3SFEB

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and thiabendazole
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
APRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3sfeB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sfeB01
2W54A 2CU3A 3P4PB 1JALA 1DOIA 1WGKA 1XLOA 1JWAD 1TKGA 1N62A 2FBWB 1V8CA 4KX6B 2WLBA 2WDQB 3SFDB 1WRIA 1GTEA 1WYGA 2K22A 3BIID 2BT6A 2M56B 1N5WA 1IUEA 3AH7A 3PO0A 3AE6B 2JQRB 3HVZA 1KF6B 3AE2B 4A9AA 1T3QA 1E6EB 2MJ3A 1A70A 3B2FA 5EE9A 1ZP0B 2KMMA 1FXIA 1NYRA 2K9XA 4YSYB 3AE5B 4N6EB 3RPFC 2PVOD 4ZOHC 2ACZB 3AE8B 1OQQA 3ETRA 1QF6A 1N60A 1H7WA 1SB3C 1I7HA 3LB8C 1GTHA 3SR6A 1F0ZA 1GT8A 1YJIA 2WDRB 2BS3B 1QOGA 3FC4A 4ITKA 3VRAB 1N5XA 2N0SB 4N59A 2W55A 1NEKB 1RWSA 2PVGC 4N58A 3CWIA 1ZXIA 1E7PB 2WU2B 2L83A 2W3SA 3AEAB 3KWLA 2OHFA 3AE9B 1KRHA 3AEFB 5GXGB 3SFEB 4C80A 3W5UB 1JROA 1XO3A 3CF4A 1L5PA 2DBYA 4JX1C 3AE4B 5G5GA 1YQ4B 4YT0B 1L6VA 1TYGB 3FAHA 4IDIA 4YXDB 4USAA 1CZPA 1V97A 1UWMA 3VRBB 3AEBB 4ZHPA 1NI3A 4YTMB 5C2TB 1JRPA 4JWUC 4WWMA 3AE7B 1FMAD 1QOFA 1QOBA 1EWYC 1JWBD 3AM9A 1FFVA 1QOAA 3AEDB 1TKYA 4P6VF 1AYFA 1TJEA 1E10A 1YJJA 5H92C 2E3TA 3AMZA 3P63A 1CJEA 3NVWA 3NRZA 3VR9B 5C3JB 1L0VB 3P4RB 3DWGC 5H8YE 3AEEB 1E9MA 1N63A 1ROEA 4LTUA 4JWSC 1WXQA 3LXFA 2QIEB 1H7XA 2BS2B 1FFUA 1XLPA 1R7SA 2MJEA 3AV8A 5EE0A 2HTME 1DOXA 4WQMA 1VJKA 3ZYYX 2BS4B 1FXAA 1NENB 1L6UA 3B9JA 1OFFA 3HRDD 4FXCA 3ABVB 3L4PA 1NVID 1PFDA 1RM6C 1FRDA 2CJOA 2JX5A 1FM0D 3AE1B 3NVYA 1ZUD2 2DWQA 2MJDA 3WCQA 5AUIA 1JW9D 1FIQA 1ZOYB 2H88B 2LEKA 3NVVA 2EKIA 2G1EA 5G5HA 3AECB 2B76B 3AB5A 2QJLA 2K5PA 4YSXB 1VLBA 2WQYB 2Y5CA 3AN1A 2KAJA 3CIRB 1B9RA 1J7CA 2L52A 1SIJA 3P4SB 3AE3B 2CJNA 2PKOA 2M19A 2WP9B 5EE1A 1DOYA 1KFYB 3NS1A 1VDVA 5MPOA 2H89B 1XLNA 2WS3B 4YTPB 1AWDA 1SF0A 2WDVB 4HROA 1RYJA 5AUKA 3AEGB 3EUB2 1FO4A 3W9CB 3P4QB 1J7AA 1NYQA 4YTNB 3B2GA 3W5VB 4HRSA 1DGJA 3NVZA 1YQ3B 1QT9A 1E0ZA 1J7BA 2WU5B 1RFKA 3HUIA 1PDXA 4US9A 1N61A 1TKEA 1GAQB 2AX5A 4YSZB 1WWTA 2PIAA 5EE3A 4C7ZA 1GPXA 1JQ4A 1XLQA 1FRRA 3P1MA 1QLBB 4US8A 3VR8B 1OQRA 4C7YA 1PUTA 2Q5WD 3DWMA 4ZHOA 2MH7A 2W3RA
chains in the Genus database with same CATH superfamily
2Z59B 3ZGZA 3SDLC 4HVBA 2WLBA 4WIPA 1N5WA 5CHWA 1CK1A 4XDCA 2JQRB 2L0TA 4A9AA 2CS4A 3HIZA 1TS2A 1JWSD 2MWSB 2Y5BB 3DBLI 3FKYA 2JWUA 1SB3C 1HQRD 4OHJA 4E71A 1QOGA 1E8ZA 1CQVA 3R7QA 3WAMA 2OOBB 4ITKA 3VRAB 4XDDA 4W9DA 3QX1A 4N58A 2WU2B 3AE9B 1WSPA 3W5UB 2J0KA 3NS8A 2YVCA 4AWJA 5BMHA 4YXDB 2IO2B 3U8ZA 3SHQA 1I4XA 2L3ZA 1QOAA 2AL3A 2LASA 4E74A 1Z2MA 3DBRB 3W1YA 3BYYB 1LQBA 4M8NA 1P1AA 1H7XA 2MJEA 2YLMA 4P1BC 1FCLA 2LGSA 2L7RA 1GNUA 2BKFA 3ZXVA 5CTRC 4P1CC 1J0GA 3NVYA 2MJDA 1AARA 3NY5A 2B3AA 4P7IA 1HE8A 3AN1A 3CIRB 3QQ8B 4GDKA 1YJ1A 1V1OA 1P3QU 3KQ4A 2WXMA 4MGYE 5JHAA 3P4QB 4C4VA 2LD9A 1DGJA 4B0MA 4EOYA 3DHIC 2KXJA 3MHSD 4BBNF 3DQVA 4LNOA 3KWVA 2JT4B 4PYZA 2MP2A 3P4PB 1TKGA 4J3OD 2V1YA 2FBWB 4GDLA 1Y8RC 3I63C 1TZOA 4GXBA 4G11A 3KUZA 1XF5L 3PGEA 1E6EB 2MJ3A 4FA6A 3B2FA 2O6VA 1UD7A 1WMHA 3H7PA 5DPSA 3CMMB 4H2AA 3L54A 2BYVE 2D3CA 5L83A 3VAWA 1C4PA 1V6EA 2K8HA 2WX1A 4JLCA 3ZKJC 4NJCA 1WIAA 2KFKA 4BAXA 3TMPB 3H8HA 2HD5B 2KVZA 4C00A 1PYWD 3ECIA 2D3GA 2WXLA 3AE7B 3ZO5B 3FILB 1ZPSA 3PT2B 1EU4A 2OJWA 3WALA 2MQJA 2NMQA 3Q8FA 2K3UA 1WXQA 2XN9C 2HTME 5BYQA 3R66C 1DYQA 1JMLA 1SEBD 3QJZA 4FJZA 4AS1A 1UF0A 4DXFA 5AUIA 2HJ1A 2H88B 1K51A 1SGHA 2DZKA 2ZCBA 4XX5A 2E6XA 4AJYB 3BK1A 3DBRI 4ANWA 5MPOA 1WF9A 2M1MA 2PPHA 2DZIA 1NYQA 2LHDA 4NQLB 2JWZA 1E7VA 4TV3A 1RFKA 4US9A 4A3PA 4YSZB 3TUOA 1LXDA 2AQ3B 1I4HA 1XLQA 1C1YB 4US8A 3EFUA 3ZUNA 3BVMA 2J42A 2CU3A 1GG3A 4HDOA 5E6JA 3BYTB 4MM3A 2KJHB 5C23A 1MPEA 5LLIA 2MCNB 4YSYB 4L2YA 2PVOD 3NHEB 4HPLB 3AE8B 2NTTA 3K9PB 3MTNB 1LFDA 3WAPA 4M00A 3Q69A 2NPTB 1OGWA 4GOCA 1UZXB 2PVGC 3LYYA 2QDFA 3KYCD 1MG4A 3FILA 1F2RI 2ASQA 1IPGA 4JGHB 2KQ7A 3DBHI 4HKZE 2KDIA 1T0QC 4ICUA 1BMLC 2YEPF 3RUIB 4F1SA 4RGNA 1KM7A 2O6VB 3PZDA 2KVRA 2E3TA 3AMZA 4I6PA 2KOXA 1CJEA 4ZRQA 4AJWA 4DHZE 1D5ZC 2JYTA 1L0YB 3VQIA 3C0RB 4OZAA 4L1BA 3PZ8A 2O2VB 4DBGA 2BKRB 3ABVB 4ZRJA 4BFRA 4PT5A 3N1YC 2VRRB 2M8SA 3PS6A 2N9KA 3KYDD 2FUHB 2WQYB 3P2BA 4NAWA 1SJED 2CJNA 2VZKB 5HHDG 1F1HA 2JRHA 3VDZA 3E56A 3NJTA 5HI1A 3RN9C 5D2MB 1SE2A 4XYCA 1H4RA 4C7ZA 1GPXA 4M0WA 1S1QB 3LJ3A 1OQRA 4DHJB 2WHIA 2HTHA 1XCQL 1WZ3A 2KNBA 3DCGA 2W9NA 1ZKHA 4KSKC 2INCC 2LJIA 3MJWA 1YIWA 4AQ7A 4ZOHC 4Q2JA 2WXPA 4MELA 4ARIA 1GT8A 2WNMA 1K52A 1FEHA 4ZRPA 3NZ3A 3GS2A 3HK0A 4XE0A 4JWUC 2EMTA 2LMCA 2OHFA 2G4SA 3M95A 2KYWA 4YWGG 4KGRA 4BKSA 1JWMD 2WYQA 1YQ4B 5FKAC 1WJ6A 4USAA 2LVPA 1E5WA 4NJ7A 2IO1B 1JRPA 4HJGE 3ZRFA 1YD8U 1FMAD 3KVFB 3PREA 4REZA 1TJEA 5H92C 1ET9A 2D07B 3AULA 3AEEB 4LTUA 2O6VD 4XGAB 2KX3A 2UYZB 3UF8A 1VJKA 2BS4B 5T8IA 4GDKB 3RYTA 4A90A 3HRDD 4KIKA 3U4EG 1WE6A 3L4PA 4GDLB 1T5XD 4WWPA 3DHHC 1PGAA 2LEKA 4TQ1A 3U52E 2UWQA 1IP9A 1B9RA 4WH4A 2WP9B 3JSVA 3NS1A 4MEMA 2PE9A 4OW0A 2H89B 2K8CA 4W9IA 4BOSC 4N9F4 1KLUD 4FHJA 1J7AA 2RDHA 3DHGC 2M0AA 1QT9A 3DBLB 3RNEC 2ZW0A 2MA9B 4IKGA 4EKUA 1L7YA 3DPDA 1XLOA 2YEPB 1N62A 1AW7A 3L13A 4S0RA 1KOTA 1HZ6A 5IP4D 4OVUA 4DDGD 3PO0A 2RDBC 3DVGY 1WGDA 2JPHA 2KMMA 1XCTL 3RNFC 4B0EA 2KLGA 5IKCM 3ETRA 4A3OA 1TZ1A 2GI9A 2JYEA 3IAM1 1EWCA 2LXAA 2D10A 1NEKB 2N4FA 3KWLA 2INNE 3KLSX 3P42A 5G5GA 4YT0B 4KIKB 4AP4C 3H1UA 4HJKA 4WWMA 4IOIE 3GZNI 4F8CB 3M3JA 4AUQC 4AOFA 5IAAC 5DPWA 5C3JB 1L0VB 3P4RB 3DWGC 5H8YE 4EZLA 2FIFA 4CHKA 2IGDA 3GOEA 2I1JA 1E8WA 3TEXA 2FUG1 2MBEA 2RPVA 4MGKE 2JX5A 2CJOA 1FXTB 2MBOA 4WAAA 3NVVA 2V4IB 2PJHA 4GMVA 4JIOU 4KVGB 3TL5A 4MSMB 1HXYD 2BYTA 2JXXA 3MC8A 3C8YA 2NCNA 5IN7A 2I1KA 5AUKA 1RYJA 1WGHA 3ZQ4A 2EELA 4K7WA 2ZPYA 5CHFA 3W5VB 4KV2A 1PDXA 1YN4A 1WWTA 3APFA 5EE3A 2J0MA 1JQ4A 2MLBA 4RGMA 1UNSA 3IFWB 1NBFC 1ET6A 2KTRB 4W9HA 3OWEB 2MRPA 1QZEA 1UGJA 1WYGA 2R61A 3AXCA 5AEKB 3A33B 1NYRA 3RPFC 1MJDA 3IBEA 4JQWC 3X0WA 1VRAB 2W55A 2VZKD 1U4AA 1E7PB 2K25A 3PLVA 4LNIA 1FPYA 4WJPA 3OAWA 4ZHPA 3R2IA 1YN5A 4NNJB 2JF5A 3MJ5A 4NAWB 1WYWB 3N3KB 1CMXB 1TIFA 3RNCC 3ZLZA 1KJTA 2BPSA 1Q5WB 1LGRA 3N9YC 2PE6B 4G0NB 2CKHB 1QQRA 3VUYA 4S17A 3ZJTA 1TS5A 1XLPA 5CHVC 3ZW3A 4KGSA 3ZNZB 4IM2A 1C9FA 1MG8A 3MFGA 3O13A 2KDEB 2GB1A 1JW9D 1D6EC 4C4VB 5LNK1 4DXGA 2ZZPB 2K1FA 1JRUA 4KKJA 5EE1A 2KACA 2LGIA 2J52A 1KTKA 3IT6B 4NAMA 1AWDA 1UELA 4MSQB 4HROA 2BYEA 5L95C 3K9OB 2LHEA 2LUMA 1FNUA 2C9WB 1N61A 3W2DA 3S2AA 1ZGUB 5HFYA 3KH0A 5GMVA 2CHWA 2MH7A 4HPPA 1XXGA 2LRUA 4FADA 2RMMA 2WDQB 4DDID 2BT6A 4HCNB 4RFBA 3HVZA 1ENFA 5EE9A 1V49A 1V2YA 1V5TA 3H6NA 1F2RC 2VH1A 1V86A 2XBBC 1I7HA 3ZRCA 1B1ZA 4BVUC 3V61A 1ZW7A 2BTEA 5JXVA 2N7DA 1V80A 1HZ5A 4BKGA 3AEFB 3SFEB 1TS4A 4CO7A 4A20A 4W9JA 1TYGB 5EDSA 2BYFA 4TUUA 2LFIA 4K7UA 1NI2A 1RAXA 3RZWC 1TKYA 1AYFA 3BY4B 2KWDA 2G9HD 3X23A 3NRZA 2PTLA 3ZTCA 3W1SC 1XD3B 4D2KA 1E9MA 5KHOA 3W1SA 3UIPB 3LDZE 2WDTB 2ZNVC 5G2NA 2C7NB 2ZVNA 4R3DA 4FHKA 2I2YA 1YX5B 4LDTB 2A4ZA 2KFKB 2N9EB 1FRDA 3N30A 3I3TB 3DBSA 4KDLB 3GZNB 4HCPB 2LWPA 2N9XA 3AB5A 3T8MA 2KAJA 2KFJA 4LNFA 3VTWA 2NR2A 1Q10A 1ZXHA 1XLNA 1V81A 2CHZA 2A5UA 1XT9B 4HEA1 2NBVB 4WURA 1L4ZB 1I42A 5HG2A 2D3BA 2KDFB 4MM3B 3ML9A 2WGSA 3WANA 4MH8A 3DWMA 1VCBA 4B6WA 4BKTA 1IYFA 1K8RB 4LJPB 4W9EA 4PK1A 2M56B 3AH7A 4A6QA 3CSFA 1NDDA 3BK2A 1FXIA 2KDBA 4N6EB 4ZYSA 3Q8BA 3L16A 1ACCA 1QF6A 1RFAA 2RGFA 2BWFA 1T6BX 4ASWC 3PTFC 5JZEB 2K8BA 1WE7A 3DBHB 3B1LX 2KN5A 1LO5D 1ZXIA 4C80A 3APCA 1TT5B 3CF4A 2BF8B 1D5XC 4FBJB 1J8CA 1CZPA 2GBRA 1UWMA 5BYRA 2W82A 2RPQA 2V3NA 2N7EA 1UWXA 3MP9A 4OVVA 1RRBA 1FD6A 2HDEA 3A9KB 3EHVA 2NS5A 4MACA 3TCAA 4HWIB 2Z0DB 3U30A 3U7ZA 4DK5A 2JUOA 1WJNA 4O1NA 3A9JA 1OEYJ 2DYOA 3NOBA 4KGTA 2MP2B 2GBJA 4RNAA 5E6PA 4II3B 1K50A 2R2OA 2EKIA 2NBWB 2FAZA 1WM3A 2PKOA 4C56C 3H9DA 1VDVA 1F9JA 1VZ8A 1SF0A 4JPSA 3DDCB 4W9FA 2KC1A 3TEZA 1C76A 3NVZA 1E0ZA 4HLEA 2J0JA 3AU4A 2GBKA 1WJ4A 4DWFA 5D94A 2W3RA 2W54A 3VH4B 1JALA 2EMSA 1V8CA 1GTEA 2K22A 1OQYA 2LUEA 4GN1A 3TSSA 4WJQA 3NZUA 5DPTA 5LXIB 2PW9A 1OQQA 1H7WA 2L8JA 1X1MA 1L4DB 4M01A 2MW5A 2N0SB 4JE3B 1RWSA 1C78A 2SEBD 2ZJDA 3B08A 3M62B 3RT3B 1AN8A 5BMIA 2ZW1A 2DBYA 3V62A 1WZ0A 3PRMB 2IJ0A 2J4XA 4MH0E 4B95A 1QOBA 1FFVA 1XEEA 2BWES 2G4DB 3P63A 1I4QA 5AZFA 3V60A 1MFWA 1N63A 2ZPNA 4IWPA 3OLMD 3UIOB 3OG5A 3RFZB 3ZYYX 4LJOB 4GLSC 4OZBA 2IY0B 1OFFA 4KKIA 3H7SA 3KUDB 4NJ6A 1WI0A 4A8XC 2FNJB 2QHOA 3ZNHB 5G5HA 3AECB 2MBHA 2UU7A 2B76B 2FIDA 1WXSA 1WXVA 2Y5CA 1J7CA 2KWUB 3P4SB 1RLFA 4HKQA 3PHXB 1QKZA 3VTUA 4GIVA 2WS3B 3PZ7A 2J53A 2RD0A 3EUB2 2KQSA 2CHXA 1SSNA 2C5LC 2PEAA 3A1QA 3VR8B 4IC7B 4RMAA 3A9JB 2QILA 3ZIMA 1SE4A 1WGKA 5D3DA 1BT0A 3JW0X 2LVQA 1ZDVA 1K53A 2IZVB 2KQ4X 3ZVVA 3HHMA 4FJVB 2INPE 3NZSA 2IYDB 1STEA 1WH3A 5BMGA 4GU2A 4IWQA 2KO3A 2L83A 3QARA 1V1PA 2WX0A 4IG7B 1VZ7A 2KDMA 3JYUA 3TEYA 2KWCA 2GRIA 3VRBB 2L1AA 4WWOA 1V9JA 1UUPA 3C19A 5E6NA 2WWZA 1GC6A 1QOFA 3IT4B 1GOZA 2GBNA 3U2SC 3ENEA 2KJRA 3B0AA 1YQBA 2KTFA 4LK0M 3L08A 2M4NA 1ROEA 4CYEA 2REXA 1XQQA 3VVWB 2NTSA 4JWSC 2CU1A 4CQNA 4WQOB 4WQMA 2WXFA 1FXAA 1YMHE 2KK8A 2KJ6A 4FULA 1WGRA 1SE3A 2XK5A 1ZUD2 1GB1A 3RULA 3TEWA 3RNGC 3AE3B 3UGBB 2CR5A 2K0PA 1PQSA 1P7FA 1P0RA 3PLUA 1C3TA 2LVOA 3DVNU 2IO3B 2DZMA 1WMHB 1TTNA 1UBIA 4RM9A 1DOIA 3PHWB 3BIID 2JU6X 2V4LA 2LXCA 4X57B 3ZNGC 1I4PA 3I9V1 4UDUC 3AE5B 4KZ0A 3SU8X 2WXHA 2FCNA 3QIJA 3EFCA 2AEHA 1F0ZA 2WDRB 2HE7A 1I35A 3T3NA 1N5XA 2DNFA 2L76A 1JCKB 2MBQA 3T9LA 4KDIC 3PV1A 5JHBA 2V9HA 1JROA 3BVGA 2JZ3B 2INDC 1V97A 3OJ3A 3AEBB 4RM8A 2RSUA 2IO0B 5FR3A 3Q2AC 1JWUD 1H8CA 1EWYC 1JWBD 3AM9A 2GBMA 3QC8B 3AEDB 2AL6A 2OJRA 1E7UA 5LXHA 2K6DB 4TQ0A 4RF1A 1HEZE 2BQQA 4EZKA 3ZDMC 3M63B 2BS2B 3AV8A 4TSSA 4MJSA 1V1PB 4ANUA 3B9JA 3RZFA 3EGRA 2QMTA 1MHHE 2KHWB 2KANA 3AE1B 1WR6E 4M02A 2DWQA 3A4SC 2G1EA 1SJHD 2QC8A 1TBEA 1VLBA 2KLCA 3Q3FA 4LLGM 2L52A 1MHXA 4WJNA 1T0SC 2WXKA 5BO4B 2WDVB 4ANXA 4DHJD 1WY8A 3W9CB 2LJ5A 4EEWA 1J7BA 2WU5B 1WGYA 3HUIA 3JVZX 4ANVA 4PS7A 2ZCCA 3VXWA 1FRRA 2IGHA 4ZHOA 2IGGA 3WIMA 1TY2A 1C4CA 2V3SA 1WX7A 3WAOA 2WXQA 2R2QA 4HK2A 3ZJUA 1WRIA 3IHPC 1A5RA 1GUAB 1KF6B 1BXTA 4FJYA 5E6OA 1ZP0B 3I5JC 3PVLA 4WJOA 5BYSA 2ACZB 2WXRA 3LB8C 4K3BA 2PMVA 4EUTA 4TMAB 2ZNVB 5AZGA 4ARCA 5GXGB 2C60A 1IBXB 4ZRIA 1MI0A 1T0RC 3BWUD 2FE8A 4ZRKA 3V6CB 4BZAA 3TJPA 4HPMB 4OVZA 4W9LA 2MX2A 5C2TB 1YOVB 4IW0A 5D3IB 5IOIA 2L32A 4P6VF 4BOZB 3VTVA 1VZ6A 5DPRA 3UQAA 3VR9B 2OEDA 3T3OA 1SIFA 1SXTA 1YNTE 1ZDXA 1E8YA 2QIEB 2Z0EB 1EF5A 2N9PC 4MGIE 3R7RA 1NENB 1C79A 1OEYA 1J19A 3IG3A 3IAS1 1PFDA 3BINA 1TY0A 1FM0D 4NPNA 4M8MA 3WCQA 3HM6X 1UH6A 5FK9C 3QCAA 4OZCA 2IDYA 3ALBA 4FLHA 2AQ2B 1WJUA 2ZVOA 2IBIB 2DLBA 2O2VA 1GC7A 1IGDA 1EO6A 3AEGB 2N7JA 2BB5A 2ICIA 4YTNB 2BVCA 2JXTA 1LM8B 1C77A 2PIAA 4A55A 1FNVA 2KN4A 1EU3A 4IM0A 4ZYNA 3VHTC 3IXSA 1WRDB 2Q5WD 4B9KA 3H7PB 3ZJVA 3QA8A 4KX6B 1FNWA 1KLVA 1R4MI 2KKCA 2XEWA 3AE6B 2BW2A 3AE2B 3A1QB 3N20C 1L2NA 2KTRA 2QCZA 3HVDA 4EE2A 3SR6A 2IPKD 4EZJA 1YJIA 4J6IA 1N6ZA 2GOWA 3L0WB 4N59A 2AQ1B 3ML8A 4XC2A 1HA5A 3PPAA 1ESFA 4PYUA 1EM7A 4KZCA 3FAHA 2G3QB 3EECA 1R4NB 2D3AA 2KD0A 2Y3AA 1SBBB 5D7GA 1IBXA 4W9CA 4DXAB 3Q14C 2RR9A 3NVWA 3PRPB 1R4NI 4NY0A 2NBUA 5JH5C 3HM3A 3PSEB 3WA0A 3RCZA 1NVID 1RM6C 3URYA 3OJ4B 1FIQA 4NQKE 3KW5B 2FCMA 2JSVX 2D2QA 4YSXB 3IVFA 2X8XX 3D32A 2VH2A 1HTOA 4URKA 4YTPB 3ZTDA 2XK5B 3A9KA 1I4RA 4PS3A 4FN2A 5J18A 1GB4A 4HRSA 1YN3A 1D3ZA 2SAKA 2WXIA 2EKEC 2RDGA 4MGZE 5C1ZA 2M0XA 3GB1A 3Q8AA 3Q3JA 3QWZB 4XZ4A 2GLSA 3ZNID 3RNAC 3QHTA 2GMIC 3Q8CA 1A70A 2AYOB 3MC9A 3JSVB 4DQOC 3DOWA 4BBNC 3N1ZC 1N60A 3Q3MC 3AU5A 1M94A 2N1VA 1EF1A 2BS3B 4IM3A 3A4RA 2JY6A 2JZZA 2NVUI 4EFOA 1YX6B 3O65B 1G6JA 1XO3A 1L5PA 2LGDA 2L0FA 1NI3A 4YTMB 2Z8LA 4G3XB 1VD2A 2PLPA 4LNNA 3GP7A 4RGOS 2LZ6A 4ICVA 1YJJA 4W9GA 3AI5A 5TSSA 2Y5PA 2K39A 3ONSA 5J17A 3U7DA 2DAFA 2V3PA 2BGFA 1FFUA 5EE0A 4KSLC 2FCSA 1DOXA 1WX9A 2DX5B 4G50A 3CSTA 1L6UA 4ACFA 3GE8C 3QK0A 5G55A 3NUHB 2BBCA 2IY1B 4ZDVA 4C7YA 4XWTA 1D5MC 2QJLA 4P16A 1SIJA 2DAJA 4IUMB 1KFYB 1MVKA 4II2B 2XNAC 3V3XA 2MEKA 2M17A 4K3CA 1YQ3B 1TKEA 4LNKA 1I4GA 4DHZB 2BB6A 4GGQA 1VR9A 2HJ8A 1JWAD 3QAQA 1D4BA 2DENB 3SFDB 1Q1OA 5AZHA 3BZDB 1PGXA 1IUEA 1WFYA 1V5OA 2X38A 1T3QA 2L05A 3N32A 1GTHA 2I38A 4K81A 3FC4A 3GE3C 3VH3B 1WM2A 2W3SA 1HTQA 4RCOA 3AEAB 1WGGA 1KRHA 4M0WB 2KMAA 3SEBA 3RD2A 3NG0A 4IDIA 3R3MA 4E3CA 1Z5SB 4BKSD 2LRWA 2DHZA 4K7SA 5IA7A 2AWTA 3J9CA 3L17A 5DCNA 2C7HA 2QEJC 2D5GA 2K6QA 2WXNA 2V0GA 3RNBC 3KUCB 4LDTD 5D6JB 4JX1C 1P7EA 4TKNA 3CF6E 3UQBA 3BVZA 2G45B 1IGCA 2KT7A 4MDKE 2D11A 4GSWA 3Q8EA 2WXGA 1UGMA 3E9SA 2WXJA 3V6EB 1TGZB 2K5PA 2MSED 4W9KA 3Q3NC 1DOYA 5FR6A 2N9LA 2ON8A 2KX0A 1SE9A 2JRIB 4IWOA 4RGTA 2ONQA 3Q6BA 3B2GA 2KMCA 5TR5A 1L0XB 4HXDA 3V05A 4MT5A 3DVGX 3PRZA 4WWNA 3P1MA 1QLBB 3UINB 3VFKA 4I6LB 1QILA 4JL9A 1KLGD 4LCDE 1GJZA 1ISNA 4PS8A 2KWVB 1Q0WB 1T0YA 2J7QB 5HKHA 1ZE3D 3RMKC 1F77A 1WXMA 1E8XA 3EC8A 1UBQA 2K9XA 4K1RB 1P9DU 2TSSA 1F52A 1FCCC 2WXOA 1KH0A 4XWWA 2QSDA 1C4AA 3UI3A 4MJSB 3CWIA 5CX3A 3APDA 4WAFA 2DYMA 1PGBA 3AE4B 3L10B 4NZLB 1L6VA 1S3SG 3TBLD 2LGXA 3Q3OC 2MBBB 2NPTA 3N1XC 3DVNV 2FCQA 3R2TA 1EUVB 4F7ZA 3VUXA 1E10A 1OTRB 1TS3A 5I4DA 2DYBA 2JVCA 2JZPA 3LXFA 4L23A 1R7SA 1WX8A 4RF0A 1WR1A 4RH6A 3R8BA 2MHJA 4FXCA 2LI5A 1ZOYB 3TIXA 3EA6A 4GB9A 2ZEQA 2KC2A 1P98A 1M4VA 2C7MB 4YL8A 2M19A 1E90A 4QAYA 1Y56A 3SD5A 3ZDTA 3ZXRA 5J2RA 3MC0B 1BUIC 1FO4A 3VUWA 2DZJA 5IO9A 2KZRA 3I57A 1GAQB 2AX5A 4I6NB 1WXAA 2LGYA 3RI7C 5KHQA 3MHZA 1PUTA 2N1WA 2L00B 4HDQA 1R4MB
chains in the Genus database with same CATH topology
2W54A 3ZGZA 3ZJVA 1JALA 1XLOA 2YEPB 2WLBA 1V8CA 1N62A 1AW7A 4KX6B 1FNWA 1GTEA 1HZ6A 2K22A 4WIPA 1N5WA 1CK1A 4XDCA 3PO0A 3AE6B 2BW2A 2JQRB 3TSSA 3AE2B 4A9AA 2KMMA 1XCTL 1TS2A 4B0EA 2PW9A 1JWSD 1OQQA 3HVDA 2JWUA 3ETRA 4EE2A 1H7WA 1SB3C 2GI9A 2IPKD 2JYEA 3IAM1 1HQRD 4OHJA 3SR6A 1EWCA 1YJIA 1L4DB 1QOGA 1CQVA 4ITKA 3VRAB 2N0SB 4N59A 2AQ1B 4JE3B 4XDDA 1NEKB 1RWSA 1C78A 2SEBD 4N58A 1HA5A 2WU2B 3KWLA 2INNE 3AE9B 1AN8A 1WSPA 3KLSX 5BMIA 3W5UB 2ZW1A 2DBYA 3P42A 1ESFA 5G5GA 1EM7A 5BMHA 4YT0B 3FAHA 4YXDB 2IJ0A 2J4XA 2Y3AA 1SBBB 4WWMA 5D7GA 1IBXA 4IOIE 1I4XA 1QOBA 1FFVA 1QOAA 1XEEA 3P63A 3NVWA 3BYYB 5C3JB 1I4QA 1L0VB 3P4RB 3DWGC 5H8YE 1N63A 1H7XA 2MJEA 1FCLA 2IGDA 3RFZB 3ZYYX 4GLSC 3TEXA 2FUG1 4OZBA 1OFFA 2RPVA 4KKIA 1NVID 2CJOA 1RM6C 2JX5A 3URYA 3NVYA 4A8XC 2MJDA 1FIQA 3NVVA 2V4IB 5G5HA 3AECB 2B76B 2JSVX 4YSXB 2Y5CA 3AN1A 3CIRB 1J7CA 1HXYD 3P4SB 2BYTA 4HKQA 1V1OA 1QKZA 3C8YA 3KQ4A 2WXMA 2WS3B 4YTPB 3PZ7A 5AUKA 1RYJA 2J53A 1I4RA 3EUB2 3ZQ4A 2EELA 3P4QB 1GB4A 3W5VB 4HRSA 1DGJA 1YN3A 2SAKA 4B0MA 1SSNA 1PDXA 1YN4A 2WXIA 1WWTA 5EE3A 2RDGA 1JQ4A 4RGMA 3VR8B 1UNSA 3KWVA 1ET6A 2QILA 3GB1A 1SE4A 3OWEB 3P4PB 1WGKA 3Q8AA 5D3DA 1TKGA 4J3OD 2FBWB 1UGJA 1TZOA 1ZDVA 1WYGA 2R61A 1K53A 2KQ4X 1XF5L 1E6EB 2MJ3A 3Q8CA 1A70A 3B2FA 2INPE 1NYRA 3RPFC 4DQOC 1N60A 4H2AA 2BS3B 1STEA 5BMGA 1VRAB 2W55A 2VZKD 2L83A 1E7PB 1V1PA 1C4PA 1XO3A 1L5PA 1VZ7A 4NJCA 2KDMA 3TEYA 2GRIA 3VRBB 3H8HA 2L1AA 4ZHPA 1NI3A 1UUPA 4YTMB 3R2IA 1YN5A 2Z8LA 1PYWD 2WXLA 3MJ5A 3AE7B 4NAWB 1QOFA 3IT4B 2PLPA 1GOZA 3FILB 3GP7A 4RGOS 1ZPSA 1EU4A 3U2SC 1YJJA 3N9YC 4LK0M 5TSSA 2Y5PA 2NMQA 3Q8FA 1QQRA 1ROEA 3ZJTA 2K3UA 2NTSA 2V3PA 1WXQA 4JWSC 1TS5A 4CQNA 1XLPA 1FFUA 5EE0A 1DOXA 2XN9C 2HTME 4WQMA 2WXFA 4KGSA 1FXAA 1YMHE 5BYQA 1DYQA 1JMLA 1L6UA 1SEBD 1C9FA 1SE3A 3MFGA 4AS1A 3O13A 3NUHB 2BBCA 1ZUD2 4C7YA 2GB1A 5AUIA 1JW9D 1D6EC 2H88B 1K51A 4DXGA 4DXFA 5LNK1 1GB1A 4XWTA 3TEWA 1D5MC 2QJLA 4P16A 1SIJA 4KKJA 3AE3B 2E6XA 2KACA 2LGIA 2J52A 5EE1A 1KFYB 3BK1A 1KTKA 1MVKA 5MPOA 3IT6B 4NAMA 1AWDA 2XNAC 4HROA 3V3XA 2MEKA 2K0PA 1NYQA 2LHDA 2LHEA 1P7FA 2LUMA 1YQ3B 1FNUA 1RFKA 4US9A 1N61A 1TKEA 3W2DA 4YSZB 3TUOA 5HFYA 2AQ3B 1I4HA 1XLQA 1I4GA 4US8A 2BB6A 3BVMA 2MH7A 2J42A 2CU3A 1VR9A 1DOIA 1XXGA 1JWAD 1D4BA 2RMMA 2WDQB 3SFDB 3BIID 2JU6X 2BT6A 5E6JA 3BZDB 1PGXA 1IUEA 3BYTB 4RFBA 3HVZA 2X38A 1T3QA 1ENFA 1I4PA 1MPEA 3I9V1 5EE9A 4UDUC 4YSYB 3AE5B 4L2YA 2PVOD 3AE8B 2WXHA 1F2RC 2NTTA 1I7HA 1GTHA 2I38A 1F0ZA 2WDRB 1B1ZA 2BTEA 3FC4A 5JXVA 3Q69A 1N5XA 3T3NA 1JCKB 2PVGC 3LYYA 1HZ5A 2W3SA 4RCOA 3AEAB 1KRHA 3AEFB 3SFEB 1TS4A 1JROA 3FILA 1F2RI 3SEBA 3BVGA 1TYGB 4IDIA 1V97A 4HKZE 3AEBB 1BMLC 2YEPF 5FR3A 2LFIA 1JWUD 4RGNA 1EWYC 1JWBD 3AM9A 3J9CA 3AEDB 1TKYA 2QEJC 1AYFA 2KWDA 2G9HD 2E3TA 3AMZA 2D5GA 1CJEA 2WXNA 3NRZA 4TQ0A 2V0GA 4ZRQA 2PTLA 4RF1A 1HEZE 4D2KA 1E9MA 3W1SA 1D5ZC 4JX1C 1P7EA 2BS2B 3AV8A 4TSSA 2JYTA 1L0YB 1V1PB 3BVZA 3VQIA 1IGCA 4OZAA 4L1BA 4R3DA 3B9JA 3PZ8A 2I2YA 3EGRA 2QMTA 3ABVB 1MHHE 1FRDA 3Q8EA 3AE1B 2WXGA 4PT5A 2DWQA 3E9SA 2WXJA 2G1EA 1SJHD 2N9KA 3AB5A 2K5PA 1VLBA 2WQYB 2KAJA 4LLGM 2L52A 1MHXA 1SJED 2CJNA 1DOYA 2N9LA 2ON8A 2VZKB 1Q10A 1ZXHA 5HHDG 1XLNA 2WXKA 2WDVB 3E56A 4RGTA 5HI1A 2ONQA 3W9CB 3B2GA 4HEA1 1SE2A 4WURA 1J7BA 1L4ZB 2WU5B 3HUIA 5HG2A 1L0XB 4C7ZA 1GPXA 4M0WA 4MT5A 3V05A 4MM3B 1FRRA 3P1MA 1QLBB 2IGHA 1OQRA 4MH8A 4ZHOA 3DWMA 1QILA 2IGGA 1KLGD 1TY2A 1C4CA 1XCQL 2WXQA 3ZJUA 1WRIA 1ZE3D 2M56B 3AH7A 2LJIA 4A6QA 1F77A 1KF6B 1BXTA 3BK2A 4AQ7A 1ZP0B 1FXIA 2K9XA 4N6EB 4ZYSA 5BYSA 3Q8BA 4ZOHC 4Q2JA 2ACZB 1ACCA 2TSSA 1QF6A 2WXPA 2WXRA 3LB8C 4ARIA 1T6BX 1FCCC 1GT8A 2PMVA 2WNMA 2WXOA 1K52A 1KH0A 4TMAB 1FEHA 4ZRPA 2QSDA 1C4AA 4XWWA 3NZ3A 3GS2A 3UI3A 4XE0A 1LO5D 3CWIA 1ZXIA 4JWUC 4ARCA 5GXGB 2LMCA 4WAFA 2OHFA 1IBXB 1MI0A 4C80A 2DYMA 3BWUD 4YWGG 4KGRA 3CF4A 1PGBA 2FE8A 3AE4B 1D5XC 1JWMD 1YQ4B 4NZLB 5FKAC 1L6VA 4USAA 1CZPA 4OVZA 1UWMA 5BYRA 2W82A 2V3NA 5C2TB 1JRPA 4HJGE 1UWXA 3MP9A 1FMAD 3R2TA 5D3IB 4REZA 1FD6A 2L32A 4P6VF 1TJEA 1E10A 1VZ6A 5H92C 1ET9A 2HDEA 3VR9B 2OEDA 1TS3A 5I4DA 3T3OA 1SXTA 2JZPA 3AEEB 1YNTE 1ZDXA 4MACA 4LTUA 3LXFA 2QIEB 4L23A 3U7ZA 1R7SA 4RF0A 1VJKA 2BS4B 1NENB 5T8IA 4O1NA 4GDKB 1C79A 4RH6A 4A90A 3R8BA 2DYOA 3HRDD 4KGTA 4FXCA 3U4EG 3L4PA 3IAS1 1PFDA 4RNAA 1TY0A 1T5XD 1FM0D 4GDLB 1PGAA 3WCQA 2LEKA 4TQ1A 1ZOYB 1K50A 3U52E 2EKIA 3EA6A 5FK9C 4OZCA 2IDYA 2AQ2B 1B9RA 1M4VA 2PKOA 4WH4A 2M19A 2WP9B 4C56C 3NS1A 2DLBA 1VDVA 4OW0A 2H89B 1Y56A 1IGDA 3MC0B 1BUIC 1VZ8A 1SF0A 4JPSA 3AEGB 1KLUD 2N7JA 1FO4A 2BB5A 2ICIA 1J7AA 2RDHA 4YTNB 3TEZA 1C76A 2M0AA 3NVZA 1QT9A 1E0ZA 3I57A 2ZW0A 2JXTA 1GAQB 1C77A 2AX5A 2PIAA 4A55A 1FNVA 2KN4A 1EU3A 4IKGA 3MHZA 3IXSA 1PUTA 2Q5WD 2W3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W54 A;  2CU3 A;  3P4P B;  1JAL A;  1DOI A;  1WGK A;  1XLO A;  1JWA D;  1TKG A;  1N62 A;  2FBW B;  1V8C A;  4KX6 B;  2WLB A;  2WDQ B;  3SFD B;  1WRI A;  1GTE A;  1WYG A;  2K22 A;  3BII D;  2BT6 A;  2M56 B;  1N5W A;  1IUE A;  3AH7 A;  3PO0 A;  3AE6 B;  2JQR B;  3HVZ A;  1KF6 B;  3AE2 B;  4A9A A;  1T3Q A;  1E6E B;  2MJ3 A;  1A70 A;  3B2F A;  5EE9 A;  1ZP0 B;  2KMM A;  1FXI A;  1NYR A;  2K9X A;  4YSY B;  3AE5 B;  4N6E B;  3RPF C;  2PVO D;  4ZOH C;  2ACZ B;  3AE8 B;  1OQQ A;  3ETR A;  1QF6 A;  1N60 A;  1H7W A;  1SB3 C;  1I7H A;  3LB8 C;  1GTH A;  3SR6 A;  1F0Z A;  1GT8 A;  1YJI A;  2WDR B;  2BS3 B;  1QOG A;  3FC4 A;  4ITK A;  3VRA B;  1N5X A;  2N0S B;  4N59 A;  2W55 A;  1NEK B;  1RWS A;  2PVG C;  4N58 A;  3CWI A;  1ZXI A;  1E7P B;  2WU2 B;  2L83 A;  2W3S A;  3AEA B;  3KWL A;  2OHF A;  3AE9 B;  1KRH A;  3AEF B;  5GXG B;  3SFE B;  4C80 A;  3W5U B;  1JRO A;  1XO3 A;  3CF4 A;  1L5P A;  2DBY A;  4JX1 C;  3AE4 B;  5G5G A;  1YQ4 B;  4YT0 B;  1L6V A;  1TYG B;  3FAH A;  4IDI A;  4YXD B;  4USA A;  1CZP A;  1V97 A;  1UWM A;  3VRB B;  3AEB B;  4ZHP A;  1NI3 A;  4YTM B;  5C2T B;  1JRP A;  4JWU C;  4WWM A;  3AE7 B;  1FMA D;  1QOF A;  1QOB A;  1EWY C;  1JWB D;  3AM9 A;  1FFV A;  1QOA A;  3AED B;  1TKY A;  4P6V F;  1AYF A;  1TJE A;  1E10 A;  1YJJ A;  5H92 C;  2E3T A;  3AMZ A;  3P63 A;  1CJE A;  3NVW A;  3NRZ A;  3VR9 B;  5C3J B;  1L0V B;  3P4R B;  3DWG C;  5H8Y E;  3AEE B;  1E9M A;  1N63 A;  1ROE A;  4LTU A;  4JWS C;  1WXQ A;  3LXF A;  2QIE B;  1H7X A;  2BS2 B;  1FFU A;  1XLP A;  1R7S A;  2MJE A;  3AV8 A;  5EE0 A;  2HTM E;  1DOX A;  4WQM A;  1VJK A;  3ZYY X;  2BS4 B;  1FXA A;  1NEN B;  1L6U A;  3B9J A;  1OFF A;  3HRD D;  4FXC A;  3ABV B;  3L4P A;  1NVI D;  1PFD A;  1RM6 C;  1FRD A;  2CJO A;  2JX5 A;  1FM0 D;  3AE1 B;  3NVY A;  1ZUD 2;  2DWQ A;  2MJD A;  3WCQ A;  5AUI A;  1JW9 D;  1FIQ A;  1ZOY B;  2H88 B;  2LEK A;  3NVV A;  2EKI A;  2G1E A;  5G5H A;  3AEC B;  2B76 B;  3AB5 A;  2QJL A;  2K5P A;  4YSX B;  1VLB A;  2WQY B;  2Y5C A;  3AN1 A;  2KAJ A;  3CIR B;  1B9R A;  1J7C A;  2L52 A;  1SIJ A;  3P4S B;  3AE3 B;  2CJN A;  2PKO A;  2M19 A;  2WP9 B;  5EE1 A;  1DOY A;  1KFY B;  3NS1 A;  1VDV A;  5MPO A;  2H89 B;  1XLN A;  2WS3 B;  4YTP B;  1AWD A;  1SF0 A;  2WDV B;  4HRO A;  1RYJ A;  5AUK A;  3AEG B;  3EUB 2;  1FO4 A;  3W9C B;  3P4Q B;  1J7A A;  1NYQ A;  4YTN B;  3B2G A;  3W5V B;  4HRS A;  1DGJ A;  3NVZ A;  1YQ3 B;  1QT9 A;  1E0Z A;  1J7B A;  2WU5 B;  1RFK A;  3HUI A;  1PDX A;  4US9 A;  1N61 A;  1TKE A;  1GAQ B;  2AX5 A;  4YSZ B;  1WWT A;  2PIA A;  5EE3 A;  4C7Z A;  1GPX A;  1JQ4 A;  1XLQ A;  1FRR A;  3P1M A;  1QLB B;  4US8 A;  3VR8 B;  1OQR A;  4C7Y A;  1PUT A;  2Q5W D;  3DWM A;  4ZHO A;  2MH7 A;  2W3R A; 
#chains in the Genus database with same CATH topology
 2Z59 B;  3ZGZ A;  3SDL C;  4HVB A;  2WLB A;  4WIP A;  1N5W A;  5CHW A;  1CK1 A;  4XDC A;  2JQR B;  2L0T A;  4A9A A;  2CS4 A;  3HIZ A;  1TS2 A;  1JWS D;  2MWS B;  2Y5B B;  3DBL I;  3FKY A;  2JWU A;  1SB3 C;  1HQR D;  4OHJ A;  4E71 A;  1QOG A;  1E8Z A;  1CQV A;  3R7Q A;  3WAM A;  2OOB B;  4ITK A;  3VRA B;  4XDD A;  4W9D A;  3QX1 A;  4N58 A;  2WU2 B;  3AE9 B;  1WSP A;  3W5U B;  2J0K A;  3NS8 A;  2YVC A;  4AWJ A;  5BMH A;  4YXD B;  2IO2 B;  3U8Z A;  3SHQ A;  1I4X A;  2L3Z A;  1QOA A;  2AL3 A;  2LAS A;  4E74 A;  1Z2M A;  3DBR B;  3W1Y A;  3BYY B;  1LQB A;  4M8N A;  1P1A A;  1H7X A;  2MJE A;  2YLM A;  4P1B C;  1FCL A;  2LGS A;  2L7R A;  1GNU A;  2BKF A;  3ZXV A;  5CTR C;  4P1C C;  1J0G A;  3NVY A;  2MJD A;  1AAR A;  3NY5 A;  2B3A A;  4P7I A;  1HE8 A;  3AN1 A;  3CIR B;  3QQ8 B;  4GDK A;  1YJ1 A;  1V1O A;  1P3Q U;  3KQ4 A;  2WXM A;  4MGY E;  5JHA A;  3P4Q B;  4C4V A;  2LD9 A;  1DGJ A;  4B0M A;  4EOY A;  3DHI C;  2KXJ A;  3MHS D;  4BBN F;  3DQV A;  4LNO A;  3KWV A;  2JT4 B;  4PYZ A;  2MP2 A;  3P4P B;  1TKG A;  4J3O D;  2V1Y A;  2FBW B;  4GDL A;  1Y8R C;  3I63 C;  1TZO A;  4GXB A;  4G11 A;  3KUZ A;  1XF5 L;  3PGE A;  1E6E B;  2MJ3 A;  4FA6 A;  3B2F A;  2O6V A;  1UD7 A;  1WMH A;  3H7P A;  5DPS A;  3CMM B;  4H2A A;  3L54 A;  2BYV E;  2D3C A;  5L83 A;  3VAW A;  1C4P A;  1V6E A;  2K8H A;  2WX1 A;  4JLC A;  3ZKJ C;  4NJC A;  1WIA A;  2KFK A;  4BAX A;  3TMP B;  3H8H A;  2HD5 B;  2KVZ A;  4C00 A;  1PYW D;  3ECI A;  2D3G A;  2WXL A;  3AE7 B;  3ZO5 B;  3FIL B;  1ZPS A;  3PT2 B;  1EU4 A;  2OJW A;  3WAL A;  2MQJ A;  2NMQ A;  3Q8F A;  2K3U A;  1WXQ A;  2XN9 C;  2HTM E;  5BYQ A;  3R66 C;  1DYQ A;  1JML A;  1SEB D;  3QJZ A;  4FJZ A;  4AS1 A;  1UF0 A;  4DXF A;  5AUI A;  2HJ1 A;  2H88 B;  1K51 A;  1SGH A;  2DZK A;  2ZCB A;  4XX5 A;  2E6X A;  4AJY B;  3BK1 A;  3DBR I;  4ANW A;  5MPO A;  1WF9 A;  2M1M A;  2PPH A;  2DZI A;  1NYQ A;  2LHD A;  4NQL B;  2JWZ A;  1E7V A;  4TV3 A;  1RFK A;  4US9 A;  4A3P A;  4YSZ B;  3TUO A;  1LXD A;  2AQ3 B;  1I4H A;  1XLQ A;  1C1Y B;  4US8 A;  3EFU A;  3ZUN A;  3BVM A;  2J42 A;  2CU3 A;  1GG3 A;  4HDO A;  5E6J A;  3BYT B;  4MM3 A;  2KJH B;  5C23 A;  1MPE A;  5LLI A;  2MCN B;  4YSY B;  4L2Y A;  2PVO D;  3NHE B;  4HPL B;  3AE8 B;  2NTT A;  3K9P B;  3MTN B;  1LFD A;  3WAP A;  4M00 A;  3Q69 A;  2NPT B;  1OGW A;  4GOC A;  1UZX B;  2PVG C;  3LYY A;  2QDF A;  3KYC D;  1MG4 A;  3FIL A;  1F2R I;  2ASQ A;  1IPG A;  4JGH B;  2KQ7 A;  3DBH I;  4HKZ E;  2KDI A;  1T0Q C;  4ICU A;  1BML C;  2YEP F;  3RUI B;  4F1S A;  4RGN A;  1KM7 A;  2O6V B;  3PZD A;  2KVR A;  2E3T A;  3AMZ A;  4I6P A;  2KOX A;  1CJE A;  4ZRQ A;  4AJW A;  4DHZ E;  1D5Z C;  2JYT A;  1L0Y B;  3VQI A;  3C0R B;  4OZA A;  4L1B A;  3PZ8 A;  2O2V B;  4DBG A;  2BKR B;  3ABV B;  4ZRJ A;  4BFR A;  4PT5 A;  3N1Y C;  2VRR B;  2M8S A;  3PS6 A;  2N9K A;  3KYD D;  2FUH B;  2WQY B;  3P2B A;  4NAW A;  1SJE D;  2CJN A;  2VZK B;  5HHD G;  1F1H A;  2JRH A;  3VDZ A;  3E56 A;  3NJT A;  5HI1 A;  3RN9 C;  5D2M B;  1SE2 A;  4XYC A;  1H4R A;  4C7Z A;  1GPX A;  4M0W A;  1S1Q B;  3LJ3 A;  1OQR A;  4DHJ B;  2WHI A;  2HTH A;  1XCQ L;  1WZ3 A;  2KNB A;  3DCG A;  2W9N A;  1ZKH A;  4KSK C;  2INC C;  2LJI A;  3MJW A;  1YIW A;  4AQ7 A;  4ZOH C;  4Q2J A;  2WXP A;  4MEL A;  4ARI A;  1GT8 A;  2WNM A;  1K52 A;  1FEH A;  4ZRP A;  3NZ3 A;  3GS2 A;  3HK0 A;  4XE0 A;  4JWU C;  2EMT A;  2LMC A;  2OHF A;  2G4S A;  3M95 A;  2KYW A;  4YWG G;  4KGR A;  4BKS A;  1JWM D;  2WYQ A;  1YQ4 B;  5FKA C;  1WJ6 A;  4USA A;  2LVP A;  1E5W A;  4NJ7 A;  2IO1 B;  1JRP A;  4HJG E;  3ZRF A;  1YD8 U;  1FMA D;  3KVF B;  3PRE A;  4REZ A;  1TJE A;  5H92 C;  1ET9 A;  2D07 B;  3AUL A;  3AEE B;  4LTU A;  2O6V D;  4XGA B;  2KX3 A;  2UYZ B;  3UF8 A;  1VJK A;  2BS4 B;  5T8I A;  4GDK B;  3RYT A;  4A90 A;  3HRD D;  4KIK A;  3U4E G;  1WE6 A;  3L4P A;  4GDL B;  1T5X D;  4WWP A;  3DHH C;  1PGA A;  2LEK A;  4TQ1 A;  3U52 E;  2UWQ A;  1IP9 A;  1B9R A;  4WH4 A;  2WP9 B;  3JSV A;  3NS1 A;  4MEM A;  2PE9 A;  4OW0 A;  2H89 B;  2K8C A;  4W9I A;  4BOS C;  4N9F 4;  1KLU D;  4FHJ A;  1J7A A;  2RDH A;  3DHG C;  2M0A A;  1QT9 A;  3DBL B;  3RNE C;  2ZW0 A;  2MA9 B;  4IKG A;  4EKU A;  1L7Y A;  3DPD A;  1XLO A;  2YEP B;  1N62 A;  1AW7 A;  3L13 A;  4S0R A;  1KOT A;  1HZ6 A;  5IP4 D;  4OVU A;  4DDG D;  3PO0 A;  2RDB C;  3DVG Y;  1WGD A;  2JPH A;  2KMM A;  1XCT L;  3RNF C;  4B0E A;  2KLG A;  5IKC M;  3ETR A;  4A3O A;  1TZ1 A;  2GI9 A;  2JYE A;  3IAM 1;  1EWC A;  2LXA A;  2D10 A;  1NEK B;  2N4F A;  3KWL A;  2INN E;  3KLS X;  3P42 A;  5G5G A;  4YT0 B;  4KIK B;  4AP4 C;  3H1U A;  4HJK A;  4WWM A;  4IOI E;  3GZN I;  4F8C B;  3M3J A;  4AUQ C;  4AOF A;  5IAA C;  5DPW A;  5C3J B;  1L0V B;  3P4R B;  3DWG C;  5H8Y E;  4EZL A;  2FIF A;  4CHK A;  2IGD A;  3GOE A;  2I1J A;  1E8W A;  3TEX A;  2FUG 1;  2MBE A;  2RPV A;  4MGK E;  2JX5 A;  2CJO A;  1FXT B;  2MBO A;  4WAA A;  3NVV A;  2V4I B;  2PJH A;  4GMV A;  4JIO U;  4KVG B;  3TL5 A;  4MSM B;  1HXY D;  2BYT A;  2JXX A;  3MC8 A;  3C8Y A;  2NCN A;  5IN7 A;  2I1K A;  5AUK A;  1RYJ A;  1WGH A;  3ZQ4 A;  2EEL A;  4K7W A;  2ZPY A;  5CHF A;  3W5V B;  4KV2 A;  1PDX A;  1YN4 A;  1WWT A;  3APF A;  5EE3 A;  2J0M A;  1JQ4 A;  2MLB A;  4RGM A;  1UNS A;  3IFW B;  1NBF C;  1ET6 A;  2KTR B;  4W9H A;  3OWE B;  2MRP A;  1QZE A;  1UGJ A;  1WYG A;  2R61 A;  3AXC A;  5AEK B;  3A33 B;  1NYR A;  3RPF C;  1MJD A;  3IBE A;  4JQW C;  3X0W A;  1VRA B;  2W55 A;  2VZK D;  1U4A A;  1E7P B;  2K25 A;  3PLV A;  4LNI A;  1FPY A;  4WJP A;  3OAW A;  4ZHP A;  3R2I A;  1YN5 A;  4NNJ B;  2JF5 A;  3MJ5 A;  4NAW B;  1WYW B;  3N3K B;  1CMX B;  1TIF A;  3RNC C;  3ZLZ A;  1KJT A;  2BPS A;  1Q5W B;  1LGR A;  3N9Y C;  2PE6 B;  4G0N B;  2CKH B;  1QQR A;  3VUY A;  4S17 A;  3ZJT A;  1TS5 A;  1XLP A;  5CHV C;  3ZW3 A;  4KGS A;  3ZNZ B;  4IM2 A;  1C9F A;  1MG8 A;  3MFG A;  3O13 A;  2KDE B;  2GB1 A;  1JW9 D;  1D6E C;  4C4V B;  5LNK 1;  4DXG A;  2ZZP B;  2K1F A;  1JRU A;  4KKJ A;  5EE1 A;  2KAC A;  2LGI A;  2J52 A;  1KTK A;  3IT6 B;  4NAM A;  1AWD A;  1UEL A;  4MSQ B;  4HRO A;  2BYE A;  5L95 C;  3K9O B;  2LHE A;  2LUM A;  1FNU A;  2C9W B;  1N61 A;  3W2D A;  3S2A A;  1ZGU B;  5HFY A;  3KH0 A;  5GMV A;  2CHW A;  2MH7 A;  4HPP A;  1XXG A;  2LRU A;  4FAD A;  2RMM A;  2WDQ B;  4DDI D;  2BT6 A;  4HCN B;  4RFB A;  3HVZ A;  1ENF A;  5EE9 A;  1V49 A;  1V2Y A;  1V5T A;  3H6N A;  1F2R C;  2VH1 A;  1V86 A;  2XBB C;  1I7H A;  3ZRC A;  1B1Z A;  4BVU C;  3V61 A;  1ZW7 A;  2BTE A;  5JXV A;  2N7D A;  1V80 A;  1HZ5 A;  4BKG A;  3AEF B;  3SFE B;  1TS4 A;  4CO7 A;  4A20 A;  4W9J A;  1TYG B;  5EDS A;  2BYF A;  4TUU A;  2LFI A;  4K7U A;  1NI2 A;  1RAX A;  3RZW C;  1TKY A;  1AYF A;  3BY4 B;  2KWD A;  2G9H D;  3X23 A;  3NRZ A;  2PTL A;  3ZTC A;  3W1S C;  1XD3 B;  4D2K A;  1E9M A;  5KHO A;  3W1S A;  3UIP B;  3LDZ E;  2WDT B;  2ZNV C;  5G2N A;  2C7N B;  2ZVN A;  4R3D A;  4FHK A;  2I2Y A;  1YX5 B;  4LDT B;  2A4Z A;  2KFK B;  2N9E B;  1FRD A;  3N30 A;  3I3T B;  3DBS A;  4KDL B;  3GZN B;  4HCP B;  2LWP A;  2N9X A;  3AB5 A;  3T8M A;  2KAJ A;  2KFJ A;  4LNF A;  3VTW A;  2NR2 A;  1Q10 A;  1ZXH A;  1XLN A;  1V81 A;  2CHZ A;  2A5U A;  1XT9 B;  4HEA 1;  2NBV B;  4WUR A;  1L4Z B;  1I42 A;  5HG2 A;  2D3B A;  2KDF B;  4MM3 B;  3ML9 A;  2WGS A;  3WAN A;  4MH8 A;  3DWM A;  1VCB A;  4B6W A;  4BKT A;  1IYF A;  1K8R B;  4LJP B;  4W9E A;  4PK1 A;  2M56 B;  3AH7 A;  4A6Q A;  3CSF A;  1NDD A;  3BK2 A;  1FXI A;  2KDB A;  4N6E B;  4ZYS A;  3Q8B A;  3L16 A;  1ACC A;  1QF6 A;  1RFA A;  2RGF A;  2BWF A;  1T6B X;  4ASW C;  3PTF C;  5JZE B;  2K8B A;  1WE7 A;  3DBH B;  3B1L X;  2KN5 A;  1LO5 D;  1ZXI A;  4C80 A;  3APC A;  1TT5 B;  3CF4 A;  2BF8 B;  1D5X C;  4FBJ B;  1J8C A;  1CZP A;  2GBR A;  1UWM A;  5BYR A;  2W82 A;  2RPQ A;  2V3N A;  2N7E A;  1UWX A;  3MP9 A;  4OVV A;  1RRB A;  1FD6 A;  2HDE A;  3A9K B;  3EHV A;  2NS5 A;  4MAC A;  3TCA A;  4HWI B;  2Z0D B;  3U30 A;  3U7Z A;  4DK5 A;  2JUO A;  1WJN A;  4O1N A;  3A9J A;  1OEY J;  2DYO A;  3NOB A;  4KGT A;  2MP2 B;  2GBJ A;  4RNA A;  5E6P A;  4II3 B;  1K50 A;  2R2O A;  2EKI A;  2NBW B;  2FAZ A;  1WM3 A;  2PKO A;  4C56 C;  3H9D A;  1VDV A;  1F9J A;  1VZ8 A;  1SF0 A;  4JPS A;  3DDC B;  4W9F A;  2KC1 A;  3TEZ A;  1C76 A;  3NVZ A;  1E0Z A;  4HLE A;  2J0J A;  3AU4 A;  2GBK A;  1WJ4 A;  4DWF A;  5D94 A;  2W3R A;  2W54 A;  3VH4 B;  1JAL A;  2EMS A;  1V8C A;  1GTE A;  2K22 A;  1OQY A;  2LUE A;  4GN1 A;  3TSS A;  4WJQ A;  3NZU A;  5DPT A;  5LXI B;  2PW9 A;  1OQQ A;  1H7W A;  2L8J A;  1X1M A;  1L4D B;  4M01 A;  2MW5 A;  2N0S B;  4JE3 B;  1RWS A;  1C78 A;  2SEB D;  2ZJD A;  3B08 A;  3M62 B;  3RT3 B;  1AN8 A;  5BMI A;  2ZW1 A;  2DBY A;  3V62 A;  1WZ0 A;  3PRM B;  2IJ0 A;  2J4X A;  4MH0 E;  4B95 A;  1QOB A;  1FFV A;  1XEE A;  2BWE S;  2G4D B;  3P63 A;  1I4Q A;  5AZF A;  3V60 A;  1MFW A;  1N63 A;  2ZPN A;  4IWP A;  3OLM D;  3UIO B;  3OG5 A;  3RFZ B;  3ZYY X;  4LJO B;  4GLS C;  4OZB A;  2IY0 B;  1OFF A;  4KKI A;  3H7S A;  3KUD B;  4NJ6 A;  1WI0 A;  4A8X C;  2FNJ B;  2QHO A;  3ZNH B;  5G5H A;  3AEC B;  2MBH A;  2UU7 A;  2B76 B;  2FID A;  1WXS A;  1WXV A;  2Y5C A;  1J7C A;  2KWU B;  3P4S B;  1RLF A;  4HKQ A;  3PHX B;  1QKZ A;  3VTU A;  4GIV A;  2WS3 B;  3PZ7 A;  2J53 A;  2RD0 A;  3EUB 2;  2KQS A;  2CHX A;  1SSN A;  2C5L C;  2PEA A;  3A1Q A;  3VR8 B;  4IC7 B;  4RMA A;  3A9J B;  2QIL A;  3ZIM A;  1SE4 A;  1WGK A;  5D3D A;  1BT0 A;  3JW0 X;  2LVQ A;  1ZDV A;  1K53 A;  2IZV B;  2KQ4 X;  3ZVV A;  3HHM A;  4FJV B;  2INP E;  3NZS A;  2IYD B;  1STE A;  1WH3 A;  5BMG A;  4GU2 A;  4IWQ A;  2KO3 A;  2L83 A;  3QAR A;  1V1P A;  2WX0 A;  4IG7 B;  1VZ7 A;  2KDM A;  3JYU A;  3TEY A;  2KWC A;  2GRI A;  3VRB B;  2L1A A;  4WWO A;  1V9J A;  1UUP A;  3C19 A;  5E6N A;  2WWZ A;  1GC6 A;  1QOF A;  3IT4 B;  1GOZ A;  2GBN A;  3U2S C;  3ENE A;  2KJR A;  3B0A A;  1YQB A;  2KTF A;  4LK0 M;  3L08 A;  2M4N A;  1ROE A;  4CYE A;  2REX A;  1XQQ A;  3VVW B;  2NTS A;  4JWS C;  2CU1 A;  4CQN A;  4WQO B;  4WQM A;  2WXF A;  1FXA A;  1YMH E;  2KK8 A;  2KJ6 A;  4FUL A;  1WGR A;  1SE3 A;  2XK5 A;  1ZUD 2;  1GB1 A;  3RUL A;  3TEW A;  3RNG C;  3AE3 B;  3UGB B;  2CR5 A;  2K0P A;  1PQS A;  1P7F A;  1P0R A;  3PLU A;  1C3T A;  2LVO A;  3DVN U;  2IO3 B;  2DZM A;  1WMH B;  1TTN A;  1UBI A;  4RM9 A;  1DOI A;  3PHW B;  3BII D;  2JU6 X;  2V4L A;  2LXC A;  4X57 B;  3ZNG C;  1I4P A;  3I9V 1;  4UDU C;  3AE5 B;  4KZ0 A;  3SU8 X;  2WXH A;  2FCN A;  3QIJ A;  3EFC A;  2AEH A;  1F0Z A;  2WDR B;  2HE7 A;  1I35 A;  3T3N A;  1N5X A;  2DNF A;  2L76 A;  1JCK B;  2MBQ A;  3T9L A;  4KDI C;  3PV1 A;  5JHB A;  2V9H A;  1JRO A;  3BVG A;  2JZ3 B;  2IND C;  1V97 A;  3OJ3 A;  3AEB B;  4RM8 A;  2RSU A;  2IO0 B;  5FR3 A;  3Q2A C;  1JWU D;  1H8C A;  1EWY C;  1JWB D;  3AM9 A;  2GBM A;  3QC8 B;  3AED B;  2AL6 A;  2OJR A;  1E7U A;  5LXH A;  2K6D B;  4TQ0 A;  4RF1 A;  1HEZ E;  2BQQ A;  4EZK A;  3ZDM C;  3M63 B;  2BS2 B;  3AV8 A;  4TSS A;  4MJS A;  1V1P B;  4ANU A;  3B9J A;  3RZF A;  3EGR A;  2QMT A;  1MHH E;  2KHW B;  2KAN A;  3AE1 B;  1WR6 E;  4M02 A;  2DWQ A;  3A4S C;  2G1E A;  1SJH D;  2QC8 A;  1TBE A;  1VLB A;  2KLC A;  3Q3F A;  4LLG M;  2L52 A;  1MHX A;  4WJN A;  1T0S C;  2WXK A;  5BO4 B;  2WDV B;  4ANX A;  4DHJ D;  1WY8 A;  3W9C B;  2LJ5 A;  4EEW A;  1J7B A;  2WU5 B;  1WGY A;  3HUI A;  3JVZ X;  4ANV A;  4PS7 A;  2ZCC A;  3VXW A;  1FRR A;  2IGH A;  4ZHO A;  2IGG A;  3WIM A;  1TY2 A;  1C4C A;  2V3S A;  1WX7 A;  3WAO A;  2WXQ A;  2R2Q A;  4HK2 A;  3ZJU A;  1WRI A;  3IHP C;  1A5R A;  1GUA B;  1KF6 B;  1BXT A;  4FJY A;  5E6O A;  1ZP0 B;  3I5J C;  3PVL A;  4WJO A;  5BYS A;  2ACZ B;  2WXR A;  3LB8 C;  4K3B A;  2PMV A;  4EUT A;  4TMA B;  2ZNV B;  5AZG A;  4ARC A;  5GXG B;  2C60 A;  1IBX B;  4ZRI A;  1MI0 A;  1T0R C;  3BWU D;  2FE8 A;  4ZRK A;  3V6C B;  4BZA A;  3TJP A;  4HPM B;  4OVZ A;  4W9L A;  2MX2 A;  5C2T B;  1YOV B;  4IW0 A;  5D3I B;  5IOI A;  2L32 A;  4P6V F;  4BOZ B;  3VTV A;  1VZ6 A;  5DPR A;  3UQA A;  3VR9 B;  2OED A;  3T3O A;  1SIF A;  1SXT A;  1YNT E;  1ZDX A;  1E8Y A;  2QIE B;  2Z0E B;  1EF5 A;  2N9P C;  4MGI E;  3R7R A;  1NEN B;  1C79 A;  1OEY A;  1J19 A;  3IG3 A;  3IAS 1;  1PFD A;  3BIN A;  1TY0 A;  1FM0 D;  4NPN A;  4M8M A;  3WCQ A;  3HM6 X;  1UH6 A;  5FK9 C;  3QCA A;  4OZC A;  2IDY A;  3ALB A;  4FLH A;  2AQ2 B;  1WJU A;  2ZVO A;  2IBI B;  2DLB A;  2O2V A;  1GC7 A;  1IGD A;  1EO6 A;  3AEG B;  2N7J A;  2BB5 A;  2ICI A;  4YTN B;  2BVC A;  2JXT A;  1LM8 B;  1C77 A;  2PIA A;  4A55 A;  1FNV A;  2KN4 A;  1EU3 A;  4IM0 A;  4ZYN A;  3VHT C;  3IXS A;  1WRD B;  2Q5W D;  4B9K A;  3H7P B;  3ZJV A;  3QA8 A;  4KX6 B;  1FNW A;  1KLV A;  1R4M I;  2KKC A;  2XEW A;  3AE6 B;  2BW2 A;  3AE2 B;  3A1Q B;  3N20 C;  1L2N A;  2KTR A;  2QCZ A;  3HVD A;  4EE2 A;  3SR6 A;  2IPK D;  4EZJ A;  1YJI A;  4J6I A;  1N6Z A;  2GOW A;  3L0W B;  4N59 A;  2AQ1 B;  3ML8 A;  4XC2 A;  1HA5 A;  3PPA A;  1ESF A;  4PYU A;  1EM7 A;  4KZC A;  3FAH A;  2G3Q B;  3EEC A;  1R4N B;  2D3A A;  2KD0 A;  2Y3A A;  1SBB B;  5D7G A;  1IBX A;  4W9C A;  4DXA B;  3Q14 C;  2RR9 A;  3NVW A;  3PRP B;  1R4N I;  4NY0 A;  2NBU A;  5JH5 C;  3HM3 A;  3PSE B;  3WA0 A;  3RCZ A;  1NVI D;  1RM6 C;  3URY A;  3OJ4 B;  1FIQ A;  4NQK E;  3KW5 B;  2FCM A;  2JSV X;  2D2Q A;  4YSX B;  3IVF A;  2X8X X;  3D32 A;  2VH2 A;  1HTO A;  4URK A;  4YTP B;  3ZTD A;  2XK5 B;  3A9K A;  1I4R A;  4PS3 A;  4FN2 A;  5J18 A;  1GB4 A;  4HRS A;  1YN3 A;  1D3Z A;  2SAK A;  2WXI A;  2EKE C;  2RDG A;  4MGZ E;  5C1Z A;  2M0X A;  3GB1 A;  3Q8A A;  3Q3J A;  3QWZ B;  4XZ4 A;  2GLS A;  3ZNI D;  3RNA C;  3QHT A;  2GMI C;  3Q8C A;  1A70 A;  2AYO B;  3MC9 A;  3JSV B;  4DQO C;  3DOW A;  4BBN C;  3N1Z C;  1N60 A;  3Q3M C;  3AU5 A;  1M94 A;  2N1V A;  1EF1 A;  2BS3 B;  4IM3 A;  3A4R A;  2JY6 A;  2JZZ A;  2NVU I;  4EFO A;  1YX6 B;  3O65 B;  1G6J A;  1XO3 A;  1L5P A;  2LGD A;  2L0F A;  1NI3 A;  4YTM B;  2Z8L A;  4G3X B;  1VD2 A;  2PLP A;  4LNN A;  3GP7 A;  4RGO S;  2LZ6 A;  4ICV A;  1YJJ A;  4W9G A;  3AI5 A;  5TSS A;  2Y5P A;  2K39 A;  3ONS A;  5J17 A;  3U7D A;  2DAF A;  2V3P A;  2BGF A;  1FFU A;  5EE0 A;  4KSL C;  2FCS A;  1DOX A;  1WX9 A;  2DX5 B;  4G50 A;  3CST A;  1L6U A;  4ACF A;  3GE8 C;  3QK0 A;  5G55 A;  3NUH B;  2BBC A;  2IY1 B;  4ZDV A;  4C7Y A;  4XWT A;  1D5M C;  2QJL A;  4P16 A;  1SIJ A;  2DAJ A;  4IUM B;  1KFY B;  1MVK A;  4II2 B;  2XNA C;  3V3X A;  2MEK A;  2M17 A;  4K3C A;  1YQ3 B;  1TKE A;  4LNK A;  1I4G A;  4DHZ B;  2BB6 A;  4GGQ A;  1VR9 A;  2HJ8 A;  1JWA D;  3QAQ A;  1D4B A;  2DEN B;  3SFD B;  1Q1O A;  5AZH A;  3BZD B;  1PGX A;  1IUE A;  1WFY A;  1V5O A;  2X38 A;  1T3Q A;  2L05 A;  3N32 A;  1GTH A;  2I38 A;  4K81 A;  3FC4 A;  3GE3 C;  3VH3 B;  1WM2 A;  2W3S A;  1HTQ A;  4RCO A;  3AEA B;  1WGG A;  1KRH A;  4M0W B;  2KMA A;  3SEB A;  3RD2 A;  3NG0 A;  4IDI A;  3R3M A;  4E3C A;  1Z5S B;  4BKS D;  2LRW A;  2DHZ A;  4K7S A;  5IA7 A;  2AWT A;  3J9C A;  3L17 A;  5DCN A;  2C7H A;  2QEJ C;  2D5G A;  2K6Q A;  2WXN A;  2V0G A;  3RNB C;  3KUC B;  4LDT D;  5D6J B;  4JX1 C;  1P7E A;  4TKN A;  3CF6 E;  3UQB A;  3BVZ A;  2G45 B;  1IGC A;  2KT7 A;  4MDK E;  2D11 A;  4GSW A;  3Q8E A;  2WXG A;  1UGM A;  3E9S A;  2WXJ A;  3V6E B;  1TGZ B;  2K5P A;  2MSE D;  4W9K A;  3Q3N C;  1DOY A;  5FR6 A;  2N9L A;  2ON8 A;  2KX0 A;  1SE9 A;  2JRI B;  4IWO A;  4RGT A;  2ONQ A;  3Q6B A;  3B2G A;  2KMC A;  5TR5 A;  1L0X B;  4HXD A;  3V05 A;  4MT5 A;  3DVG X;  3PRZ A;  4WWN A;  3P1M A;  1QLB B;  3UIN B;  3VFK A;  4I6L B;  1QIL A;  4JL9 A;  1KLG D;  4LCD E;  1GJZ A;  1ISN A;  4PS8 A;  2KWV B;  1Q0W B;  1T0Y A;  2J7Q B;  5HKH A;  1ZE3 D;  3RMK C;  1F77 A;  1WXM A;  1E8X A;  3EC8 A;  1UBQ A;  2K9X A;  4K1R B;  1P9D U;  2TSS A;  1F52 A;  1FCC C;  2WXO A;  1KH0 A;  4XWW A;  2QSD A;  1C4A A;  3UI3 A;  4MJS B;  3CWI A;  5CX3 A;  3APD A;  4WAF A;  2DYM A;  1PGB A;  3AE4 B;  3L10 B;  4NZL B;  1L6V A;  1S3S G;  3TBL D;  2LGX A;  3Q3O C;  2MBB B;  2NPT A;  3N1X C;  3DVN V;  2FCQ A;  3R2T A;  1EUV B;  4F7Z A;  3VUX A;  1E10 A;  1OTR B;  1TS3 A;  5I4D A;  2DYB A;  2JVC A;  2JZP A;  3LXF A;  4L23 A;  1R7S A;  1WX8 A;  4RF0 A;  1WR1 A;  4RH6 A;  3R8B A;  2MHJ A;  4FXC A;  2LI5 A;  1ZOY B;  3TIX A;  3EA6 A;  4GB9 A;  2ZEQ A;  2KC2 A;  1P98 A;  1M4V A;  2C7M B;  4YL8 A;  2M19 A;  1E90 A;  4QAY A;  1Y56 A;  3SD5 A;  3ZDT A;  3ZXR A;  5J2R A;  3MC0 B;  1BUI C;  1FO4 A;  3VUW A;  2DZJ A;  5IO9 A;  2KZR A;  3I57 A;  1GAQ B;  2AX5 A;  4I6N B;  1WXA A;  2LGY A;  3RI7 C;  5KHQ A;  3MHZ A;  1PUT A;  2N1W A;  2L00 B;  4HDQ A;  1R4M B; 
#chains in the Genus database with same CATH homology
 2W54 A;  3ZGZ A;  3ZJV A;  1JAL A;  1XLO A;  2YEP B;  2WLB A;  1V8C A;  1N62 A;  1AW7 A;  4KX6 B;  1FNW A;  1GTE A;  1HZ6 A;  2K22 A;  4WIP A;  1N5W A;  1CK1 A;  4XDC A;  3PO0 A;  3AE6 B;  2BW2 A;  2JQR B;  3TSS A;  3AE2 B;  4A9A A;  2KMM A;  1XCT L;  1TS2 A;  4B0E A;  2PW9 A;  1JWS D;  1OQQ A;  3HVD A;  2JWU A;  3ETR A;  4EE2 A;  1H7W A;  1SB3 C;  2GI9 A;  2IPK D;  2JYE A;  3IAM 1;  1HQR D;  4OHJ A;  3SR6 A;  1EWC A;  1YJI A;  1L4D B;  1QOG A;  1CQV A;  4ITK A;  3VRA B;  2N0S B;  4N59 A;  2AQ1 B;  4JE3 B;  4XDD A;  1NEK B;  1RWS A;  1C78 A;  2SEB D;  4N58 A;  1HA5 A;  2WU2 B;  3KWL A;  2INN E;  3AE9 B;  1AN8 A;  1WSP A;  3KLS X;  5BMI A;  3W5U B;  2ZW1 A;  2DBY A;  3P42 A;  1ESF A;  5G5G A;  1EM7 A;  5BMH A;  4YT0 B;  3FAH A;  4YXD B;  2IJ0 A;  2J4X A;  2Y3A A;  1SBB B;  4WWM A;  5D7G A;  1IBX A;  4IOI E;  1I4X A;  1QOB A;  1FFV A;  1QOA A;  1XEE A;  3P63 A;  3NVW A;  3BYY B;  5C3J B;  1I4Q A;  1L0V B;  3P4R B;  3DWG C;  5H8Y E;  1N63 A;  1H7X A;  2MJE A;  1FCL A;  2IGD A;  3RFZ B;  3ZYY X;  4GLS C;  3TEX A;  2FUG 1;  4OZB A;  1OFF A;  2RPV A;  4KKI A;  1NVI D;  2CJO A;  1RM6 C;  2JX5 A;  3URY A;  3NVY A;  4A8X C;  2MJD A;  1FIQ A;  3NVV A;  2V4I B;  5G5H A;  3AEC B;  2B76 B;  2JSV X;  4YSX B;  2Y5C A;  3AN1 A;  3CIR B;  1J7C A;  1HXY D;  3P4S B;  2BYT A;  4HKQ A;  1V1O A;  1QKZ A;  3C8Y A;  3KQ4 A;  2WXM A;  2WS3 B;  4YTP B;  3PZ7 A;  5AUK A;  1RYJ A;  2J53 A;  1I4R A;  3EUB 2;  3ZQ4 A;  2EEL A;  3P4Q B;  1GB4 A;  3W5V B;  4HRS A;  1DGJ A;  1YN3 A;  2SAK A;  4B0M A;  1SSN A;  1PDX A;  1YN4 A;  2WXI A;  1WWT A;  5EE3 A;  2RDG A;  1JQ4 A;  4RGM A;  3VR8 B;  1UNS A;  3KWV A;  1ET6 A;  2QIL A;  3GB1 A;  1SE4 A;  3OWE B;  3P4P B;  1WGK A;  3Q8A A;  5D3D A;  1TKG A;  4J3O D;  2FBW B;  1UGJ A;  1TZO A;  1ZDV A;  1WYG A;  2R61 A;  1K53 A;  2KQ4 X;  1XF5 L;  1E6E B;  2MJ3 A;  3Q8C A;  1A70 A;  3B2F A;  2INP E;  1NYR A;  3RPF C;  4DQO C;  1N60 A;  4H2A A;  2BS3 B;  1STE A;  5BMG A;  1VRA B;  2W55 A;  2VZK D;  2L83 A;  1E7P B;  1V1P A;  1C4P A;  1XO3 A;  1L5P A;  1VZ7 A;  4NJC A;  2KDM A;  3TEY A;  2GRI A;  3VRB B;  3H8H A;  2L1A A;  4ZHP A;  1NI3 A;  1UUP A;  4YTM B;  3R2I A;  1YN5 A;  2Z8L A;  1PYW D;  2WXL A;  3MJ5 A;  3AE7 B;  4NAW B;  1QOF A;  3IT4 B;  2PLP A;  1GOZ A;  3FIL B;  3GP7 A;  4RGO S;  1ZPS A;  1EU4 A;  3U2S C;  1YJJ A;  3N9Y C;  4LK0 M;  5TSS A;  2Y5P A;  2NMQ A;  3Q8F A;  1QQR A;  1ROE A;  3ZJT A;  2K3U A;  2NTS A;  2V3P A;  1WXQ A;  4JWS C;  1TS5 A;  4CQN A;  1XLP A;  1FFU A;  5EE0 A;  1DOX A;  2XN9 C;  2HTM E;  4WQM A;  2WXF A;  4KGS A;  1FXA A;  1YMH E;  5BYQ A;  1DYQ A;  1JML A;  1L6U A;  1SEB D;  1C9F A;  1SE3 A;  3MFG A;  4AS1 A;  3O13 A;  3NUH B;  2BBC A;  1ZUD 2;  4C7Y A;  2GB1 A;  5AUI A;  1JW9 D;  1D6E C;  2H88 B;  1K51 A;  4DXG A;  4DXF A;  5LNK 1;  1GB1 A;  4XWT A;  3TEW A;  1D5M C;  2QJL A;  4P16 A;  1SIJ A;  4KKJ A;  3AE3 B;  2E6X A;  2KAC A;  2LGI A;  2J52 A;  5EE1 A;  1KFY B;  3BK1 A;  1KTK A;  1MVK A;  5MPO A;  3IT6 B;  4NAM A;  1AWD A;  2XNA C;  4HRO A;  3V3X A;  2MEK A;  2K0P A;  1NYQ A;  2LHD A;  2LHE A;  1P7F A;  2LUM A;  1YQ3 B;  1FNU A;  1RFK A;  4US9 A;  1N61 A;  1TKE A;  3W2D A;  4YSZ B;  3TUO A;  5HFY A;  2AQ3 B;  1I4H A;  1XLQ A;  1I4G A;  4US8 A;  2BB6 A;  3BVM A;  2MH7 A;  2J42 A;  2CU3 A;  1VR9 A;  1DOI A;  1XXG A;  1JWA D;  1D4B A;  2RMM A;  2WDQ B;  3SFD B;  3BII D;  2JU6 X;  2BT6 A;  5E6J A;  3BZD B;  1PGX A;  1IUE A;  3BYT B;  4RFB A;  3HVZ A;  2X38 A;  1T3Q A;  1ENF A;  1I4P A;  1MPE A;  3I9V 1;  5EE9 A;  4UDU C;  4YSY B;  3AE5 B;  4L2Y A;  2PVO D;  3AE8 B;  2WXH A;  1F2R C;  2NTT A;  1I7H A;  1GTH A;  2I38 A;  1F0Z A;  2WDR B;  1B1Z A;  2BTE A;  3FC4 A;  5JXV A;  3Q69 A;  1N5X A;  3T3N A;  1JCK B;  2PVG C;  3LYY A;  1HZ5 A;  2W3S A;  4RCO A;  3AEA B;  1KRH A;  3AEF B;  3SFE B;  1TS4 A;  1JRO A;  3FIL A;  1F2R I;  3SEB A;  3BVG A;  1TYG B;  4IDI A;  1V97 A;  4HKZ E;  3AEB B;  1BML C;  2YEP F;  5FR3 A;  2LFI A;  1JWU D;  4RGN A;  1EWY C;  1JWB D;  3AM9 A;  3J9C A;  3AED B;  1TKY A;  2QEJ C;  1AYF A;  2KWD A;  2G9H D;  2E3T A;  3AMZ A;  2D5G A;  1CJE A;  2WXN A;  3NRZ A;  4TQ0 A;  2V0G A;  4ZRQ A;  2PTL A;  4RF1 A;  1HEZ E;  4D2K A;  1E9M A;  3W1S A;  1D5Z C;  4JX1 C;  1P7E A;  2BS2 B;  3AV8 A;  4TSS A;  2JYT A;  1L0Y B;  1V1P B;  3BVZ A;  3VQI A;  1IGC A;  4OZA A;  4L1B A;  4R3D A;  3B9J A;  3PZ8 A;  2I2Y A;  3EGR A;  2QMT A;  3ABV B;  1MHH E;  1FRD A;  3Q8E A;  3AE1 B;  2WXG A;  4PT5 A;  2DWQ A;  3E9S A;  2WXJ A;  2G1E A;  1SJH D;  2N9K A;  3AB5 A;  2K5P A;  1VLB A;  2WQY B;  2KAJ A;  4LLG M;  2L52 A;  1MHX A;  1SJE D;  2CJN A;  1DOY A;  2N9L A;  2ON8 A;  2VZK B;  1Q10 A;  1ZXH A;  5HHD G;  1XLN A;  2WXK A;  2WDV B;  3E56 A;  4RGT A;  5HI1 A;  2ONQ A;  3W9C B;  3B2G A;  4HEA 1;  1SE2 A;  4WUR A;  1J7B A;  1L4Z B;  2WU5 B;  3HUI A;  5HG2 A;  1L0X B;  4C7Z A;  1GPX A;  4M0W A;  4MT5 A;  3V05 A;  4MM3 B;  1FRR A;  3P1M A;  1QLB B;  2IGH A;  1OQR A;  4MH8 A;  4ZHO A;  3DWM A;  1QIL A;  2IGG A;  1KLG D;  1TY2 A;  1C4C A;  1XCQ L;  2WXQ A;  3ZJU A;  1WRI A;  1ZE3 D;  2M56 B;  3AH7 A;  2LJI A;  4A6Q A;  1F77 A;  1KF6 B;  1BXT A;  3BK2 A;  4AQ7 A;  1ZP0 B;  1FXI A;  2K9X A;  4N6E B;  4ZYS A;  5BYS A;  3Q8B A;  4ZOH C;  4Q2J A;  2ACZ B;  1ACC A;  2TSS A;  1QF6 A;  2WXP A;  2WXR A;  3LB8 C;  4ARI A;  1T6B X;  1FCC C;  1GT8 A;  2PMV A;  2WNM A;  2WXO A;  1K52 A;  1KH0 A;  4TMA B;  1FEH A;  4ZRP A;  2QSD A;  1C4A A;  4XWW A;  3NZ3 A;  3GS2 A;  3UI3 A;  4XE0 A;  1LO5 D;  3CWI A;  1ZXI A;  4JWU C;  4ARC A;  5GXG B;  2LMC A;  4WAF A;  2OHF A;  1IBX B;  1MI0 A;  4C80 A;  2DYM A;  3BWU D;  4YWG G;  4KGR A;  3CF4 A;  1PGB A;  2FE8 A;  3AE4 B;  1D5X C;  1JWM D;  1YQ4 B;  4NZL B;  5FKA C;  1L6V A;  4USA A;  1CZP A;  4OVZ A;  1UWM A;  5BYR A;  2W82 A;  2V3N A;  5C2T B;  1JRP A;  4HJG E;  1UWX A;  3MP9 A;  1FMA D;  3R2T A;  5D3I B;  4REZ A;  1FD6 A;  2L32 A;  4P6V F;  1TJE A;  1E10 A;  1VZ6 A;  5H92 C;  1ET9 A;  2HDE A;  3VR9 B;  2OED A;  1TS3 A;  5I4D A;  3T3O A;  1SXT A;  2JZP A;  3AEE B;  1YNT E;  1ZDX A;  4MAC A;  4LTU A;  3LXF A;  2QIE B;  4L23 A;  3U7Z A;  1R7S A;  4RF0 A;  1VJK A;  2BS4 B;  1NEN B;  5T8I A;  4O1N A;  4GDK B;  1C79 A;  4RH6 A;  4A90 A;  3R8B A;  2DYO A;  3HRD D;  4KGT A;  4FXC A;  3U4E G;  3L4P A;  3IAS 1;  1PFD A;  4RNA A;  1TY0 A;  1T5X D;  1FM0 D;  4GDL B;  1PGA A;  3WCQ A;  2LEK A;  4TQ1 A;  1ZOY B;  1K50 A;  3U52 E;  2EKI A;  3EA6 A;  5FK9 C;  4OZC A;  2IDY A;  2AQ2 B;  1B9R A;  1M4V A;  2PKO A;  4WH4 A;  2M19 A;  2WP9 B;  4C56 C;  3NS1 A;  2DLB A;  1VDV A;  4OW0 A;  2H89 B;  1Y56 A;  1IGD A;  3MC0 B;  1BUI C;  1VZ8 A;  1SF0 A;  4JPS A;  3AEG B;  1KLU D;  2N7J A;  1FO4 A;  2BB5 A;  2ICI A;  1J7A A;  2RDH A;  4YTN B;  3TEZ A;  1C76 A;  2M0A A;  3NVZ A;  1QT9 A;  1E0Z A;  3I57 A;  2ZW0 A;  2JXT A;  1GAQ B;  1C77 A;  2AX5 A;  2PIA A;  4A55 A;  1FNV A;  2KN4 A;  1EU3 A;  4IKG A;  3MHZ A;  3IXS A;  1PUT A;  2Q5W D;  2W3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...