C;  4ZHO A;  1ET6 A;  1SE2 A;  1SF0 A;  1ZE3 D;  2CJN A;  1M4V A;  1I4Q A;  3P1M A;  4H2A A;  4KGT A;  4LTU A;  2ONQ A;  4REZ A;  1WGK A;  3P4P B;  1PGB A;  3TEX A;  3DWM A;  1P7E A;  1R7S A;  3BK2 A;  4NJC A;  3ZGZ A;  1V1P B;  2JYE A;  5BMH A;  3MP9 A;  4OHJ A;  1QOG A;  1K50 A;  3AE2 B;  1IBX B;  4B0M A;  4MT5 A;  1DOY A;  3RPF C;  4OZB A;  1ROE A;  1UWM A;  3WCQ A;  1GTH A;  4L2Y A;  2QIE B;  1YN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...