3SFEB

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and thiabendazole
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
APRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3sfeB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sfeB01
1NI3A 3AN1A 1TKEA 1UWMA 3AEEB 4JX1C 3AE2B 1E0ZA 1JQ4A 2PVOD 5C2TB 4IDIA 1F0ZA 5AUIA 3P4PB 1FRRA 1PFDA 3PO0A 4ITKA 1OQQA 5EE3A 1NYQA 1AWDA 4HROA 5EE0A 1JWAD 4C7ZA 1GT8A 3AEDB 1TKYA 1E10A 1OQRA 2G1EA 3CWIA 2H88B 3AEFB 4HRSA 4USAA 3AE5B 3NVWA 1SIJA 2AX5A 1WYGA 1FO4A 1N5XA 4YSXB 1YJIA 5EE9A 2WQYB 3AEGB 1CJEA 1AYFA 2KAJA 1E9MA 2EKIA 1VDVA 1SF0A 1FFVA 1QOAA 1PDXA 1FXAA 1L6UA 3NRZA 2PKOA 1PUTA 1YQ3B 3AE3B 2CJNA 5AUKA 1WXQA 1RFKA 3CIRB 5MPOA 3AH7A 4KX6B 2MJDA 4LTUA 1NVID 1JRPA 3EUB2 1J7AA 2L83A 3AV8A 3B9JA 4N6EB 1FFUA 1V97A 2QJLA 4FXCA 1NENB 1VJKA 2CJOA 1H7WA 1YQ4B 1L6VA 3ZYYX 2WS3B 1KF6B 3AEBB 1XLPA 3AM9A 4US8A 1E7PB 4YTPB 1N5WA 2ACZB 2W3RA 1DOYA 1JALA 1WWTA 1GTHA 1V8CA 1XLOA 3RPFC 4WQMA 1QF6A 1XLQA 1XO3A 3B2GA 2JQRB 1RM6C 2WP9B 1B9RA 3HVZA 3VRBB 3AE8B 3LB8C 1NEKB 3L4PA 3AB5A 3AMZA 4P6VF 1L5PA 3LXFA 1NYRA 2MH7A 1FMAD 1KFYB 1N63A 3HUIA 1VLBA 2M19A 3FC4A 2MJEA 3P1MA 2WU5B 1RWSA 2DBYA 4ZOHC 5G5HA 2LEKA 2M56B 2BS2B 2QIEB 1JW9D 3P4QB 3AE1B 4YTMB 1E6EB 2BT6A 3KWLA 1H7XA 2Y5CA 1GAQB 1TKGA 2DWQA 4ZHPA 1XLNA 3NVZA 3W5UB 1TJEA 2OHFA 1A70A 3DWGC 2WDVB 3AE6B 1ZUD2 5H8YE 5G5GA 1GTEA 2WDRB 2W54A 1J7CA 1KRHA 4YSYB 1QOBA 1WRIA 2BS3B 1SB3C 3AECB 2N0SB 3ETRA 3SR6A 2BS4B 2KMMA 3P63A 5H92C 3P4RB 1I7HA 1YJJA 2K9XA 2WU2B 1JWBD 2H89B 4C7YA 1QLBB 2FBWB 3VR9B 2K5PA 3VRAB 1RYJA 1ROEA 1OFFA 3HRDD 2WDQB 3DWMA 4US9A 5GXGB 3B2FA 3SFEB 2PVGC 3NVYA 2PIAA 1R7SA 3W9CB 3SFDB 4N59A 4C80A 4ZHOA 2MJ3A 4WWMA 1QOGA 3W5VB 1ZXIA 1DOIA 2HTME 2JX5A 2W55A 1GPXA 1ZP0B 1J7BA 4A9AA 1T3QA 1DOXA 2K22A 1N60A 3NVVA 3AEAB 1QT9A 1L0VB 5C3JB 1N61A 3NS1A 1CZPA 5EE1A 3WCQA 1JROA 2Q5WD 1FRDA 3VR8B 1IUEA 3AE9B 2WLBA 1FXIA 1FM0D 2CU3A 1EWYC 4YXDB 4JWUC 3AE7B 2W3SA 4YSZB 3CF4A 1QOFA 3AE4B 2L52A 4N58A 1N62A 4JWSC 4YT0B 3ABVB 3FAHA 2E3TA 3BIID 1ZOYB 1DGJA 4YTNB 2B76B 1WGKA 1FIQA 3P4SB 1TYGB
chains in the Genus database with same CATH superfamily
1UWMA 4LNOA 3W2DA 2LWPA 1JWUD 4K7WA 4IUMB 4FHKA 1GG3A 1JWAD 1E10A 2JZPA 1OQRA 3PT2B 2C60A 3NVWA 2V4LA 2O6VB 4BKGA 3AEGB 1K51A 2MCNB 1Z5SB 2QCZA 1YD8U 3H7PB 2NPTB 1VZ8A 2NVUI 2JZ3B 1E7UA 1WY8A 2CJNA 1RFKA 2MLBA 3BK1A 1JRPA 3SU8X 1L6VA 3WALA 1ET9A 2ACZB 1DOYA 1XEEA 2AEHA 4JE3B 2IY0B 1SJHD 3IFWB 4PYUA 4A6QA 1FNUA 3TBLD 2DNFA 1GUAB 3EFUA 1K53A 1MHHE 2KLCA 1ACCA 4NAWA 2J0JA 3HUIA 4WWNA 2Z8LA 3FC4A 2M56B 2IO3B 1LGRA 1UBQA 2BW2A 4GXBA 1A5RA 3V05A 2AYOB 2WXQA 1WJUA 2O6VD 1KRHA 1WM2A 1WIAA 2EMTA 4C7YA 1IPGA 1YIWA 3GZNB 4GLSC 2KZRA 3P2BA 3DWMA 3Q8FA 3B2FA 2IY1B 4MJSA 1ZXIA 4B95A 2CU1A 3DVGX 4R3DA 1QILA 2D10A 1HZ6A 4OVZA 4LLGM 3OJ4B 3WCQA 1I4HA 2K0PA 1UGMA 3AE7B 1WR1A 1N62A 2K1FA 2LGXA 3BIID 2C7MB 3TSSA 2L32A 4ANXA 1WE6A 1HA5A 3ZLZA 2DZJA 3V3XA 4OZBA 1D4BA 4XDDA 1NBFC 2KVZA 1YOVB 3N32A 3ZNZB 3AEFB 2PPHA 3AE5B 4FBJB 1YNTE 4LNNA 3S2AA 2EKIA 2FNJB 4A55A 3HM6X 4DXAB 3DBHB 4AQ7A 3NRZA 1EO6A 3R3MA 3RNAC 2YEPF 4W9IA 4ZRKA 4P7IA 3B9JA 2KNBA 4URKA 2WS3B 2BVCA 1Q1OA 2WXRA 1MHXA 1E7PB 2KWUB 3H7SA 1FNWA 3FILB 2BPSA 2WXIA 2WP9B 4HWIB 5C23A 3PRZA 3SD5A 1R4NI 4IOIE 2ZNVC 4ZOHC 2QSDA 2INCC 2QDFA 4B6WA 1I42A 3IXSA 4BKSD 3MP9A 4NJ7A 2WDVB 5BMIA 2KQ7A 5G5GA 4KZCA 4YSYB 1QOBA 1WRIA 1YX6B 1WX9A 3JSVB 3P63A 4IM0A 5IA7A 4MDKE 1JWBD 2MQJA 1QLBB 2FBWB 2I38A 3VVWB 1S3SG 3A9KB 5DPWA 4K81A 3W1SC 5I4DA 1AARA 2JWZA 1ZP0B 1NI2A 4S0RA 3ZNID 1HXYD 4P1CC 1QT9A 5E6PA 3PSEB 1CZPA 2WXGA 1L4ZB 3U4EG 1D5XC 3R2IA 3DVNU 3ZTDA 2KN5A 2N9XA 1GB4A 1WGKA 1DYQA 1T6BX 3MFGA 4G11A 2MBBB 4HVBA 3H7PA 4KSKC 1Z2MA 4TSSA 1E0ZA 2R2OA 4HXDA 3PO0A 3GB1A 1HQRD 2DYMA 3QA8A 4RMAA 4USAA 1BXTA 5DPTA 2I1JA 2MBEA 3NOBA 2XK5B 1TBEA 1SF0A 1L6UA 2LVPA 1FEHA 3M63B 1YJ1A 4OVUA 4HDOA 3U7ZA 2NTTA 3A9KA 2MA9B 2LJIA 2KANA 2SEBD 4ICUA 1P9DU 1WXAA 4WQMA 1PYWD 1WE7A 1XO3A 2JQRB 1WYWB 2MHJA 3ZGZA 2BWES 4EFOA 3UIOB 2LD9A 3AMZA 2IPKD 2KT7A 2XK5A 2A4ZA 3QC8B 1YN5A 2C9WB 5IP4D 3OLMD 1N63A 4WWOA 1EUVB 1JW9D 3P4QB 4YTMB 1E6EB 2ZVNA 2Y5CA 2DZKA 1WX8A 1H8CA 2M8SA 1JMLA 3TEWA 2IGDA 2BS3B 3H8HA 1VZ7A 3RCZA 3A33B 4BOSC 3URYA 2K5PA 3PZ7A 4II2B 1HEZE 1PQSA 1RYJA 5CTRC 4ZHOA 4RM9A 1RFAA 3AU4A 5JH5C 4KIKA 1TTNA 2LMCA 3VXWA 5C1ZA 2MSED 2JVCA 3MHZA 3ABVB 4A20A 4M00A 1HTQA 2C7NB 1WF9A 1MPEA 1JQ4A 1UNSA 4DDGD 2ZEQA 3HM3A 1SE4A 1FRRA 3KVFB 2AWTA 3NG0A 4HROA 3TCAA 2KDIA 1K8RB 4LK0M 1C1YB 1ISNA 4YSXB 2WXNA 1LM8B 4MEMA 4RF1A 2N7DA 4ZRPA 3AE3B 1WZ0A 5MPOA 1FPYA 1HTOA 1CK1A 2MJDA 2JUOA 4OW0A 3M95A 3EC8A 4F8CB 2E6XA 2XN9C 3N1YC 4C4VB 3RULA 4XE0A 1WSPA 1V8CA 4PS7A 3TUOA 1P7FA 5L83A 4P6VF 3LXFA 5CHVC 2WX0A 1UWXA 1FMAD 2FCSA 1IYFA 5FR6A 2IJ0A 4TQ1A 2KDFB 3PRPB 1MG4A 2B3AA 2M0XA 2QIEB 1C77A 2BT6A 4MH0E 2KTRB 2BKRB 3R7RA 1Q10A 2OHFA 3O13A 1V5TA 3T9LA 4DWFA 2IBIB 1WJNA 2HTHA 3EA6A 1E90A 2D3AA 1C79A 4BZAA 3M3JA 3V60A 3T8MA 1HZ5A 3UGBB 2V1YA 4WWMA 2KWVB 2WXLA 4RF0A 5JHBA 5C3JB 2JXXA 4MGZE 3I5JC 1SSNA 2EELA 3AE4B 2LHDA 4JWSC 2WXJA 1C4PA 1V5OA 2G3QB 3PHWB 2ZW1A 2B76B 1GJZA 4WQOB 4NNJB 3ONSA 3VHTC 2PVOD 3U2SC 3VUXA 4EZJA 1F2RC 5EE0A 4EUTA 4XGAB 2G1EA 3T3NA 4HRSA 2KMAA 5BMGA 2V0GA 2OEDA 2FCMA 1LO5D 2KTFA 1TS2A 2MW5A 4DK5A 4BKTA 1YQ3B 1WXQA 3SDLC 4GN1A 3J9CA 4EE2A 3EUB2 2L83A 3I63C 1E8ZA 2QJLA 1VJKA 1QQRA 2ICIA 3DOWA 4GMVA 1WWTA 4C4VA 2L00B 1T0RC 3B2GA 1FXTB 4NY0A 4XWTA 3RD2A 3K9PB 3EFCA 3HVDA 3P1MA 4PT5A 4IWQA 3RYTA 2DYBA 3ZO5B 1HE8A 3AE1B 3KLSX 4HPLB 4MACA 3ENEA 3MC0B 4KDLB 2VZKD 1WI0A 3QJZA 3ETRA 3VTWA 3ZNHB 1YX5B 2ZNVB 5LXHA 2MBOA 1XD3B 3U30A 4JLCA 1R7SA 2MJ3A 3IHPC 5GMVA 3ZNGC 3NVVA 4K3BA 4LJOB 4XYCA 1WX7A 2RPQA 1OEYA 4YXDB 3I3TB 1QOFA 2CHZA 2O2VB 3JVZX 3RN9C 1KLUD 2XEWA 3JW0X 3DPDA 3JSVA 4BBNF 2KJ6A 3V6EB 2UWQA 1F0ZA 3Q8CA 5LLIA 2N1WA 4M02A 4A3OA 1TKYA 3CWIA 3AI5A 3ML9A 3APFA 3O65B 1WYGA 1WGHA 3NY5A 5IN7A 5IO9A 2KX3A 3U52E 2KJHB 4FJVB 3BVZA 5CX3A 2BBCA 1I4XA 1SBBB 3QAQA 2OJWA 2K39A 3A1QB 1FFUA 1RLFA 5D3DA 4AOFA 3VH4B 4MSQB 4US8A 2JZZA 1N5WA 3TEXA 3B0AA 3DBLI 1BMLC 3DHIC 2KMCA 3L0WB 3DBRB 3BY4B 3WAMA 2N7EA 2WXHA 1TS3A 2Z0EB 3KYCD 1PGXA 1NYRA 1WXMA 1XCTL 2MX2A 2KOXA 3NZSA 1GB1A 3ZJTA 1V2YA 1VZ6A 3B08A 2HJ8A 4M8MA 3EHVA 2PEAA 2MRPA 4FJYA 2FIDA 2MEKA 3KWVA 3CSTA 3Q6BA 4LDTB 1WGGA 1V81A 2GBNA 1WXVA 3DQVA 2GRIA 1RRBA 1EF1A 2D07B 4LNIA 4KKJA 4PK1A 2W9NA 5JXVA 4MGKE 2K25A 2HTME 1Y56A 2JY6A 2K22A 2KWCA 1FRDA 3AE9B 4W9HA 3Q2AC 2SAKA 1V49A 4WJNA 1TY0A 1EU3A 4GDKA 4AJYB 3AE2B 3AULA 1PFDA 1AWDA 1GT8A 1WFYA 2KKCA 2WXKA 4KV2A 4WJQA 5EE9A 5IAAC 2KAJA 3A4SC 3N20C 2FIFA 1PUTA 3PGEA 4ACFA 3NZUA 1P1AA 1F52A 4W9LA 3MJ5A 3LDZE 2CJOA 3RMKC 1ZDXA 4E74A 4AWJA 3UIPB 1D3ZA 4XC2A 1QF6A 2EMSA 2KD0A 4WURA 1B9RA 3VRBB 2AL6A 1WMHA 1ZE3D 2RSUA 4GGQA 3T3OA 4QAYA 1C4CA 1ENFA 2D3BA 4ICVA 4IG7B 1V86A 3VTUA 2N9PC 1SJED 5D7GA 3RT3B 3WANA 4MELA 1SEBD 2KDMA 1XLNA 4HKQA 4L2YA 1A70A 2GOWA 2PJHA 1IGDA 3MC9A 5J17A 3DDCB 3OJ3A 3X0WA 3ALBA 3VQIA 2DZMA 3BINA 2REXA 2ZW0A 4US9A 4D2KA 4N59A 2YLMA 1H4RA 1T3QA 2KQ4X 2GBJA 2I2YA 1WR6E 5D2MB 2PW9A 3MJWA 4E3CA 1GNUA 4W9EA 2JYEA 5JHAA 3DBHI 3FAHA 1DGJA 1WGYA 4YTNB 4WJOA 4GOCA 5CHWA 4JX1C 3ECIA 2TSSA 4B0EA 2IO1B 2EKEC 4MH8A 1OQQA 3VUYA 5J18A 3BWUD 3AEDB 1XQQA 1XF5L 3L08A 2L0TA 1JWSD 4HJGE 4L23A 1FFVA 2WNMA 1PDXA 5TR5A 3ZVVA 1OQYA 1KH0A 1MVKA 1WMHB 4HEA1 4WAFA 4J3OD 4N6EB 2O6VA 2L7RA 2W3RA 2Y5BB 3QK0A 4GDLA 1JALA 1I4QA 1GTHA 3RPFC 3OAWA 2G45B 3KW5B 3DVGY 2MBQA 2LGYA 4H2AA 1T0QC 2LGSA 2KXJA 3I57A 3N1XC 3R2TA 4S17A 3RNCC 1T0SC 1VLBA 2OOBB 1C9FA 1J8CA 4DHZE 3L16A 4KIKB 3C0RB 4I6LB 5AZHA 3TEYA 2NPTA 1ZPSA 2RD0A 2BS4B 5H92C 5FR3A 4F1SA 5HKHA 1IBXB 2RPVA 2WU2B 2H89B 3U8ZA 5DPRA 3VRAB 1YMHE 3V61A 1T5XD 3SFDB 1G6JA 2JX5A 2V9HA 2GBRA 4EEWA 2JPHA 3AEAB 3NS1A 2KC1A 3HHMA 2K8HA 1IUEA 4RGTA 3UI3A 3ZDTA 3ZKJC 1D5MC 2JXTA 3E56A 3P4SB 1K50A 4WH4A 2BYFA 4KZ0A 1ZW7A 1M4VA 2ZPNA 1I4RA 4HK2A 2NS5A 1FNVA 2LUMA 3GE3C 4ITKA 5EE3A 1YN3A 1NYQA 4KGRA 2QMTA 4B0MA 2L8JA 1SIJA 2Y3AA 2NBUA 1YJIA 3C19A 1UELA 1AN8A 1MI0A 3BYYB 2BKFA 1TT5B 2AQ3B 2Z59B 2KJRA 1WZ3A 3N3KB 4LNFA 1TS5A 1XLPA 1KF6B 3DBSA 4YTPB 2KO3A 3A1QA 2VRRB 1AW7A 2HE7A 5HFYA 3AE8B 1Y8RC 3LB8C 1KLGD 1NEKB 2LGIA 2L1AA 1ZKHA 3IAS1 5T8IA 2DYOA 3SHQA 2N4FA 4IW0A 2MWSB 3HIZA 3V62A 4JGHB 1EU4A 2GMIC 2K6DB 4ZRQA 2DBYA 4DHZB 1Q5WB 2KLGA 2BB5A 3ZUNA 1WJ6A 4NAMA 5AEKB 3ZJVA 1UH6A 1J7CA 2ZCBA 5HHDG 2DENB 1SB3C 2N0SB 4LJPB 5IOIA 3P4RB 4DHJB 2K9XA 2LVQA 2DLBA 2WX1A 1FCLA 2PVGC 2KX0A 2ZVOA 2X8XX 1XXGA 1DOIA 2N9LA 4I6PA 3TIXA 3A9JB 4A9AA 4HPPA 3ZW3A 1DOXA 4WJPA 2NBWB 3UF8A 4FULA 2JYTA 2Q5WD 3ZXRA 4W9JA 3TL5A 4OZCA 4N58A 1E8YA 2A5UA 5BYRA 1MFWA 2D3CA 3N30A 3AN1A 3BYTB 4MGIE 2JSVX 2FCNA 2IGGA 3X23A 2CHWA 2LUEA 3Q3JA 2Z0DB 5AUKA 4ZRIA 3CIRB 2KDEB 3QARA 4KX6B 1NVID 4KVGB 2K3UA 3GE8C 3K9OB 3PHXB 5LNK1 2YVCA 2WXOA 2CS4A 1SGHA 3NHEB 1MG8A 1XLQA 4ARIA 2RR9A 2FAZA 4RCOA 2JWUA 2INNE 2Y5PA 3IT6B 2J52A 2INPE 4G3XB 1EWCA 2BYVE 3UQBA 2BS2B 2BGFA 3MC8A 3PLVA 4MSMB 1WJ4A 2DWQA 1I35A 1YN4A 2RGFA 2HDEA 3JYUA 3PLUA 5HI1A 5H8YE 4B9KA 2L3ZA 4OVVA 2KMMA 2LFIA 4DDID 5GXGB 3WAPA 1J0GA 2L05A 1FCCC 1OGWA 3UQAA 2PMVA 4PS8A 1SE2A 3A4RA 4XZ4A 1FM0D 1X1MA 1BT0A 3PS6A 2L52A 3CF4A 4EOYA 4MGYE 4HCNB 4RFBA 2VH2A 3R66C 2L0FA 3QIJA 3WAOA 3ZTCA 5AUIA 4NQKE 1GC6A 4UDUC 2OJRA 3Q8EA 2KDBA 4WIPA 2N7JA 2WDTB 3H6NA 3UINB 4NPNA 1R4MB 2MP2B 3RUIB 5JZEB 1VDVA 5HG2A 3W1SA 1KJTA 2C5LC 1J7AA 4FXCA 2KFKB 5DPSA 3KUDB 3Q8BA 2KTRA 3AM9A 3QQ8B 2LVOA 2RDBC 4DQOC 2KQSA 4EKUA 4IWOA 3WA0A 1YQBA 3DHGC 1KFYB 1UBIA 3PREA 2WYQA 2LEKA 3APDA 3RZFA 4ZYNA 2HD5B 1EF5A 4W9DA 1TKGA 4W9CA 3NVZA 4DXGA 4TQ0A 2WXFA 2MBHA 4W9FA 2IDYA 3RI7C 1V9JA 2KC2A 2WXPA 1ET6A 1SE9A 4RGNA 2BF8B 2BTEA 5KHQA 2IO2B 4HLEA 1U4AA 3NVYA 4N9F4 1QOGA 3ZJUA 3B1LX 1K52A 5EE1A 1VR9A 1EWYC 4XWWA 4I6NB 2GBMA 1F1HA 1XCQL 1FIQA 1NI3A 3AEEB 2ZZPB 3PVLA 2KWDA 5D3IB 4NZLB 4YWGG 3KH0A 4JQWC 3RNEC 2N9EB 3AU5A 3BVMA 3PZ8A 2H88B 2HJ1A 3DBLB 4IM3A 2X38A 2JRHA 2N9KA 1SXTA 5DCNA 1E9MA 4ZRJA 3RNFC 2D5GA 3DBRI 4OZAA 2PKOA 2AQ2B 4KDIC 2J0MA 3EGRA 4LTUA 5TSSA 4G50A 5G2NA 1V97A 3VAWA 3NZ3A 4Q2JA 2K8CA 1TS4A 3Q8AA 4FN2A 1LQBA 1F2RI 3Q14C 1EM7A 1L0XB 3ML8A 3R8BA 3GS2A 4G0NB 5BYSA 1JWMD 3N9YC 3IVFA 2DHZA 2NR2A 2RMMA 1L5PA 3EECA 2QEJC 3SEBA 1V6EA 2LHEA 3TJPA 3Q3NC 1P98A 2KHWB 2RDHA 4LNKA 4KGTA 3W5UB 3KYDD 3RZWC 1C78A 1UUPA 2LJ5A 3IBEA 3SR6A 1TZ1A 3DCGA 2JRIB 2R2QA 4GB9A 1ROEA 1D6EC 4M0WB 1J19A 3IT4B 3QHTA 3Q3FA 2ZPYA 2LASA 4NJ6A 2W3SA 4YSZB 3OG5A 2V4IB 4ZDVA 2LXCA 4HCPB 1QKZA 1V80A 3VH3B 4KSLC 4K3CA 1T0YA 4BBNC 5C2TB 3P4PB 3QWZB 2UU7A 2BQQA 4RGOS 4MJSB 4TKNA 2KVRA 1WGRA 1D5ZC 2K6QA 2PLPA 2XBBC 3PPAA 3H9DA 4GDKB 2WXMA 1I4GA 4HDQA 2I1KA 4KGSA 4HKZE 4XDCA 1NENB 1H7WA 3AEBB 2M4NA 4CYEA 1L2NA 4LDTD 1VD2A 4W9KA 1L0YB 2JT4B 1V1PB 4MM3B 4BFRA 2JU6X 2YEPB 1WH3A 1L4DB 1TGZB 2KN4A 2MH7A 1BUIC 3GZNI 5CHFA 4FJZA 1RWSA 4YL8A 2N1VA 4K1RB 4W9GA 4GDLB 3BZDB 3KWLA 3Q3OC 2DAFA 3Q69A 4ZHPA 1TJEA 2KFKA 3AE6B 2WDRB 4E71A 1F9JA 2K8BA 2MP2A 4HPMB 4ZYSA 4GSWA 2V3SA 1OFFA 4ARCA 3VTVA 4LCDE 4IWPA 3VUWA 2ONQA 2D2QA 2W55A 1GPXA 2KK8A 1J7BA 4FLHA 3V6CB 3LJ3A 4FHJA 1FD6A 1P7EA 4A3PA 3ZIMA 2IYDB 2LRWA 2LXAA 1I4PA 2E3TA 4WAAA 1ZOYB 3P42A 1RAXA 4P16A 2RDGA 1WM3A 4C7ZA 3NS8A 5AZFA 2AX5A 4OHJA 1FO4A 1N5XA 5D94A 2WQYB 1CJEA 1AYFA 3D32A 4WWPA 1TZOA 4NAWB 1R4NB 1VRAB 4FADA 2NMQA 5BYQA 4AJWA 3DHHC 4TUUA 4F7ZA 4BOZB 1TY2A 4M01A 3CF6E 4HJKA 4DBGA 2BYEA 2VZKB 2FUHB 3L4PA 4BVUC 1V1PA 3N1ZC 2PE6B 2WGSA 3CMMB 4IM2A 1JRUA 2IGHA 1KOTA 1PGAA 2W54A 2DAJA 4J6IA 2DZIA 2M0AA 2WHIA 1NDDA 4RNAA 1LXDA 3VR9B 1KLVA 2J53A 2FCQA 3ZDMC 3W9CB 3SFEB 3WIMA 2PIAA 2C7HA 2LI5A 1ESFA 2IO0B 2G9HD 2NCNA 1C3TA 1ZGUB 4RM8A 1L0VB 3PV1A 4GU2A 4X57B 1JROA 2QHOA 1FXIA 4ASWC 1P3QU 2CKHB 3DVNV 2W82A 1PGBA 1QZEA 2BWFA 3L13A 3RFZB 3NUHB 4IC7B 1B1ZA 1TKEA 2ZJDA 4KKIA 4RGMA 4C00A 3A9JA 2LRUA 3C8YA 4PS3A 4JIOU 2D3GA 5AZGA 1XT9B 4IKGA 3OWEB 4GIVA 2ON8A 4TV3A 3I9V1 3W1YA 2ASQA 3H1UA 1OEYJ 5G55A 3TMPB 1WRDB 5FKAC 4P1BC 3KUCB 4AUQC 5E6JA 4PYZA 3AV8A 3GP7A 3ZYYX 2GI9A 2GB1A 1S1QB 3HK0A 5EDSA 3PTFC 4BKSA 3E9SA 2AQ1B 1IGCA 1R4MI 1SE3A 3VDZA 4A90A 3HVZA 2BB6A 1C4AA 3KQ4A 4MT5A 1E5WA 4MM3A 2NBVB 3ZRFA 1LFDA 2M19A 2MJEA 2WU5B 5G5HA 1E7VA 2CR5A 2D11A 1H7XA 2M1MA 5D6JB 4RH6A 5IKCM 1MJDA 4C56C 3DWGC 4ANUA 4ANVA 1KM7A 2WWZA 3AECB 1TIFA 2L76A 3QCAA 5E6OA 3MHSD 4DXFA 2GLSA 3AXCA 3RNBC 3IAM1 3HRDD 2WDQB 5E6NA 2KFJA 1CQVA 3ZQ4A 3W5VB 3U7DA 2INDC 1KTKA 2V3NA 4II3B 4BAXA 1N60A 3RNGC 2WLBA 2CU3A 2FUG1 2NTSA 4ANWA 1GC7A 1ZDVA 1ZXHA 2KACA 1UD7A 4YT0B 4NJCA 5KHOA 2J0KA 4A8XC 3L54A 3BVGA 2QILA 4IDIA 2FE8A 1CMXB 3FKYA 2GBKA 2DX5B 2LZ6A 3R7QA 1E8WA 2AL3A 3VFKA 1V1OA 2UYZB 2V3PA 4FA6A 1IBXA 4EZKA 4EZLA 1WXSA 5BO4B 4CHKA 4CQNA 1QOAA 4O1NA 1FXAA 1UZXB 2IZVB 3GOEA 4AS1A 3AH7A 4C80A 1E8XA 3BK2A 2G4DB 4L1BA 1SIFA 3IG3A 2G4SA 4NQLB 1YQ4B 2KYWA 3LYYA 4CO7A 3FILA 2J42A 1IP9A 2VH1A 2BYTA 3ZXVA 1XLOA 2PE9A 5FK9C 1UF0A 3QX1A 4REZA 1C76A 1RM6C 2PTLA 3L10B 3AB5A 2J7QB 4DHJD 3CSFA 2R61A 2O2VA 1STEA 3M62B 1N6ZA 5J2RA 4TMAB 1GOZA 1GAQB 1WGDA 3PZDA 3KUZA 3TEZA 1ZUD2 3APCA 1VCBA 3NJTA 1GTEA 3ZRCA 1UGJA 4M8NA 1Q0WB 1P0RA 4M0WA 5BMHA 2QC8A 1YJJA 1I7HA 2J4XA 1JCKB 2XNAC 4JPSA 2ZCCA 2LGDA 2CHXA 2M17A 3Q3MC 1L7YA 3L17A 3PRMB 3MTNB 1N61A 4K7SA 1M94A 4K7UA 3VR8B 5L95C 4JWUC 4AP4C 4JL9A 1F77A 1OTRB 4XX5A 5LXIB 2JF5A 1TYGB
chains in the Genus database with same CATH topology
4WH4A 1UWMA 1M4VA 1I4RA 1FNVA 3W2DA 2LUMA 2PVOD 3U2SC 5C2TB 1JWUD 3P4PB 4ITKA 5EE3A 1YN3A 1NYQA 4KGRA 1F2RC 5EE0A 1JWAD 1E10A 2QMTA 2JZPA 1OQRA 2G1EA 4RGOS 3T3NA 4HRSA 3NVWA 2Y3AA 1SIJA 5BMGA 4B0MA 2V0GA 1YJIA 3AEGB 1D5ZC 1K51A 2PLPA 2OEDA 1LO5D 1TS2A 1VZ8A 1AN8A 1MI0A 2WXMA 4GDKB 1YQ3B 2CJNA 1I4GA 1WXQA 1RFKA 4KGSA 3J9CA 4HKZE 4EE2A 3BK1A 3BYYB 3EUB2 1JRPA 2L83A 2AQ3B 4XDCA 2QJLA 1NENB 1VJKA 1H7WA 1TS5A 1L6VA 3AEBB 1KF6B 1XLPA 1QQRA 2ICIA 4YTPB 1ET9A 2ACZB 1DOYA 1WWTA 1XEEA 1L0YB 4JE3B 1SJHD 3B2GA 1AW7A 4A6QA 1FNUA 5HFYA 3AE8B 3LB8C 1V1PB 4MM3B 1KLGD 1NEKB 2LGIA 2JU6X 2YEPB 2L1AA 3IAS1 4XWTA 5T8IA 1K53A 1L4DB 1MHHE 2DYOA 1ACCA 2KN4A 2MH7A 1BUIC 1EU4A 3HUIA 2Z8LA 3HVDA 3FC4A 3P1MA 4PT5A 1RWSA 2DBYA 4ZRQA 2M56B 2BB5A 4GDLB 3AE1B 3KLSX 3BZDB 3KWLA 2BW2A 4MACA 3Q69A 4ZHPA 3V05A 1TJEA 4NAMA 3MC0B 2WXQA 3AE6B 2WDRB 3ZJVA 1J7CA 1KRHA 2VZKD 5HHDG 1SB3C 2N0SB 3ETRA 3P4RB 2K9XA 4C7YA 4ZYSA 1OFFA 4GLSC 4ARCA 2DLBA 3DWMA 3Q8FA 1FCLA 3B2FA 2PVGC 1R7SA 1XXGA 2MJ3A 2ONQA 1ZXIA 1DOIA 2W55A 1GPXA 2N9LA 4R3DA 1J7BA 4A9AA 1QILA 1DOXA 3NVVA 1HZ6A 4OVZA 4LLGM 3WCQA 1FD6A 1I4HA 2JYTA 2Q5WD 2K0PA 1P7EA 4YXDB 3AE7B 1QOFA 4OZCA 4N58A 1I4PA 1N62A 5BYRA 2E3TA 3BIID 3TSSA 1ZOYB 2L32A 1KLUD 3P42A 3AN1A 3BYTB 1HA5A 1F0ZA 3Q8CA 2JSVX 3V3XA 4OZBA 4P16A 4XDDA 2RDGA 1D4BA 4C7ZA 1TKYA 3CWIA 3AEFB 3AE5B 2IGGA 2AX5A 4OHJA 1WYGA 1FO4A 1N5XA 1YNTE 2WQYB 1CJEA 1AYFA 2EKIA 1TZOA 4NAWB 4A55A 3U52E 4AQ7A 3NRZA 3BVZA 5AUKA 2BBCA 3CIRB 1I4XA 2YEPF 4KX6B 1SBBB 1VRAB 1NVID 2NMQA 3B9JA 1FFUA 5D3DA 5BYQA 2K3UA 2WS3B 4US8A 2WXRA 1MHXA 1E7PB 5LNK1 1N5WA 1TY2A 2WXOA 1FNWA 3TEXA 3FILB 2WXIA 1XLQA 1BMLC 4ARIA 2VZKB 4RCOA 2WP9B 2JWUA 2INNE 3L4PA 2Y5PA 3IT6B 2WXHA 1TS3A 2J52A 1PGXA 1V1PA 1NYRA 2INPE 4IOIE 1XCTL 1EWCA 1GB1A 4ZOHC 3ZJTA 2QSDA 2BS2B 1VZ6A 3IXSA 2DWQA 1YN4A 2IGHA 3MP9A 2HDEA 2MEKA 5HI1A 3KWVA 2WDVB 5H8YE 1PGAA 5BMIA 5G5GA 2W54A 4YSYB 1QOBA 1WRIA 2KMMA 3P63A 2GRIA 2LFIA 2M0AA 1JWBD 4KKJA 1QLBB 2FBWB 3VR9B 2I38A 4RNAA 2J53A 5GXGB 3W9CB 5JXVA 3SFEB 2PIAA 1ESFA 1FCCC 2HTME 5I4DA 1ZP0B 1Y56A 2G9HD 1HXYD 2PMVA 2K22A 1QT9A 1L0VB 1SE2A 1CZPA 2WXGA 1JROA 1FRDA 3AE9B 1L4ZB 3U4EG 1D5XC 1FM0D 1FXIA 2L52A 3CF4A 3R2IA 2SAKA 2W82A 1PGBA 4RFBA 1GB4A 1WGKA 3RFZB 3NUHB 1DYQA 1T6BX 3MFGA 1B1ZA 1TKEA 1TY0A 1EU3A 4KKIA 4RGMA 3AE2B 4TSSA 1E0ZA 5AUIA 3C8YA 3PO0A 1PFDA 4UDUC 3Q8EA 3GB1A 1AWDA 1HQRD 2DYMA 1GT8A 2WXKA 4IKGA 4WIPA 2N7JA 4USAA 3OWEB 1BXTA 5EE9A 2ON8A 2KAJA 3I9V1 1VDVA 1SF0A 5HG2A 1L6UA 3W1SA 1PUTA 5FKAC 1FEHA 5E6JA 1J7AA 3AV8A 3MJ5A 4FXCA 2CJOA 3U7ZA 1ZDXA 3GP7A 3ZYYX 2NTTA 3Q8BA 3AM9A 2GI9A 2GB1A 2LJIA 2SEBD 3E9SA 2AQ1B 1IGCA 4DQOC 4WQMA 1QF6A 1PYWD 1XO3A 2JQRB 4WURA 1SE3A 4A90A 3ZGZA 1B9RA 3HVZA 3VRBB 1ZE3D 2BB6A 3AMZA 1C4AA 2IPKD 3KQ4A 4MT5A 1C4CA 3T3OA 1YN5A 1ENFA 1KFYB 1N63A 2M19A 2MJEA 2WU5B 5G5HA 2LEKA 1SJED 5D7GA 1JW9D 3P4QB 4YTMB 1E6EB 1H7XA 2Y5CA 1SEBD 4RH6A 1TKGA 2KDMA 1XLNA 3NVZA 4DXGA 4HKQA 1JMLA 4L2YA 1A70A 4C56C 3DWGC 4TQ0A 1IGDA 3TEWA 2WXFA 2IGDA 2BS3B 2IDYA 3AECB 3H8HA 1VZ7A 2WXPA 1ET6A 4DXFA 4RGNA 3VQIA 3URYA 2K5PA 3PZ7A 1HEZE 1RYJA 2BTEA 3IAM1 3HRDD 2WDQB 2ZW0A 4US9A 4D2KA 3NVYA 4ZHOA 1CQVA 4N59A 3ZQ4A 1QOGA 3W5VB 3ZJUA 1KTKA 1T3QA 2V3NA 1N60A 2KQ4X 1K52A 2I2YA 5EE1A 2WLBA 2PW9A 1VR9A 2CU3A 2FUG1 1EWYC 2LMCA 2NTSA 1ZDVA 1ZXHA 4XWWA 2KACA 1XCQL 3MHZA 4YT0B 2JYEA 3ABVB 4NJCA 3FAHA 1DGJA 4YTNB 1FIQA 4A8XC 1NI3A 3AEEB 4JX1C 2KWDA 1MPEA 3BVGA 5D3IB 1JQ4A 1UNSA 2QILA 2TSSA 4IDIA 4NZLB 2FE8A 4YWGG 1SE4A 4B0EA 1FRRA 4MH8A 1OQQA 3BWUD 3BVMA 4HROA 3AEDB 1XF5L 3PZ8A 4LK0M 2H88B 2X38A 1V1OA 4YSXB 2N9KA 1JWSD 1SXTA 2V3PA 4HJGE 1IBXA 1E9MA 4L23A 2WXNA 2D5GA 1FFVA 2WNMA 4OZAA 4CQNA 1QOAA 4RF1A 4O1NA 1PDXA 1FXAA 4ZRPA 2PKOA 2AQ2B 3AE3B 1KH0A 5MPOA 4AS1A 3EGRA 1MVKA 1CK1A 3AH7A 4LTUA 2MJDA 4HEA1 4WAFA 4OW0A 5TSSA 4J3OD 3BK2A 4L1BA 4N6EB 1V97A 3NZ3A 1YQ4B 2E6XA 3LYYA 4Q2JA 2XN9C 3FILA 2J42A 1TS4A 3Q8AA 1F2RI 2W3RA 2BYTA 4XE0A 1WSPA 1JALA 1I4QA 1GTHA 1V8CA 1EM7A 1XLOA 1L0XB 3R8BA 3RPFC 3GS2A 5BYSA 5FK9C 3TUOA 1JWMD 3N9YC 1P7FA 1C76A 1RM6C 2PTLA 4REZA 4H2AA 3AB5A 2RMMA 3I57A 3R2TA 4P6VF 1L5PA 3LXFA 2R61A 2QEJC 1UWXA 3SEBA 1FMAD 2IJ0A 1VLBA 4TQ1A 1STEA 2LHEA 1C9FA 2QIEB 1C77A 2BT6A 4TMAB 1GOZA 1GAQB 2RDHA 4KGTA 3W5UB 1Q10A 2OHFA 3O13A 3TEZA 1ZUD2 3TEYA 1GTEA 1C78A 1UGJA 1UUPA 1ZPSA 5BMHA 4M0WA 3EA6A 3SR6A 2BS4B 5H92C 5FR3A 1YJJA 1I7HA 2J4XA 1IBXB 1JCKB 2RPVA 1C79A 2XNAC 2WU2B 2H89B 3VRAB 1YMHE 1ROEA 1D6EC 4JPSA 3IT4B 1HZ5A 4C80A 1T5XD 3SFDB 4WWMA 2JX5A 2WXLA 4RF0A 3AEAB 3NS1A 5C3JB 1N61A 3VR8B 1IUEA 4RGTA 3UI3A 4JWUC 1SSNA 2EELA 1D5MC 2W3SA 4YSZB 2JXTA 3AE4B 2LHDA 2V4IB 4JWSC 1F77A 2WXJA 1C4PA 3E56A 1QKZA 2ZW1A 2B76B 3P4SB 1K50A 1TYGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI3 A;  3AN1 A;  1TKE A;  1UWM A;  3AEE B;  4JX1 C;  3AE2 B;  1E0Z A;  1JQ4 A;  2PVO D;  5C2T B;  4IDI A;  1F0Z A;  5AUI A;  3P4P B;  1FRR A;  1PFD A;  3PO0 A;  4ITK A;  1OQQ A;  5EE3 A;  1NYQ A;  1AWD A;  4HRO A;  5EE0 A;  1JWA D;  4C7Z A;  1GT8 A;  3AED B;  1TKY A;  1E10 A;  1OQR A;  2G1E A;  3CWI A;  2H88 B;  3AEF B;  4HRS A;  4USA A;  3AE5 B;  3NVW A;  1SIJ A;  2AX5 A;  1WYG A;  1FO4 A;  1N5X A;  4YSX B;  1YJI A;  5EE9 A;  2WQY B;  3AEG B;  1CJE A;  1AYF A;  2KAJ A;  1E9M A;  2EKI A;  1VDV A;  1SF0 A;  1FFV A;  1QOA A;  1PDX A;  1FXA A;  1L6U A;  3NRZ A;  2PKO A;  1PUT A;  1YQ3 B;  3AE3 B;  2CJN A;  5AUK A;  1WXQ A;  1RFK A;  3CIR B;  5MPO A;  3AH7 A;  4KX6 B;  2MJD A;  4LTU A;  1NVI D;  1JRP A;  3EUB 2;  1J7A A;  2L83 A;  3AV8 A;  3B9J A;  4N6E B;  1FFU A;  1V97 A;  2QJL A;  4FXC A;  1NEN B;  1VJK A;  2CJO A;  1H7W A;  1YQ4 B;  1L6V A;  3ZYY X;  2WS3 B;  1KF6 B;  3AEB B;  1XLP A;  3AM9 A;  4US8 A;  1E7P B;  4YTP B;  1N5W A;  2ACZ B;  2W3R A;  1DOY A;  1JAL A;  1WWT A;  1GTH A;  1V8C A;  1XLO A;  3RPF C;  4WQM A;  1QF6 A;  1XLQ A;  1XO3 A;  3B2G A;  2JQR B;  1RM6 C;  2WP9 B;  1B9R A;  3HVZ A;  3VRB B;  3AE8 B;  3LB8 C;  1NEK B;  3L4P A;  3AB5 A;  3AMZ A;  4P6V F;  1L5P A;  3LXF A;  1NYR A;  2MH7 A;  1FMA D;  1KFY B;  1N63 A;  3HUI A;  1VLB A;  2M19 A;  3FC4 A;  2MJE A;  3P1M A;  2WU5 B;  1RWS A;  2DBY A;  4ZOH C;  5G5H A;  2LEK A;  2M56 B;  2BS2 B;  2QIE B;  1JW9 D;  3P4Q B;  3AE1 B;  4YTM B;  1E6E B;  2BT6 A;  3KWL A;  1H7X A;  2Y5C A;  1GAQ B;  1TKG A;  2DWQ A;  4ZHP A;  1XLN A;  3NVZ A;  3W5U B;  1TJE A;  2OHF A;  1A70 A;  3DWG C;  2WDV B;  3AE6 B;  1ZUD 2;  5H8Y E;  5G5G A;  1GTE A;  2WDR B;  2W54 A;  1J7C A;  1KRH A;  4YSY B;  1QOB A;  1WRI A;  2BS3 B;  1SB3 C;  3AEC B;  2N0S B;  3ETR A;  3SR6 A;  2BS4 B;  2KMM A;  3P63 A;  5H92 C;  3P4R B;  1I7H A;  1YJJ A;  2K9X A;  2WU2 B;  1JWB D;  2H89 B;  4C7Y A;  1QLB B;  2FBW B;  3VR9 B;  2K5P A;  3VRA B;  1RYJ A;  1ROE A;  1OFF A;  3HRD D;  2WDQ B;  3DWM A;  4US9 A;  5GXG B;  3B2F A;  3SFE B;  2PVG C;  3NVY A;  2PIA A;  1R7S A;  3W9C B;  3SFD B;  4N59 A;  4C80 A;  4ZHO A;  2MJ3 A;  4WWM A;  1QOG A;  3W5V B;  1ZXI A;  1DOI A;  2HTM E;  2JX5 A;  2W55 A;  1GPX A;  1ZP0 B;  1J7B A;  4A9A A;  1T3Q A;  1DOX A;  2K22 A;  1N60 A;  3NVV A;  3AEA B;  1QT9 A;  1L0V B;  5C3J B;  1N61 A;  3NS1 A;  1CZP A;  5EE1 A;  3WCQ A;  1JRO A;  2Q5W D;  1FRD A;  3VR8 B;  1IUE A;  3AE9 B;  2WLB A;  1FXI A;  1FM0 D;  2CU3 A;  1EWY C;  4YXD B;  4JWU C;  3AE7 B;  2W3S A;  4YSZ B;  3CF4 A;  1QOF A;  3AE4 B;  2L52 A;  4N58 A;  1N62 A;  4JWS C;  4YT0 B;  3ABV B;  3FAH A;  2E3T A;  3BII D;  1ZOY B;  1DGJ A;  4YTN B;  2B76 B;  1WGK A;  1FIQ A;  3P4S B;  1TYG B; 
#chains in the Genus database with same CATH topology
 1UWM A;  4LNO A;  3W2D A;  2LWP A;  1JWU D;  4K7W A;  4IUM B;  4FHK A;  1GG3 A;  1JWA D;  1E10 A;  2JZP A;  1OQR A;  3PT2 B;  2C60 A;  3NVW A;  2V4L A;  2O6V B;  4BKG A;  3AEG B;  1K51 A;  2MCN B;  1Z5S B;  2QCZ A;  1YD8 U;  3H7P B;  2NPT B;  1VZ8 A;  2NVU I;  2JZ3 B;  1E7U A;  1WY8 A;  2CJN A;  1RFK A;  2MLB A;  3BK1 A;  1JRP A;  3SU8 X;  1L6V A;  3WAL A;  1ET9 A;  2ACZ B;  1DOY A;  1XEE A;  2AEH A;  4JE3 B;  2IY0 B;  1SJH D;  3IFW B;  4PYU A;  4A6Q A;  1FNU A;  3TBL D;  2DNF A;  1GUA B;  3EFU A;  1K53 A;  1MHH E;  2KLC A;  1ACC A;  4NAW A;  2J0J A;  3HUI A;  4WWN A;  2Z8L A;  3FC4 A;  2M56 B;  2IO3 B;  1LGR A;  1UBQ A;  2BW2 A;  4GXB A;  1A5R A;  3V05 A;  2AYO B;  2WXQ A;  1WJU A;  2O6V D;  1KRH A;  1WM2 A;  1WIA A;  2EMT A;  4C7Y A;  1IPG A;  1YIW A;  3GZN B;  4GLS C;  2KZR A;  3P2B A;  3DWM A;  3Q8F A;  3B2F A;  2IY1 B;  4MJS A;  1ZXI A;  4B95 A;  2CU1 A;  3DVG X;  4R3D A;  1QIL A;  2D10 A;  1HZ6 A;  4OVZ A;  4LLG M;  3OJ4 B;  3WCQ A;  1I4H A;  2K0P A;  1UGM A;  3AE7 B;  1WR1 A;  1N62 A;  2K1F A;  2LGX A;  3BII D;  2C7M B;  3TSS A;  2L32 A;  4ANX A;  1WE6 A;  1HA5 A;  3ZLZ A;  2DZJ A;  3V3X A;  4OZB A;  1D4B A;  4XDD A;  1NBF C;  2KVZ A;  1YOV B;  3N32 A;  3ZNZ B;  3AEF B;  2PPH A;  3AE5 B;  4FBJ B;  1YNT E;  4LNN A;  3S2A A;  2EKI A;  2FNJ B;  4A55 A;  3HM6 X;  4DXA B;  3DBH B;  4AQ7 A;  3NRZ A;  1EO6 A;  3R3M A;  3RNA C;  2YEP F;  4W9I A;  4ZRK A;  4P7I A;  3B9J A;  2KNB A;  4URK A;  2WS3 B;  2BVC A;  1Q1O A;  2WXR A;  1MHX A;  1E7P B;  2KWU B;  3H7S A;  1FNW A;  3FIL B;  2BPS A;  2WXI A;  2WP9 B;  4HWI B;  5C23 A;  3PRZ A;  3SD5 A;  1R4N I;  4IOI E;  2ZNV C;  4ZOH C;  2QSD A;  2INC C;  2QDF A;  4B6W A;  1I42 A;  3IXS A;  4BKS D;  3MP9 A;  4NJ7 A;  2WDV B;  5BMI A;  2KQ7 A;  5G5G A;  4KZC A;  4YSY B;  1QOB A;  1WRI A;  1YX6 B;  1WX9 A;  3JSV B;  3P63 A;  4IM0 A;  5IA7 A;  4MDK E;  1JWB D;  2MQJ A;  1QLB B;  2FBW B;  2I38 A;  3VVW B;  1S3S G;  3A9K B;  5DPW A;  4K81 A;  3W1S C;  5I4D A;  1AAR A;  2JWZ A;  1ZP0 B;  1NI2 A;  4S0R A;  3ZNI D;  1HXY D;  4P1C C;  1QT9 A;  5E6P A;  3PSE B;  1CZP A;  2WXG A;  1L4Z B;  3U4E G;  1D5X C;  3R2I A;  3DVN U;  3ZTD A;  2KN5 A;  2N9X A;  1GB4 A;  1WGK A;  1DYQ A;  1T6B X;  3MFG A;  4G11 A;  2MBB B;  4HVB A;  3H7P A;  4KSK C;  1Z2M A;  4TSS A;  1E0Z A;  2R2O A;  4HXD A;  3PO0 A;  3GB1 A;  1HQR D;  2DYM A;  3QA8 A;  4RMA A;  4USA A;  1BXT A;  5DPT A;  2I1J A;  2MBE A;  3NOB A;  2XK5 B;  1TBE A;  1SF0 A;  1L6U A;  2LVP A;  1FEH A;  3M63 B;  1YJ1 A;  4OVU A;  4HDO A;  3U7Z A;  2NTT A;  3A9K A;  2MA9 B;  2LJI A;  2KAN A;  2SEB D;  4ICU A;  1P9D U;  1WXA A;  4WQM A;  1PYW D;  1WE7 A;  1XO3 A;  2JQR B;  1WYW B;  2MHJ A;  3ZGZ A;  2BWE S;  4EFO A;  3UIO B;  2LD9 A;  3AMZ A;  2IPK D;  2KT7 A;  2XK5 A;  2A4Z A;  3QC8 B;  1YN5 A;  2C9W B;  5IP4 D;  3OLM D;  1N63 A;  4WWO A;  1EUV B;  1JW9 D;  3P4Q B;  4YTM B;  1E6E B;  2ZVN A;  2Y5C A;  2DZK A;  1WX8 A;  1H8C A;  2M8S A;  1JML A;  3TEW A;  2IGD A;  2BS3 B;  3H8H A;  1VZ7 A;  3RCZ A;  3A33 B;  4BOS C;  3URY A;  2K5P A;  3PZ7 A;  4II2 B;  1HEZ E;  1PQS A;  1RYJ A;  5CTR C;  4ZHO A;  4RM9 A;  1RFA A;  3AU4 A;  5JH5 C;  4KIK A;  1TTN A;  2LMC A;  3VXW A;  5C1Z A;  2MSE D;  2JVC A;  3MHZ A;  3ABV B;  4A20 A;  4M00 A;  1HTQ A;  2C7N B;  1WF9 A;  1MPE A;  1JQ4 A;  1UNS A;  4DDG D;  2ZEQ A;  3HM3 A;  1SE4 A;  1FRR A;  3KVF B;  2AWT A;  3NG0 A;  4HRO A;  3TCA A;  2KDI A;  1K8R B;  4LK0 M;  1C1Y B;  1ISN A;  4YSX B;  2WXN A;  1LM8 B;  4MEM A;  4RF1 A;  2N7D A;  4ZRP A;  3AE3 B;  1WZ0 A;  5MPO A;  1FPY A;  1HTO A;  1CK1 A;  2MJD A;  2JUO A;  4OW0 A;  3M95 A;  3EC8 A;  4F8C B;  2E6X A;  2XN9 C;  3N1Y C;  4C4V B;  3RUL A;  4XE0 A;  1WSP A;  1V8C A;  4PS7 A;  3TUO A;  1P7F A;  5L83 A;  4P6V F;  3LXF A;  5CHV C;  2WX0 A;  1UWX A;  1FMA D;  2FCS A;  1IYF A;  5FR6 A;  2IJ0 A;  4TQ1 A;  2KDF B;  3PRP B;  1MG4 A;  2B3A A;  2M0X A;  2QIE B;  1C77 A;  2BT6 A;  4MH0 E;  2KTR B;  2BKR B;  3R7R A;  1Q10 A;  2OHF A;  3O13 A;  1V5T A;  3T9L A;  4DWF A;  2IBI B;  1WJN A;  2HTH A;  3EA6 A;  1E90 A;  2D3A A;  1C79 A;  4BZA A;  3M3J A;  3V60 A;  3T8M A;  1HZ5 A;  3UGB B;  2V1Y A;  4WWM A;  2KWV B;  2WXL A;  4RF0 A;  5JHB A;  5C3J B;  2JXX A;  4MGZ E;  3I5J C;  1SSN A;  2EEL A;  3AE4 B;  2LHD A;  4JWS C;  2WXJ A;  1C4P A;  1V5O A;  2G3Q B;  3PHW B;  2ZW1 A;  2B76 B;  1GJZ A;  4WQO B;  4NNJ B;  3ONS A;  3VHT C;  2PVO D;  3U2S C;  3VUX A;  4EZJ A;  1F2R C;  5EE0 A;  4EUT A;  4XGA B;  2G1E A;  3T3N A;  4HRS A;  2KMA A;  5BMG A;  2V0G A;  2OED A;  2FCM A;  1LO5 D;  2KTF A;  1TS2 A;  2MW5 A;  4DK5 A;  4BKT A;  1YQ3 B;  1WXQ A;  3SDL C;  4GN1 A;  3J9C A;  4EE2 A;  3EUB 2;  2L83 A;  3I63 C;  1E8Z A;  2QJL A;  1VJK A;  1QQR A;  2ICI A;  3DOW A;  4GMV A;  1WWT A;  4C4V A;  2L00 B;  1T0R C;  3B2G A;  1FXT B;  4NY0 A;  4XWT A;  3RD2 A;  3K9P B;  3EFC A;  3HVD A;  3P1M A;  4PT5 A;  4IWQ A;  3RYT A;  2DYB A;  3ZO5 B;  1HE8 A;  3AE1 B;  3KLS X;  4HPL B;  4MAC A;  3ENE A;  3MC0 B;  4KDL B;  2VZK D;  1WI0 A;  3QJZ A;  3ETR A;  3VTW A;  3ZNH B;  1YX5 B;  2ZNV B;  5LXH A;  2MBO A;  1XD3 B;  3U30 A;  4JLC A;  1R7S A;  2MJ3 A;  3IHP C;  5GMV A;  3ZNG C;  3NVV A;  4K3B A;  4LJO B;  4XYC A;  1WX7 A;  2RPQ A;  1OEY A;  4YXD B;  3I3T B;  1QOF A;  2CHZ A;  2O2V B;  3JVZ X;  3RN9 C;  1KLU D;  2XEW A;  3JW0 X;  3DPD A;  3JSV A;  4BBN F;  2KJ6 A;  3V6E B;  2UWQ A;  1F0Z A;  3Q8C A;  5LLI A;  2N1W A;  4M02 A;  4A3O A;  1TKY A;  3CWI A;  3AI5 A;  3ML9 A;  3APF A;  3O65 B;  1WYG A;  1WGH A;  3NY5 A;  5IN7 A;  5IO9 A;  2KX3 A;  3U52 E;  2KJH B;  4FJV B;  3BVZ A;  5CX3 A;  2BBC A;  1I4X A;  1SBB B;  3QAQ A;  2OJW A;  2K39 A;  3A1Q B;  1FFU A;  1RLF A;  5D3D A;  4AOF A;  3VH4 B;  4MSQ B;  4US8 A;  2JZZ A;  1N5W A;  3TEX A;  3B0A A;  3DBL I;  1BML C;  3DHI C;  2KMC A;  3L0W B;  3DBR B;  3BY4 B;  3WAM A;  2N7E A;  2WXH A;  1TS3 A;  2Z0E B;  3KYC D;  1PGX A;  1NYR A;  1WXM A;  1XCT L;  2MX2 A;  2KOX A;  3NZS A;  1GB1 A;  3ZJT A;  1V2Y A;  1VZ6 A;  3B08 A;  2HJ8 A;  4M8M A;  3EHV A;  2PEA A;  2MRP A;  4FJY A;  2FID A;  2MEK A;  3KWV A;  3CST A;  3Q6B A;  4LDT B;  1WGG A;  1V81 A;  2GBN A;  1WXV A;  3DQV A;  2GRI A;  1RRB A;  1EF1 A;  2D07 B;  4LNI A;  4KKJ A;  4PK1 A;  2W9N A;  5JXV A;  4MGK E;  2K25 A;  2HTM E;  1Y56 A;  2JY6 A;  2K22 A;  2KWC A;  1FRD A;  3AE9 B;  4W9H A;  3Q2A C;  2SAK A;  1V49 A;  4WJN A;  1TY0 A;  1EU3 A;  4GDK A;  4AJY B;  3AE2 B;  3AUL A;  1PFD A;  1AWD A;  1GT8 A;  1WFY A;  2KKC A;  2WXK A;  4KV2 A;  4WJQ A;  5EE9 A;  5IAA C;  2KAJ A;  3A4S C;  3N20 C;  2FIF A;  1PUT A;  3PGE A;  4ACF A;  3NZU A;  1P1A A;  1F52 A;  4W9L A;  3MJ5 A;  3LDZ E;  2CJO A;  3RMK C;  1ZDX A;  4E74 A;  4AWJ A;  3UIP B;  1D3Z A;  4XC2 A;  1QF6 A;  2EMS A;  2KD0 A;  4WUR A;  1B9R A;  3VRB B;  2AL6 A;  1WMH A;  1ZE3 D;  2RSU A;  4GGQ A;  3T3O A;  4QAY A;  1C4C A;  1ENF A;  2D3B A;  4ICV A;  4IG7 B;  1V86 A;  3VTU A;  2N9P C;  1SJE D;  5D7G A;  3RT3 B;  3WAN A;  4MEL A;  1SEB D;  2KDM A;  1XLN A;  4HKQ A;  4L2Y A;  1A70 A;  2GOW A;  2PJH A;  1IGD A;  3MC9 A;  5J17 A;  3DDC B;  3OJ3 A;  3X0W A;  3ALB A;  3VQI A;  2DZM A;  3BIN A;  2REX A;  2ZW0 A;  4US9 A;  4D2K A;  4N59 A;  2YLM A;  1H4R A;  1T3Q A;  2KQ4 X;  2GBJ A;  2I2Y A;  1WR6 E;  5D2M B;  2PW9 A;  3MJW A;  4E3C A;  1GNU A;  4W9E A;  2JYE A;  5JHA A;  3DBH I;  3FAH A;  1DGJ A;  1WGY A;  4YTN B;  4WJO A;  4GOC A;  5CHW A;  4JX1 C;  3ECI A;  2TSS A;  4B0E A;  2IO1 B;  2EKE C;  4MH8 A;  1OQQ A;  3VUY A;  5J18 A;  3BWU D;  3AED B;  1XQQ A;  1XF5 L;  3L08 A;  2L0T A;  1JWS D;  4HJG E;  4L23 A;  1FFV A;  2WNM A;  1PDX A;  5TR5 A;  3ZVV A;  1OQY A;  1KH0 A;  1MVK A;  1WMH B;  4HEA 1;  4WAF A;  4J3O D;  4N6E B;  2O6V A;  2L7R A;  2W3R A;  2Y5B B;  3QK0 A;  4GDL A;  1JAL A;  1I4Q A;  1GTH A;  3RPF C;  3OAW A;  2G45 B;  3KW5 B;  3DVG Y;  2MBQ A;  2LGY A;  4H2A A;  1T0Q C;  2LGS A;  2KXJ A;  3I57 A;  3N1X C;  3R2T A;  4S17 A;  3RNC C;  1T0S C;  1VLB A;  2OOB B;  1C9F A;  1J8C A;  4DHZ E;  3L16 A;  4KIK B;  3C0R B;  4I6L B;  5AZH A;  3TEY A;  2NPT A;  1ZPS A;  2RD0 A;  2BS4 B;  5H92 C;  5FR3 A;  4F1S A;  5HKH A;  1IBX B;  2RPV A;  2WU2 B;  2H89 B;  3U8Z A;  5DPR A;  3VRA B;  1YMH E;  3V61 A;  1T5X D;  3SFD B;  1G6J A;  2JX5 A;  2V9H A;  2GBR A;  4EEW A;  2JPH A;  3AEA B;  3NS1 A;  2KC1 A;  3HHM A;  2K8H A;  1IUE A;  4RGT A;  3UI3 A;  3ZDT A;  3ZKJ C;  1D5M C;  2JXT A;  3E56 A;  3P4S B;  1K50 A;  4WH4 A;  2BYF A;  4KZ0 A;  1ZW7 A;  1M4V A;  2ZPN A;  1I4R A;  4HK2 A;  2NS5 A;  1FNV A;  2LUM A;  3GE3 C;  4ITK A;  5EE3 A;  1YN3 A;  1NYQ A;  4KGR A;  2QMT A;  4B0M A;  2L8J A;  1SIJ A;  2Y3A A;  2NBU A;  1YJI A;  3C19 A;  1UEL A;  1AN8 A;  1MI0 A;  3BYY B;  2BKF A;  1TT5 B;  2AQ3 B;  2Z59 B;  2KJR A;  1WZ3 A;  3N3K B;  4LNF A;  1TS5 A;  1XLP A;  1KF6 B;  3DBS A;  4YTP B;  2KO3 A;  3A1Q A;  2VRR B;  1AW7 A;  2HE7 A;  5HFY A;  3AE8 B;  1Y8R C;  3LB8 C;  1KLG D;  1NEK B;  2LGI A;  2L1A A;  1ZKH A;  3IAS 1;  5T8I A;  2DYO A;  3SHQ A;  2N4F A;  4IW0 A;  2MWS B;  3HIZ A;  3V62 A;  4JGH B;  1EU4 A;  2GMI C;  2K6D B;  4ZRQ A;  2DBY A;  4DHZ B;  1Q5W B;  2KLG A;  2BB5 A;  3ZUN A;  1WJ6 A;  4NAM A;  5AEK B;  3ZJV A;  1UH6 A;  1J7C A;  2ZCB A;  5HHD G;  2DEN B;  1SB3 C;  2N0S B;  4LJP B;  5IOI A;  3P4R B;  4DHJ B;  2K9X A;  2LVQ A;  2DLB A;  2WX1 A;  1FCL A;  2PVG C;  2KX0 A;  2ZVO A;  2X8X X;  1XXG A;  1DOI A;  2N9L A;  4I6P A;  3TIX A;  3A9J B;  4A9A A;  4HPP A;  3ZW3 A;  1DOX A;  4WJP A;  2NBW B;  3UF8 A;  4FUL A;  2JYT A;  2Q5W D;  3ZXR A;  4W9J A;  3TL5 A;  4OZC A;  4N58 A;  1E8Y A;  2A5U A;  5BYR A;  1MFW A;  2D3C A;  3N30 A;  3AN1 A;  3BYT B;  4MGI E;  2JSV X;  2FCN A;  2IGG A;  3X23 A;  2CHW A;  2LUE A;  3Q3J A;  2Z0D B;  5AUK A;  4ZRI A;  3CIR B;  2KDE B;  3QAR A;  4KX6 B;  1NVI D;  4KVG B;  2K3U A;  3GE8 C;  3K9O B;  3PHX B;  5LNK 1;  2YVC A;  2WXO A;  2CS4 A;  1SGH A;  3NHE B;  1MG8 A;  1XLQ A;  4ARI A;  2RR9 A;  2FAZ A;  4RCO A;  2JWU A;  2INN E;  2Y5P A;  3IT6 B;  2J52 A;  2INP E;  4G3X B;  1EWC A;  2BYV E;  3UQB A;  2BS2 B;  2BGF A;  3MC8 A;  3PLV A;  4MSM B;  1WJ4 A;  2DWQ A;  1I35 A;  1YN4 A;  2RGF A;  2HDE A;  3JYU A;  3PLU A;  5HI1 A;  5H8Y E;  4B9K A;  2L3Z A;  4OVV A;  2KMM A;  2LFI A;  4DDI D;  5GXG B;  3WAP A;  1J0G A;  2L05 A;  1FCC C;  1OGW A;  3UQA A;  2PMV A;  4PS8 A;  1SE2 A;  3A4R A;  4XZ4 A;  1FM0 D;  1X1M A;  1BT0 A;  3PS6 A;  2L52 A;  3CF4 A;  4EOY A;  4MGY E;  4HCN B;  4RFB A;  2VH2 A;  3R66 C;  2L0F A;  3QIJ A;  3WAO A;  3ZTC A;  5AUI A;  4NQK E;  1GC6 A;  4UDU C;  2OJR A;  3Q8E A;  2KDB A;  4WIP A;  2N7J A;  2WDT B;  3H6N A;  3UIN B;  4NPN A;  1R4M B;  2MP2 B;  3RUI B;  5JZE B;  1VDV A;  5HG2 A;  3W1S A;  1KJT A;  2C5L C;  1J7A A;  4FXC A;  2KFK B;  5DPS A;  3KUD B;  3Q8B A;  2KTR A;  3AM9 A;  3QQ8 B;  2LVO A;  2RDB C;  4DQO C;  2KQS A;  4EKU A;  4IWO A;  3WA0 A;  1YQB A;  3DHG C;  1KFY B;  1UBI A;  3PRE A;  2WYQ A;  2LEK A;  3APD A;  3RZF A;  4ZYN A;  2HD5 B;  1EF5 A;  4W9D A;  1TKG A;  4W9C A;  3NVZ A;  4DXG A;  4TQ0 A;  2WXF A;  2MBH A;  4W9F A;  2IDY A;  3RI7 C;  1V9J A;  2KC2 A;  2WXP A;  1ET6 A;  1SE9 A;  4RGN A;  2BF8 B;  2BTE A;  5KHQ A;  2IO2 B;  4HLE A;  1U4A A;  3NVY A;  4N9F 4;  1QOG A;  3ZJU A;  3B1L X;  1K52 A;  5EE1 A;  1VR9 A;  1EWY C;  4XWW A;  4I6N B;  2GBM A;  1F1H A;  1XCQ L;  1FIQ A;  1NI3 A;  3AEE B;  2ZZP B;  3PVL A;  2KWD A;  5D3I B;  4NZL B;  4YWG G;  3KH0 A;  4JQW C;  3RNE C;  2N9E B;  3AU5 A;  3BVM A;  3PZ8 A;  2H88 B;  2HJ1 A;  3DBL B;  4IM3 A;  2X38 A;  2JRH A;  2N9K A;  1SXT A;  5DCN A;  1E9M A;  4ZRJ A;  3RNF C;  2D5G A;  3DBR I;  4OZA A;  2PKO A;  2AQ2 B;  4KDI C;  2J0M A;  3EGR A;  4LTU A;  5TSS A;  4G50 A;  5G2N A;  1V97 A;  3VAW A;  3NZ3 A;  4Q2J A;  2K8C A;  1TS4 A;  3Q8A A;  4FN2 A;  1LQB A;  1F2R I;  3Q14 C;  1EM7 A;  1L0X B;  3ML8 A;  3R8B A;  3GS2 A;  4G0N B;  5BYS A;  1JWM D;  3N9Y C;  3IVF A;  2DHZ A;  2NR2 A;  2RMM A;  1L5P A;  3EEC A;  2QEJ C;  3SEB A;  1V6E A;  2LHE A;  3TJP A;  3Q3N C;  1P98 A;  2KHW B;  2RDH A;  4LNK A;  4KGT A;  3W5U B;  3KYD D;  3RZW C;  1C78 A;  1UUP A;  2LJ5 A;  3IBE A;  3SR6 A;  1TZ1 A;  3DCG A;  2JRI B;  2R2Q A;  4GB9 A;  1ROE A;  1D6E C;  4M0W B;  1J19 A;  3IT4 B;  3QHT A;  3Q3F A;  2ZPY A;  2LAS A;  4NJ6 A;  2W3S A;  4YSZ B;  3OG5 A;  2V4I B;  4ZDV A;  2LXC A;  4HCP B;  1QKZ A;  1V80 A;  3VH3 B;  4KSL C;  4K3C A;  1T0Y A;  4BBN C;  5C2T B;  3P4P B;  3QWZ B;  2UU7 A;  2BQQ A;  4RGO S;  4MJS B;  4TKN A;  2KVR A;  1WGR A;  1D5Z C;  2K6Q A;  2PLP A;  2XBB C;  3PPA A;  3H9D A;  4GDK B;  2WXM A;  1I4G A;  4HDQ A;  2I1K A;  4KGS A;  4HKZ E;  4XDC A;  1NEN B;  1H7W A;  3AEB B;  2M4N A;  4CYE A;  1L2N A;  4LDT D;  1VD2 A;  4W9K A;  1L0Y B;  2JT4 B;  1V1P B;  4MM3 B;  4BFR A;  2JU6 X;  2YEP B;  1WH3 A;  1L4D B;  1TGZ B;  2KN4 A;  2MH7 A;  1BUI C;  3GZN I;  5CHF A;  4FJZ A;  1RWS A;  4YL8 A;  2N1V A;  4K1R B;  4W9G A;  4GDL B;  3BZD B;  3KWL A;  3Q3O C;  2DAF A;  3Q69 A;  4ZHP A;  1TJE A;  2KFK A;  3AE6 B;  2WDR B;  4E71 A;  1F9J A;  2K8B A;  2MP2 A;  4HPM B;  4ZYS A;  4GSW A;  2V3S A;  1OFF A;  4ARC A;  3VTV A;  4LCD E;  4IWP A;  3VUW A;  2ONQ A;  2D2Q A;  2W55 A;  1GPX A;  2KK8 A;  1J7B A;  4FLH A;  3V6C B;  3LJ3 A;  4FHJ A;  1FD6 A;  1P7E A;  4A3P A;  3ZIM A;  2IYD B;  2LRW A;  2LXA A;  1I4P A;  2E3T A;  4WAA A;  1ZOY B;  3P42 A;  1RAX A;  4P16 A;  2RDG A;  1WM3 A;  4C7Z A;  3NS8 A;  5AZF A;  2AX5 A;  4OHJ A;  1FO4 A;  1N5X A;  5D94 A;  2WQY B;  1CJE A;  1AYF A;  3D32 A;  4WWP A;  1TZO A;  4NAW B;  1R4N B;  1VRA B;  4FAD A;  2NMQ A;  5BYQ A;  4AJW A;  3DHH C;  4TUU A;  4F7Z A;  4BOZ B;  1TY2 A;  4M01 A;  3CF6 E;  4HJK A;  4DBG A;  2BYE A;  2VZK B;  2FUH B;  3L4P A;  4BVU C;  1V1P A;  3N1Z C;  2PE6 B;  2WGS A;  3CMM B;  4IM2 A;  1JRU A;  2IGH A;  1KOT A;  1PGA A;  2W54 A;  2DAJ A;  4J6I A;  2DZI A;  2M0A A;  2WHI A;  1NDD A;  4RNA A;  1LXD A;  3VR9 B;  1KLV A;  2J53 A;  2FCQ A;  3ZDM C;  3W9C B;  3SFE B;  3WIM A;  2PIA A;  2C7H A;  2LI5 A;  1ESF A;  2IO0 B;  2G9H D;  2NCN A;  1C3T A;  1ZGU B;  4RM8 A;  1L0V B;  3PV1 A;  4GU2 A;  4X57 B;  1JRO A;  2QHO A;  1FXI A;  4ASW C;  1P3Q U;  2CKH B;  3DVN V;  2W82 A;  1PGB A;  1QZE A;  2BWF A;  3L13 A;  3RFZ B;  3NUH B;  4IC7 B;  1B1Z A;  1TKE A;  2ZJD A;  4KKI A;  4RGM A;  4C00 A;  3A9J A;  2LRU A;  3C8Y A;  4PS3 A;  4JIO U;  2D3G A;  5AZG A;  1XT9 B;  4IKG A;  3OWE B;  4GIV A;  2ON8 A;  4TV3 A;  3I9V 1;  3W1Y A;  2ASQ A;  3H1U A;  1OEY J;  5G55 A;  3TMP B;  1WRD B;  5FKA C;  4P1B C;  3KUC B;  4AUQ C;  5E6J A;  4PYZ A;  3AV8 A;  3GP7 A;  3ZYY X;  2GI9 A;  2GB1 A;  1S1Q B;  3HK0 A;  5EDS A;  3PTF C;  4BKS A;  3E9S A;  2AQ1 B;  1IGC A;  1R4M I;  1SE3 A;  3VDZ A;  4A90 A;  3HVZ A;  2BB6 A;  1C4A A;  3KQ4 A;  4MT5 A;  1E5W A;  4MM3 A;  2NBV B;  3ZRF A;  1LFD A;  2M19 A;  2MJE A;  2WU5 B;  5G5H A;  1E7V A;  2CR5 A;  2D11 A;  1H7X A;  2M1M A;  5D6J B;  4RH6 A;  5IKC M;  1MJD A;  4C56 C;  3DWG C;  4ANU A;  4ANV A;  1KM7 A;  2WWZ A;  3AEC B;  1TIF A;  2L76 A;  3QCA A;  5E6O A;  3MHS D;  4DXF A;  2GLS A;  3AXC A;  3RNB C;  3IAM 1;  3HRD D;  2WDQ B;  5E6N A;  2KFJ A;  1CQV A;  3ZQ4 A;  3W5V B;  3U7D A;  2IND C;  1KTK A;  2V3N A;  4II3 B;  4BAX A;  1N60 A;  3RNG C;  2WLB A;  2CU3 A;  2FUG 1;  2NTS A;  4ANW A;  1GC7 A;  1ZDV A;  1ZXH A;  2KAC A;  1UD7 A;  4YT0 B;  4NJC A;  5KHO A;  2J0K A;  4A8X C;  3L54 A;  3BVG A;  2QIL A;  4IDI A;  2FE8 A;  1CMX B;  3FKY A;  2GBK A;  2DX5 B;  2LZ6 A;  3R7Q A;  1E8W A;  2AL3 A;  3VFK A;  1V1O A;  2UYZ B;  2V3P A;  4FA6 A;  1IBX A;  4EZK A;  4EZL A;  1WXS A;  5BO4 B;  4CHK A;  4CQN A;  1QOA A;  4O1N A;  1FXA A;  1UZX B;  2IZV B;  3GOE A;  4AS1 A;  3AH7 A;  4C80 A;  1E8X A;  3BK2 A;  2G4D B;  4L1B A;  1SIF A;  3IG3 A;  2G4S A;  4NQL B;  1YQ4 B;  2KYW A;  3LYY A;  4CO7 A;  3FIL A;  2J42 A;  1IP9 A;  2VH1 A;  2BYT A;  3ZXV A;  1XLO A;  2PE9 A;  5FK9 C;  1UF0 A;  3QX1 A;  4REZ A;  1C76 A;  1RM6 C;  2PTL A;  3L10 B;  3AB5 A;  2J7Q B;  4DHJ D;  3CSF A;  2R61 A;  2O2V A;  1STE A;  3M62 B;  1N6Z A;  5J2R A;  4TMA B;  1GOZ A;  1GAQ B;  1WGD A;  3PZD A;  3KUZ A;  3TEZ A;  1ZUD 2;  3APC A;  1VCB A;  3NJT A;  1GTE A;  3ZRC A;  1UGJ A;  4M8N A;  1Q0W B;  1P0R A;  4M0W A;  5BMH A;  2QC8 A;  1YJJ A;  1I7H A;  2J4X A;  1JCK B;  2XNA C;  4JPS A;  2ZCC A;  2LGD A;  2CHX A;  2M17 A;  3Q3M C;  1L7Y A;  3L17 A;  3PRM B;  3MTN B;  1N61 A;  4K7S A;  1M94 A;  4K7U A;  3VR8 B;  5L95 C;  4JWU C;  4AP4 C;  4JL9 A;  1F77 A;  1OTR B;  4XX5 A;  5LXI B;  2JF5 A;  1TYG B; 
#chains in the Genus database with same CATH homology
 4WH4 A;  1UWM A;  1M4V A;  1I4R A;  1FNV A;  3W2D A;  2LUM A;  2PVO D;  3U2S C;  5C2T B;  1JWU D;  3P4P B;  4ITK A;  5EE3 A;  1YN3 A;  1NYQ A;  4KGR A;  1F2R C;  5EE0 A;  1JWA D;  1E10 A;  2QMT A;  2JZP A;  1OQR A;  2G1E A;  4RGO S;  3T3N A;  4HRS A;  3NVW A;  2Y3A A;  1SIJ A;  5BMG A;  4B0M A;  2V0G A;  1YJI A;  3AEG B;  1D5Z C;  1K51 A;  2PLP A;  2OED A;  1LO5 D;  1TS2 A;  1VZ8 A;  1AN8 A;  1MI0 A;  2WXM A;  4GDK B;  1YQ3 B;  2CJN A;  1I4G A;  1WXQ A;  1RFK A;  4KGS A;  3J9C A;  4HKZ E;  4EE2 A;  3BK1 A;  3BYY B;  3EUB 2;  1JRP A;  2L83 A;  2AQ3 B;  4XDC A;  2QJL A;  1NEN B;  1VJK A;  1H7W A;  1TS5 A;  1L6V A;  3AEB B;  1KF6 B;  1XLP A;  1QQR A;  2ICI A;  4YTP B;  1ET9 A;  2ACZ B;  1DOY A;  1WWT A;  1XEE A;  1L0Y B;  4JE3 B;  1SJH D;  3B2G A;  1AW7 A;  4A6Q A;  1FNU A;  5HFY A;  3AE8 B;  3LB8 C;  1V1P B;  4MM3 B;  1KLG D;  1NEK B;  2LGI A;  2JU6 X;  2YEP B;  2L1A A;  3IAS 1;  4XWT A;  5T8I A;  1K53 A;  1L4D B;  1MHH E;  2DYO A;  1ACC A;  2KN4 A;  2MH7 A;  1BUI C;  1EU4 A;  3HUI A;  2Z8L A;  3HVD A;  3FC4 A;  3P1M A;  4PT5 A;  1RWS A;  2DBY A;  4ZRQ A;  2M56 B;  2BB5 A;  4GDL B;  3AE1 B;  3KLS X;  3BZD B;  3KWL A;  2BW2 A;  4MAC A;  3Q69 A;  4ZHP A;  3V05 A;  1TJE A;  4NAM A;  3MC0 B;  2WXQ A;  3AE6 B;  2WDR B;  3ZJV A;  1J7C A;  1KRH A;  2VZK D;  5HHD G;  1SB3 C;  2N0S B;  3ETR A;  3P4R B;  2K9X A;  4C7Y A;  4ZYS A;  1OFF A;  4GLS C;  4ARC A;  2DLB A;  3DWM A;  3Q8F A;  1FCL A;  3B2F A;  2PVG C;  1R7S A;  1XXG A;  2MJ3 A;  2ONQ A;  1ZXI A;  1DOI A;  2W55 A;  1GPX A;  2N9L A;  4R3D A;  1J7B A;  4A9A A;  1QIL A;  1DOX A;  3NVV A;  1HZ6 A;  4OVZ A;  4LLG M;  3WCQ A;  1FD6 A;  1I4H A;  2JYT A;  2Q5W D;  2K0P A;  1P7E A;  4YXD B;  3AE7 B;  1QOF A;  4OZC A;  4N58 A;  1I4P A;  1N62 A;  5BYR A;  2E3T A;  3BII D;  3TSS A;  1ZOY B;  2L32 A;  1KLU D;  3P42 A;  3AN1 A;  3BYT B;  1HA5 A;  1F0Z A;  3Q8C A;  2JSV X;  3V3X A;  4OZB A;  4P16 A;  4XDD A;  2RDG A;  1D4B A;  4C7Z A;  1TKY A;  3CWI A;  3AEF B;  3AE5 B;  2IGG A;  2AX5 A;  4OHJ A;  1WYG A;  1FO4 A;  1N5X A;  1YNT E;  2WQY B;  1CJE A;  1AYF A;  2EKI A;  1TZO A;  4NAW B;  4A55 A;  3U52 E;  4AQ7 A;  3NRZ A;  3BVZ A;  5AUK A;  2BBC A;  3CIR B;  1I4X A;  2YEP F;  4KX6 B;  1SBB B;  1VRA B;  1NVI D;  2NMQ A;  3B9J A;  1FFU A;  5D3D A;  5BYQ A;  2K3U A;  2WS3 B;  4US8 A;  2WXR A;  1MHX A;  1E7P B;  5LNK 1;  1N5W A;  1TY2 A;  2WXO A;  1FNW A;  3TEX A;  3FIL B;  2WXI A;  1XLQ A;  1BML C;  4ARI A;  2VZK B;  4RCO A;  2WP9 B;  2JWU A;  2INN E;  3L4P A;  2Y5P A;  3IT6 B;  2WXH A;  1TS3 A;  2J52 A;  1PGX A;  1V1P A;  1NYR A;  2INP E;  4IOI E;  1XCT L;  1EWC A;  1GB1 A;  4ZOH C;  3ZJT A;  2QSD A;  2BS2 B;  1VZ6 A;  3IXS A;  2DWQ A;  1YN4 A;  2IGH A;  3MP9 A;  2HDE A;  2MEK A;  5HI1 A;  3KWV A;  2WDV B;  5H8Y E;  1PGA A;  5BMI A;  5G5G A;  2W54 A;  4YSY B;  1QOB A;  1WRI A;  2KMM A;  3P63 A;  2GRI A;  2LFI A;  2M0A A;  1JWB D;  4KKJ A;  1QLB B;  2FBW B;  3VR9 B;  2I38 A;  4RNA A;  2J53 A;  5GXG B;  3W9C B;  5JXV A;  3SFE B;  2PIA A;  1ESF A;  1FCC C;  2HTM E;  5I4D A;  1ZP0 B;  1Y56 A;  2G9H D;  1HXY D;  2PMV A;  2K22 A;  1QT9 A;  1L0V B;  1SE2 A;  1CZP A;  2WXG A;  1JRO A;  1FRD A;  3AE9 B;  1L4Z B;  3U4E G;  1D5X C;  1FM0 D;  1FXI A;  2L52 A;  3CF4 A;  3R2I A;  2SAK A;  2W82 A;  1PGB A;  4RFB A;  1GB4 A;  1WGK A;  3RFZ B;  3NUH B;  1DYQ A;  1T6B X;  3MFG A;  1B1Z A;  1TKE A;  1TY0 A;  1EU3 A;  4KKI A;  4RGM A;  3AE2 B;  4TSS A;  1E0Z A;  5AUI A;  3C8Y A;  3PO0 A;  1PFD A;  4UDU C;  3Q8E A;  3GB1 A;  1AWD A;  1HQR D;  2DYM A;  1GT8 A;  2WXK A;  4IKG A;  4WIP A;  2N7J A;  4USA A;  3OWE B;  1BXT A;  5EE9 A;  2ON8 A;  2KAJ A;  3I9V 1;  1VDV A;  1SF0 A;  5HG2 A;  1L6U A;  3W1S A;  1PUT A;  5FKA C;  1FEH A;  5E6J A;  1J7A A;  3AV8 A;  3MJ5 A;  4FXC A;  2CJO A;  3U7Z A;  1ZDX A;  3GP7 A;  3ZYY X;  2NTT A;  3Q8B A;  3AM9 A;  2GI9 A;  2GB1 A;  2LJI A;  2SEB D;  3E9S A;  2AQ1 B;  1IGC A;  4DQO C;  4WQM A;  1QF6 A;  1PYW D;  1XO3 A;  2JQR B;  4WUR A;  1SE3 A;  4A90 A;  3ZGZ A;  1B9R A;  3HVZ A;  3VRB B;  1ZE3 D;  2BB6 A;  3AMZ A;  1C4A A;  2IPK D;  3KQ4 A;  4MT5 A;  1C4C A;  3T3O A;  1YN5 A;  1ENF A;  1KFY B;  1N63 A;  2M19 A;  2MJE A;  2WU5 B;  5G5H A;  2LEK A;  1SJE D;  5D7G A;  1JW9 D;  3P4Q B;  4YTM B;  1E6E B;  1H7X A;  2Y5C A;  1SEB D;  4RH6 A;  1TKG A;  2KDM A;  1XLN A;  3NVZ A;  4DXG A;  4HKQ A;  1JML A;  4L2Y A;  1A70 A;  4C56 C;  3DWG C;  4TQ0 A;  1IGD A;  3TEW A;  2WXF A;  2IGD A;  2BS3 B;  2IDY A;  3AEC B;  3H8H A;  1VZ7 A;  2WXP A;  1ET6 A;  4DXF A;  4RGN A;  3VQI A;  3URY A;  2K5P A;  3PZ7 A;  1HEZ E;  1RYJ A;  2BTE A;  3IAM 1;  3HRD D;  2WDQ B;  2ZW0 A;  4US9 A;  4D2K A;  3NVY A;  4ZHO A;  1CQV A;  4N59 A;  3ZQ4 A;  1QOG A;  3W5V B;  3ZJU A;  1KTK A;  1T3Q A;  2V3N A;  1N60 A;  2KQ4 X;  1K52 A;  2I2Y A;  5EE1 A;  2WLB A;  2PW9 A;  1VR9 A;  2CU3 A;  2FUG 1;  1EWY C;  2LMC A;  2NTS A;  1ZDV A;  1ZXH A;  4XWW A;  2KAC A;  1XCQ L;  3MHZ A;  4YT0 B;  2JYE A;  3ABV B;  4NJC A;  3FAH A;  1DGJ A;  4YTN B;  1FIQ A;  4A8X C;  1NI3 A;  3AEE B;  4JX1 C;  2KWD A;  1MPE A;  3BVG A;  5D3I B;  1JQ4 A;  1UNS A;  2QIL A;  2TSS A;  4IDI A;  4NZL B;  2FE8 A;  4YWG G;  1SE4 A;  4B0E A;  1FRR A;  4MH8 A;  1OQQ A;  3BWU D;  3BVM A;  4HRO A;  3AED B;  1XF5 L;  3PZ8 A;  4LK0 M;  2H88 B;  2X38 A;  1V1O A;  4YSX B;  2N9K A;  1JWS D;  1SXT A;  2V3P A;  4HJG E;  1IBX A;  1E9M A;  4L23 A;  2WXN A;  2D5G A;  1FFV A;  2WNM A;  4OZA A;  4CQN A;  1QOA A;  4RF1 A;  4O1N A;  1PDX A;  1FXA A;  4ZRP A;  2PKO A;  2AQ2 B;  3AE3 B;  1KH0 A;  5MPO A;  4AS1 A;  3EGR A;  1MVK A;  1CK1 A;  3AH7 A;  4LTU A;  2MJD A;  4HEA 1;  4WAF A;  4OW0 A;  5TSS A;  4J3O D;  3BK2 A;  4L1B A;  4N6E B;  1V97 A;  3NZ3 A;  1YQ4 B;  2E6X A;  3LYY A;  4Q2J A;  2XN9 C;  3FIL A;  2J42 A;  1TS4 A;  3Q8A A;  1F2R I;  2W3R A;  2BYT A;  4XE0 A;  1WSP A;  1JAL A;  1I4Q A;  1GTH A;  1V8C A;  1EM7 A;  1XLO A;  1L0X B;  3R8B A;  3RPF C;  3GS2 A;  5BYS A;  5FK9 C;  3TUO A;  1JWM D;  3N9Y C;  1P7F A;  1C76 A;  1RM6 C;  2PTL A;  4REZ A;  4H2A A;  3AB5 A;  2RMM A;  3I57 A;  3R2T A;  4P6V F;  1L5P A;  3LXF A;  2R61 A;  2QEJ C;  1UWX A;  3SEB A;  1FMA D;  2IJ0 A;  1VLB A;  4TQ1 A;  1STE A;  2LHE A;  1C9F A;  2QIE B;  1C77 A;  2BT6 A;  4TMA B;  1GOZ A;  1GAQ B;  2RDH A;  4KGT A;  3W5U B;  1Q10 A;  2OHF A;  3O13 A;  3TEZ A;  1ZUD 2;  3TEY A;  1GTE A;  1C78 A;  1UGJ A;  1UUP A;  1ZPS A;  5BMH A;  4M0W A;  3EA6 A;  3SR6 A;  2BS4 B;  5H92 C;  5FR3 A;  1YJJ A;  1I7H A;  2J4X A;  1IBX B;  1JCK B;  2RPV A;  1C79 A;  2XNA C;  2WU2 B;  2H89 B;  3VRA B;  1YMH E;  1ROE A;  1D6E C;  4JPS A;  3IT4 B;  1HZ5 A;  4C80 A;  1T5X D;  3SFD B;  4WWM A;  2JX5 A;  2WXL A;  4RF0 A;  3AEA B;  3NS1 A;  5C3J B;  1N61 A;  3VR8 B;  1IUE A;  4RGT A;  3UI3 A;  4JWU C;  1SSN A;  2EEL A;  1D5M C;  2W3S A;  4YSZ B;  2JXT A;  3AE4 B;  2LHD A;  2V4I B;  4JWS C;  1F77 A;  2WXJ A;  1C4P A;  3E56 A;  1QKZ A;  2ZW1 A;  2B76 B;  3P4S B;  1K50 A;  1TYG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...