3SFEB

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and thiabendazole
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
APRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3sfeB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sfeB01
4C80A 4A9AA 5C2TB 1FRDA 1IUEA 1WYGA 3AEEB 1L5PA 2OHFA 2PKOA 3NVVA 1GPXA 1J7CA 1JROA 2BT6A 1L6UA 2K5PA 2W3SA 3EUB2 1ZUD2 1JWAD 3DWGC 3HVZA 4JWUC 4USAA 3VR9B 1FFUA 1JQ4A 2W55A 1CJEA 2FBWB 3AE8B 3AEAB 1N63A 2MJDA 2WS3B 1XLQA 3RPFC 4N6EB 1JRPA 3LB8C 2L83A 1XLNA 1GT8A 2BS3B 2H88B 1QOBA 2N0SB 4LTUA 3B2FA 3CF4A 4C7YA 3AEGB 1XLPA 4US9A 2WU5B 1E9MA 1NYRA 3HRDD 1QOGA 3VR8B 2ACZB 2EKIA 1ZP0B 1TJEA 1I7HA 3P1MA 1QLBB 1RFKA 3VRBB 1KRHA 2K22A 3AE2B 1FRRA 4YT0B 1H7WA 3FC4A 1SB3C 4FXCA 2WDVB 1FXAA 1N5WA 1ZXIA 3AE5B 4YXDB 1XO3A 1DOIA 1DOXA 2KMMA 1JW9D 1E7PB 1WWTA 3LXFA 1YQ3B 1N61A 2MH7A 1DOYA 2BS2B 1RWSA 4YSXB 1JWBD 2M19A 2M56B 3ABVB 1NVID 1RYJA 2WP9B 3FAHA 3B2GA 3AB5A 2Q5WD 1JALA 1AWDA 1WRIA 3HUIA 3NRZA 2HTME 1A70A 3PO0A 1H7XA 1NEKB 1YJJA 4YSZB 3L4PA 2PIAA 4P6VF 2MJ3A 4WQMA 1NENB 3AECB 1SIJA 2BS4B 2LEKA 4HRSA 3CWIA 4YTPB 2Y5CA 1TKEA 1L6VA 5C3JB 3ZYYX 1E0ZA 1QOFA 1TKYA 3WCQA 3AE7B 4ITKA 3AH7A 1E10A 2L52A 1GAQB 2WLBA 3W5UB 5G5GA 3P4RB 3P63A 2WQYB 1YQ4B 2WDRB 2DWQA 4KX6B 1L0VB 1KFYB 2DBYA 2W3RA 3AN1A 3BIID 1FMAD 2MJEA 1E6EB 2PVGC 1FM0D 3SFDB 5H92C 1ZOYB 3VRAB 3AV8A 4IDIA 1F0ZA 4YTNB 1T3QA 1R7SA 1XLOA 2B76B 2E3TA 3AM9A 5EE0A 2H89B 1QF6A 1UWMA 3AEFB 3KWLA 5AUKA 4ZHOA 1VDVA 3CIRB 1J7BA 4JX1C 1FO4A 2PVOD 1GTHA 2W54A 5G5HA 1GTEA 3AE9B 1J7AA 3AE1B 3P4SB 4YSYB 1OQRA 1CZPA 3P4QB 1WXQA 2JX5A 5EE3A 4ZHPA 1RM6C 1AYFA 5H8YE 1OQQA 4YTMB 1ROEA 1VLBA 3AE3B 2WDQB 1FFVA 3NVZA 2QJLA 1KF6B 4N59A 3NVWA 3SR6A 4JWSC 1FIQA 2G1EA 1N62A 3AMZA 4WWMA 4US8A 1QT9A 1NYQA 1PUTA 3DWMA 1N5XA 1TKGA 3B9JA 5GXGB 3AEBB 4ZOHC 1YJIA 1EWYC 3SFEB 3P4PB 1DGJA 2JQRB 2CU3A 2CJOA 1SF0A 5AUIA 1NI3A 2K9XA 3W9CB 1PDXA 3W5VB 1N60A 1PFDA 3NS1A 1TYGB 5EE9A 2KAJA 1V97A 1OFFA 1V8CA 1WGKA 2AX5A 1FXIA 3NVYA 4HROA 4C7ZA 4N58A 5MPOA 3AEDB 3AE6B 1VJKA 2WU2B 3AE4B 1QOAA 2CJNA 5EE1A 3ETRA 1B9RA 2QIEB
chains in the Genus database with same CATH superfamily
1BXTA 4EE2A 1B1ZA 1GPXA 1J7CA 3X0WA 2AYOB 2KANA 3U8ZA 1H8CA 2R61A 2JUOA 1KJTA 3M62B 1GT8A 3JSVA 5FKAC 4C7YA 3LDZE 1KH0A 4W9FA 3QJZA 3APFA 3PSEB 3KYDD 1FNVA 1VZ8A 3P1MA 2DYBA 2KQ7A 4FA6A 3AE2B 2BB5A 1LO5D 1DOXA 2N9PC 4C4VB 3I9V1 1RYJA 4NJ6A 4A90A 2VZKD 2HTME 4FJZA 4E71A 2PIAA 2KHWB 2WXLA 2JXTA 2LI5A 1VZ6A 3ZKJC 4C00A 1C1YB 2IZVB 2W3RA 4LNOA 3W1SA 1WXVA 4RGOS 2NTSA 2FAZA 5EE0A 2B76B 1IP9A 4S0RA 3ZO5B 3OG5A 3MHZA 2M4NA 2RDBC 5D3IB 1VDVA 3RMKC 4A3OA 1GTHA 4BKSA 1WX7A 3PLVA 1MG4A 1WX9A 2JX5A 1UELA 3L10B 1RM6C 2FCSA 1ZXHA 4L2YA 1ROEA 4MGKE 1YD8U 4W9EA 1YMHE 4G3XB 1FNWA 3VQIA 3U52E 4GU2A 4C4VA 2KX3A 1P3QU 3L17A 4W9HA 1SSNA 2JT4B 3AE6B 3QQ8B 3BVGA 2PKOA 3JW0X 3NVVA 2UYZB 1JROA 2BT6A 3EUB2 4OHJA 2N7JA 2KT7A 1YN3A 5FK9C 1GC7A 2QHOA 4CYEA 3IHPC 4IM3A 4DXGA 3CF4A 3VH3B 1XLPA 4M02A 4WH4A 2WU5B 3N9YC 4RCOA 3DBRB 3MP9A 1T5XD 2FCQA 4RF1A 2N7EA 3V61A 3GOEA 3RI7C 3H7SA 1SB3C 3C19A 3N1ZC 4IM0A 2A5UA 3OLMD 1DOIA 2SEBD 2WX1A 1Q1OA 3DVNU 4RGNA 1C77A 1GNUA 4DWFA 1WR1A 1H7XA 4P6VF 1NENB 4CQNA 2MW5A 4GGQA 1OEYA 1UWXA 1ZKHA 1ZDVA 1V1PB 4HDOA 2HJ8A 3N1YC 5E6PA 4MGIE 4D2KA 2QEJC 3Q8FA 1ZOYB 3UIOB 1TS3A 4LDTB 3VRAB 4JE3B 4JQWC 3RNFC 2NBVB 1QF6A 1UWMA 4EOYA 2D07B 4GIVA 2Z59B 3Q8EA 2LZ6A 2XNAC 2PVOD 3UF8A 1GTEA 1K51A 3V6CB 2LFIA 2MBHA 5DPWA 3CSTA 3OWEB 2FCNA 4MH0E 1FIQA 3AMZA 2ZZPB 5IN7A 3AEBB 2QCZA 2MBEA 5CHWA 1AN8A 2INCC 3DVGX 1TS4A 2K9XA 4RFBA 1WR6E 3DVNV 2KJRA 1I4PA 4KKJA 4OVUA 1TY2A 3ZUNA 1C4PA 4W9GA 1T0YA 4HVBA 1V1PA 3IG3A 3DVGY 1CJEA 4HPMB 3DOWA 3UQBA 4K1RB 4M00A 1WE7A 3V60A 1V9JA 4P1CC 1I4RA 2HTHA 1TJEA 5D2MB 2K22A 4NAWB 2ZVOA 4YT0B 3KUCB 1ZXIA 3R66C 3IXSA 3DBLI 4ANWA 1H4RA 2LGDA 4FN2A 4LNNA 3NRZA 2C9WB 1E7VA 2ZVNA 1ZPSA 2N1WA 4WWNA 2WXQA 3O65B 2WQYB 3A4SC 1E8YA 2GBMA 2LASA 1E8XA 2L3ZA 2KKCA 2KWDA 1L0XB 3ZXVA 3FKYA 2WXOA 1EO6A 4K81A 5JH5C 1WMHB 4NJCA 2RGFA 4EEWA 2QJLA 2BKFA 2LGYA 2RDGA 1U4AA 1YNTE 2KMCA 5TR5A 2MRPA 5GXGB 3DDCB 1OEYJ 1UZXB 3R7RA 4P16A 1WI0A 2KQ4X 4YWGG 1TT5B 2CJNA 2GBNA 2QDFA 3VUYA 3QA8A 2FBWB 3TEWA 3V3XA 2L32A 3PZDA 4ZYSA 4DHZE 1JRPA 5JHBA 1GB4A 3B2FA 2L0TA 1Z2MA 4RF0A 5E6OA 2DZKA 3PZ7A 2EKIA 3M63B 2IO2B 2BBCA 2L7RA 2RPQA 3ZJTA 1H7WA 3FILB 1UF0A 2PEAA 4NY0A 4E74A 3LJ3A 4IWQA 2LVOA 4MJSB 4B9KA 1WMHA 4KDIC 2KO3A 1NVID 3AB5A 1JALA 3RZFA 2JWUA 5IOIA 2L0FA 1HA5A 3KUZA 2LEKA 3N1XC 3QIJA 1F2RI 1SBBB 1GAQB 3WALA 2KWVB 1HEZE 2GI9A 1L0VB 1V1OA 1YX6B 2MJEA 3WANA 2XK5B 1V80A 2K8CA 2INDC 2ICIA 2LGIA 1XXGA 4GMVA 3PLUA 2ZNVB 1CK1A 3AU4A 5AUKA 4RGMA 1KLVA 2WXIA 1CZPA 3QARA 2BYFA 1VLBA 2LGSA 3FILA 4W9JA 2N9LA 4MJSA 4ZOHC 3O13A 4M01A 1N60A 2WXHA 4A20A 4II2B 2HDEA 4ARIA 2XBBC 3ZTCA 4LLGM 4ANVA 3AEEB 1VRAB 1ACCA 3DWGC 4HKZE 2VZKB 2PTLA 5IKCM 3HVDA 2PMVA 1WXMA 2BPSA 1F77A 2XK5A 5IAAC 5J2RA 1QOGA 4MM3B 1OQYA 2JZZA 1KRHA 3WIMA 3AU5A 4NQKE 3NZUA 1FXAA 3IFWB 1V5OA 4FJVB 2BWES 4DK5A 2AQ3B 3MC0B 1JWUD 3PO0A 4XDDA 2AQ2B 4YSZB 2LVQA 3MTNB 1SIJA 5EDSA 4YTPB 2CU1A 4M8MA 4JGHB 4ITKA 4O1NA 2X38A 1E10A 2WLBA 4L1BA 3A9KB 2DWQA 3VTUA 1V2YA 2MEKA 1K52A 3QC8B 3NHEB 2V4IB 1TS5A 5D94A 3LYYA 2LVPA 4A3PA 1MJDA 2N9EB 2W54A 4FJYA 4MM3A 2HE7A 3HHMA 4PS8A 2K39A 4KGTA 4JWSC 2I38A 4MSQB 2KFJA 3W1SC 4KSKC 4EFOA 4RM8A 2JRHA 3CSFA 3NS1A 3NZSA 3NS8A 4HROA 2Y3AA 2JZPA 2QIEB 5J18A 1B9RA 1G6JA 3SU8X 1NI2A 2NS5A 2K3UA 1C9FA 1ZUD2 1F52A 1WGRA 4OW0A 3A9KA 5L83A 5LXIB 2KDMA 4J3OD 1UNSA 3ZW3A 1TY0A 1L4DB 1J0GA 2G4SA 2BGFA 4XX5A 4AQ7A 4WWOA 4G11A 4X57B 4H2AA 2HD5B 2DYMA 3ZJVA 2GBKA 3UIPB 3VUWA 2WP9B 2IO1B 1D5XC 2K6QA 3AECB 3VTVA 1C76A 3BYYB 2MWSB 1E0ZA 2IY0B 1XT9B 2PJHA 2M0XA 3K9OB 2MX2A 4I6LB 1SE9A 2IGGA 4TMAB 3W5UB 1YQ4B 1K8RB 2CHWA 4FHJA 1E6EB 1HTQA 3BVZA 3ZIMA 3C0RB 1V49A 1IGCA 4ARCA 2V3SA 1UH6A 5HG2A 1SE4A 1T6BX 4FBJB 1D3ZA 3UINB 2DNFA 4L23A 1FFVA 3Q8BA 1MHHE 5DPSA 2WXNA 1WGHA 4TQ0A 1L7YA 1T0RC 3DWMA 3MC9A 1IPGA 1QQRA 5AUIA 3W9CB 1XCQL 1TZ1A 1Q5WB 5HI1A 3W2DA 1OTRB 1GUAB 2KXJA 2GBJA 4TV3A 1V6EA 3T9LA 3RUIB 1Q0WB 2GBRA 5AZFA 5HFYA 2RMMA 4LNIA 4IWOA 3NG0A 3L16A 2JZ3B 1FD6A 1XLQA 1XEEA 1KLUD 2BS3B 5CTRC 2JWZA 2X8XX 4ZRIA 2KTFA 5JXVA 3TL5A 3R2TA 2L00B 3FC4A 3NY5A 1MPEA 1HZ6A 3RNBC 2I2YA 3ECIA 3MHSD 1WM3A 1WFYA 1L0YB 4XWWA 3GE8C 1UGMA 4M8NA 3GZNI 2KN5A 2OJRA 2IJ0A 2Z8LA 1YN4A 1LQBA 1LM8B 3GE3C 4B95A 4MACA 2RD0A 2KX0A 3PRZA 4JIOU 1DYQA 3HM6X 3TCAA 3P4RB 2KLGA 1PGXA 1RFAA 2DBYA 2IPKD 1PGBA 4LK0M 4HJGE 4ICUA 3B0AA 2AL3A 4B6WA 1P1AA 2QSDA 3JYUA 5C1ZA 3H7PB 2KOXA 4EUTA 4KVGB 3PS6A 5CHVC 2FIDA 5HKHA 1OQRA 2C5LC 3IAS1 1TIFA 2N9KA 1MG8A 1PUTA 2DZMA 4DDID 3BZDB 2D3CA 4AP4C 2JXXA 4GXBA 3ZJUA 2AQ1B 1GC6A 3DPDA 1KTKA 3DBLB 2NCNA 5IA7A 1WY8A 3X23A 1L5PA 1EF1A 4KZ0A 1L6UA 1JWAD 3VVWB 4USAA 2V4LA 2INPE 1JQ4A 3PTFC 2ASQA 3ZGZA 2L8JA 1R4MI 2YEPF 2DZJA 2EMSA 3AEGB 5D6JB 3PZ8A 3RNAC 2DX5B 2J4XA 1YQBA 2N1VA 3H7PA 5BYRA 3RNGC 3VRBB 3NJTA 1JCKB 2KWUB 2M1MA 3L13A 3A9JB 3Q14C 2FIFA 1WZ3A 4XDCA 4HDQA 3DBHI 1S3SG 2D3BA 3L0WB 1PYWD 2R2OA 2LXAA 3B2GA 4KGRA 2RPVA 3HUIA 3ZNGC 3Q2AC 2MQJA 1ZGUB 3BY4B 1Q10A 2DAJA 1TKYA 3ML8A 4JL9A 1T0QC 4ACFA 4II3B 3R8BA 1WH3A 1C78A 2K1FA 1BUIC 2KK8A 2CHZA 4JLCA 2C7MB 4ZHOA 1J7BA 4OZAA 1EF5A 4KDLB 3WAOA 4KKIA 4BZAA 4IOIE 4PK1A 2ZCCA 3P4SB 2M0AA 1UBQA 4GDKB 2O6VD 2LHDA 4IC7B 3A9JA 4N59A 2TSSA 2OEDA 3MC8A 3RZWC 3I3TB 2ZW1A 4BVUC 3ZNZB 1DGJA 2KLCA 2CU3A 2QMTA 4FULA 1NI3A 2AEHA 4NQLB 5EE9A 2KAJA 3AI5A 4C7ZA 1ISNA 3OJ3A 3M3JA 3V62A 1D5ZC 1OGWA 1TTNA 3EC8A 1IUEA 2BW2A 1GJZA 2D5GA 2N9XA 2G3QB 2JSVX 2PE6B 1HQRD 1FFUA 4NAWA 3WA0A 1N63A 4LCDE 1EWCA 3JVZX 2KVZA 2H88B 2RR9A 2YLMA 3IT4B 2MLBA 3EECA 1WGDA 4HJKA 3H9DA 3APCA 3PRPB 3GB1A 2MP2B 2B3AA 2UU7A 1N5WA 1XO3A 2DLBA 3LXFA 1YQ3B 2MH7A 4GDKA 2AL6A 1RWSA 1WJNA 2K25A 4HLEA 2Q5WD 4EZJA 4IWPA 4WWPA 1WGGA 2YVCA 1E7UA 3P2BA 3ZNHB 1TKEA 4NAMA 2D3AA 2KNBA 4Q2JA 2KDEB 2LRUA 2JU6X 5I4DA 3AH7A 1EU4A 4RM9A 1M94A 5KHOA 2JYEA 1K50A 4WQOB 4ZRQA 2BWFA 1HXYD 2KFKB 3PHXB 1WGYA 1WRDB 3I5JC 2ZPNA 1YIWA 1TBEA 2GB1A 1KM7A 2G4DB 3N3KB 4WJNA 4AUQC 1WIAA 3TUOA 3ZXRA 3AE1B 2MHJA 4ZHPA 5H8YE 4PS3A 4DHZB 2MP2A 1KF6B 2G1EA 4MSMB 4DDGD 4WJPA 1N5XA 1JWMD 1L2NA 4IW0A 3SFEB 2V3NA 2EELA 4XYCA 1FCLA 4BOSC 3AEDB 1E8WA 1SJED 1WZ0A 2K8HA 3R3MA 3Q3OC 2WDTB 2VRRB 4W9LA 4HXDA 3NZ3A 1T0SC 4ZYNA 1EUVB 3AEAB 3AE8B 2MJDA 3DHIC 3Q3NC 2M8SA 1I4QA 2ZJDA 4ZRPA 2WXPA 4URKA 4IKGA 2NMQA 1F9JA 2KFKA 2NVUI 3H1UA 3ZNID 1NYRA 3ENEA 3PREA 2CKHB 2WYQA 4G0NB 4EZLA 3RT3B 3TEZA 3A4RA 2D2QA 1FRRA 2RDHA 3OJ4B 4AOFA 4MELA 3U7DA 1AW7A 4YXDB 2D11A 4CO7A 4MDKE 4WJQA 1P9DU 3PVLA 2RSUA 3MJ5A 3FAHA 2KZRA 2KD0A 5KHQA 2QC8A 4QAYA 4TKNA 3CWIA 2XEWA 2ONQA 2FNJB 4HEA1 2IO3B 5AEKB 1IYFA 4WAAA 2C60A 2JRIB 4MGYE 4EZKA 2J0JA 3BIID 3IBEA 1GG3A 1HTOA 4J6IA 2KMAA 3A33B 2H89B 1R4NI 4HPLB 3CIRB 1FO4A 1I4XA 3Q8CA 2LJIA 2I1JA 3ALBA 3QX1A 1OQQA 1YJ1A 5TSSA 4BKGA 4AWJA 4ZRJA 2MBOA 2FUHB 4RGTA 3T3OA 3RCZA 2MA9B 1SXTA 1V97A 1WGKA 4C56C 4AJYB 1QOAA 1TS2A 4REZA 5EE1A 1FRDA 3B08A 4DBGA 4R3DA 4RH6A 2Z0EB 3RPFC 2ZCBA 2PLPA 4LNKA 1VZ7A 4WIPA 3T3NA 4PYUA 1D5MC 4N9F4 2ACZB 1YX5B 3BK2A 1I7HA 3QHTA 1YOVB 3VUXA 5FR6A 2DYOA 4NJ7A 2MSED 3ZLZA 1E7PB 2CR5A 2ZPYA 1DOYA 2M56B 4BAXA 2HJ1A 1LGRA 4LJOB 3RN9C 3RULA 1D6EC 3ZVVA 4W9KA 2WHIA 3KH0A 5C3JB 2C7NB 3N30A 1C3TA 3NOBA 1P7EA 2LHEA 2KQSA 2LUEA 1KFYB 2DENB 3AULA 4DQOC 2GLSA 3NUHB 3SFDB 3DCGA 3EFCA 3GP7A 1NDDA 4MT5A 3VXWA 5BYQA 1YN5A 5HHDG 4JX1C 2BYTA 3U4EG 3U30A 3DHGC 1J19A 2J52A 1P0RA 4ICVA 3ZRFA 1QT9A 3B9JA 3TIXA 3P4PB 3ZDMC 4W9CA 1QILA 1PDXA 2PW9A 3K9PB 4N58A 4E3CA 1CMXB 4KZCA 4ZDVA 2BKRB 2D10A 4S17A 1LXDA 3ETRA 1HE8A 4NNJB 4A9AA 5JZEB 2KJ6A 3GZNB 3VFKA 5BMHA 3I57A 1FEHA 1SJHD 3HVZA 1K53A 5DPTA 3PV1A 1SIFA 4US9A 1BT0A 2J42A 1ZP0B 1RFKA 2C7HA 3DHHC 2WDVB 2KMMA 2IGHA 1WWTA 2BTEA 3E56A 1MFWA 1ZE3D 3ABVB 4IM2A 1WRIA 1NEKB 3L4PA 3I63C 4NZLB 2BS4B 3HM3A 5D3DA 4W9IA 5GMVA 2GOWA 1Z5SB 1WSPA 2QILA 2O6VB 2AWTA 2IYDB 5G5GA 2L05A 2V3PA 4JPSA 4I6NB 2EKEC 1XD3B 1XF5L 2PE9A 3AN1A 3UQAA 1Y8RC 2PVGC 2WX0A 4G50A 3L08A 2WXRA 1E8ZA 3C8YA 1F0ZA 1R7SA 4P1BC 3ZDTA 1SE2A 1RLFA 1UBIA 2PPHA 3HK0A 3Q3MC 3KW5B 1R4MB 1X1MA 5EE3A 1I4HA 1C4AA 1A5RA 4GN1A 2LUMA 1SGHA 4US8A 3KYCD 1NYQA 2CHXA 1TKGA 1EWYC 4FLHA 2UWQA 3ONSA 1E5WA 1OFFA 2VH1A 3DBHB 5MPOA 1BMLC 1FXIA 1P98A 2J0MA 4TUUA 1WJ4A 2V0GA 1VJKA 2WU2B 2XN9C 3QAQA 4F7ZA 3ZRCA 5C2TB 1MI0A 1F1HA 2WXJA 2WXGA 2O6VA 3H8HA 2REXA 4K7SA 3VR9B 1Y56A 2W55A 1JMLA 2WS3B 1S1QB 1QOBA 3T8MA 2WXMA 4GB9A 1I42A 3RD2A 3H6NA 3KWVA 1JWSD 3VR8B 5D7GA 4IG7B 3UGBB 1MHXA 4DHJD 4YL8A 2KWCA 1WF9A 3TBLD 2NTTA 4BKTA 2LRWA 4HKQA 2WWZA 2Y5PA 4MH8A 5CHFA 1AWDA 2JYTA 5FR3A 5G55A 2Y5CA 2OOBB 3ZYYX 5IO9A 1VD2A 2FCMA 1FCCC 4BKSD 2JY6A 3HIZA 5IP4D 5BMGA 3KVFB 2WDRB 1WXSA 3DBRI 2O2VB 4WURA 3N20C 4MGZE 5H92C 2KC2A 3EGRA 3WAMA 2FUG1 1MVKA 1UD7A 3AV8A 2V9HA 4M0WB 3KQ4A 2E3TA 3AM9A 3VTWA 4OZBA 1N6ZA 2V1YA 4HCPB 3AXCA 2OJWA 4PS7A 4YSYB 3TEYA 3W1YA 2NBWB 1GOZA 3AE3B 4NPNA 2DAFA 3SR6A 2WXKA 3NVWA 2GMIC 4WWMA 2KVRA 5BMIA 2ON8A 3TJPA 2BVCA 5G2NA 1YJIA 2KDBA 2CJOA 4HK2A 3BYTB 4UDUC 4ASWC 2J7QB 1ENFA 4K3BA 4OVZA 2JVCA 1V8CA 3NVYA 2N7DA 1ESFA 2WGSA 3CF6E 3IT6B 1V86A 1F2RC 4F1SA 2K5PA 4JWUC 3CMMB 2DHZA 4FADA 3S2AA 3QCAA 3LB8C 2O2VA 2LD9A 4TSSA 3EHVA 1IBXB 3HRDD 4PT5A 4M0WA 2BQQA 2NPTB 3DQVA 2CS4A 1JRUA 2FE8A 1UUPA 1WJUA 3URYA 2WXFA 4EKUA 4K7WA 2JPHA 4ANXA 1JW9D 4RNAA 4KSLC 2W9NA 1RRBA 1JWBD 2M19A 5T8IA 1A70A 1HZ5A 2JF5A 4WQMA 4HRSA 5AZGA 1FXTB 5E6NA 2M17A 1C79A 2L52A 2VH2A 1WYWB 3SDLC 4KIKB 4TQ1A 3OAWA 1FMAD 2BYVE 1ET9A 1E90A 3RFZB 2G9HD 1VCBA 3AEFB 1RAXA 3Q8AA 4XGAB 1WXAA 1AARA 1IBXA 3BINA 1WXQA 2NPTA 3R7QA 3U2SC 4XWTA 1LFDA 3DBSA 4A8XC 2WDQB 2Y5BB 2LJ5A 2ZNVC 1QZEA 3ZQ4A 2MCNB 4LNFA 3M95A 2BB6A 4A55A 2JQRB 2NR2A 2D3GA 4RMAA 1IGDA 3W5VB 1PFDA 2IGDA 4LDTD 3IAM1 2AX5A 4GDLB 3TEXA 3AE4B 1J8CA 4HWIB 1XQQA 4DXAB 1V81A 3B1LX 2KYWA 4OVVA 3Q69A 2DZIA 2K0PA 4DXFA 3EA6A 2IO0B 3J9CA 2J0KA 4HCNB 5CX3A 4KIKA 4XE0A 2INNE 1XLNA 4LTUA 4BBNF 2ZW0A 3PHWB 5LLIA 1VR9A 2L1AA 3APDA 2IBIB 1NBFC 4I6PA 2KJHB 1XCTL 1QLBB 2KTRB 4P7IA 2LWPA 2GRIA 4FXCA 2YEPB 5LXHA 1FNUA 1EU3A 3VH4B 1R4NB 2KN4A 4WJOA 3WAPA 1M4VA 1N61A 2R2QA 4YSXB 3KLSX 2ZEQA 3Q3JA 3RYTA 1WM2A 3KUDB 1YJJA 2MJ3A 3IVFA 2LXCA 1I35A 1L6VA 2G45B 1QOFA 3WCQA 4KGSA 3RNEC 4GDLA 4W9DA 3V05A 1CQVA 2SAKA 2MBQA 4KX6B 3E9SA 1I4GA 4GSWA 3BVMA 1L4ZB 4OZCA 2MBBB 1V5TA 3TSSA 1XLOA 3VHTC 2NBUA 4FHKA 1P7FA 1GB1A 1TZOA 3AE9B 1J7AA 4K7UA 3R2IA 1AYFA 4YTMB 2KTRA 3SHQA 3NVZA 2KDFB 3A1QB 1QKZA 3GS2A 1ET6A 3MFGA 3RNCC 2KC1A 3QK0A 2A4ZA 3QWZB 1SF0A 3SD5A 1TYGB 4PYZA 1FPYA 1STEA 4HPPA 4C80A 1KLGD 2OHFA 3N32A 1WYGA 2W3SA 3PT2B 3Q3FA 4XC2A 4AS1A 5J17A 3BWUD 4N6EB 4KV2A 2L83A 1SE3A 2N0SB 4XZ4A 3V6EB 1E9MA 2K8BA 4WAFA 5DCNA 1SEBD 1C4CA 2E6XA 5DPRA 2Z0DB 3PRMB 4K3CA 3AE5B 3D32A 5C23A 1PGAA 2BS2B 4BOZB 3A1QA 5L95C 4CHKA 4BBNC 4B0MA 1ZW7A 2N4FA 4ZRKA 1D4BA 4A6QA 2W82A 1PQSA 3AE7B 1EM7A 4GOCA 4AJWA 3P63A 5LNK1 3Q6BA 2LGXA 1KOTA 3JSVB 1FM0D 3U7ZA 5BO4B 4IDIA 3EFUA 2J53A 4LJPB 4YTNB 1T3QA 1WE6A 4MEMA 5AZHA 5E6JA 3KWLA 2BYEA 3ZTDA 3VDZA 2LMCA 2WNMA 3PPAA 3SEBA 4IUMB 3MJWA 5G5HA 4ANUA 3P4QB 3TMPB 2K6DB 2BF8B 5BYSA 3L54A 1N62A 2KDIA 3P42A 3BK1A 3PGEA 4B0EA 1UGJA 2L76A 5JHAA 4GLSC 4F8CB 1TGZB 2I1KA 1WX8A 2EMTA 3ML9A 4DHJB 3VAWA 2KACA 4BFRA 3UI3A 1WJ6A 1ZDXA 2IY1B 2IDYA
chains in the Genus database with same CATH topology
1BXTA 4LLGM 4EE2A 5C2TB 1MI0A 1IUEA 3AEEB 1VRAB 2BW2A 1ACCA 2D5GA 1B1ZA 1GPXA 1J7CA 2WXJA 2WXGA 3H8HA 3DWGC 4HKZE 2VZKB 3VR9B 1Y56A 1HQRD 1FFUA 2JSVX 2PTLA 2W55A 1N63A 1JMLA 2WS3B 2PMVA 2R61A 1EWCA 3HVDA 1F77A 1GT8A 2H88B 1QOBA 2WXMA 5FKAC 4C7YA 3KWVA 1KH0A 3IT4B 1JWSD 1QOGA 3VR8B 5D7GA 4MM3B 1MHXA 1FNVA 1VZ8A 3P1MA 3GB1A 1KRHA 3AE2B 2BB5A 2NTTA 1FXAA 1N5WA 1LO5D 1XO3A 1DOXA 2DLBA 3LXFA 4HKQA 1YQ3B 4MH8A 2MH7A 2Y5PA 1RWSA 2AQ3B 3I9V1 1RYJA 3MC0B 4A90A 2VZKD 1JWUD 2Q5WD 1AWDA 2JYTA 2HTME 3PO0A 4XDDA 2AQ2B 5FR3A 4YSZB 2PIAA 1SIJA 4YTPB 2Y5CA 1TKEA 3ZYYX 4NAMA 2WXLA 2JXTA 4Q2JA 4ITKA 1FCCC 2JU6X 4O1NA 3AH7A 5I4DA 1EU4A 2X38A 1E10A 1VZ6A 2WLBA 5BMGA 4L1BA 2WDRB 2DWQA 2W3RA 2JYEA 1K50A 3W1SA 4WURA 4ZRQA 1HXYD 5H92C 2MEKA 3EGRA 2FUG1 4RGOS 1MVKA 2NTSA 1K52A 3AV8A 3KQ4A 5EE0A 2B76B 2E3TA 2V4IB 3AM9A 1TS5A 2GB1A 3LYYA 3MHZA 4OZBA 5D3IB 1VDVA 3TUOA 1GTHA 2W54A 3AE1B 2JX5A 4YSYB 4ZHPA 3TEYA 1RM6C 5H8YE 1ZXHA 4L2YA 1GOZA 1ROEA 3AE3B 3SR6A 1KF6B 2WXKA 3NVWA 4KGTA 4JWSC 2G1EA 2I38A 4WWMA 5BMIA 1YMHE 2ON8A 1N5XA 1JWMD 1FNWA 3VQIA 1YJIA 3U52E 3SFEB 2CJOA 3BYTB 4UDUC 1ENFA 2V3NA 2EELA 3NS1A 4OVZA 1FCLA 1V8CA 3NVYA 4HROA 1SSNA 3AEDB 3AE6B 1ESFA 1SJED 2Y3AA 3IT6B 1F2RC 2JZPA 2QIEB 1B9RA 3BVGA 2PKOA 3NVVA 2K3UA 1JROA 2BT6A 2K5PA 3EUB2 1C9FA 4OHJA 1ZUD2 2N7JA 4JWUC 3NZ3A 1YN3A 4OW0A 5FK9C 3AEAB 3AE8B 2MJDA 1I4QA 2KDMA 4J3OD 4ZRPA 1UNSA 3LB8C 2WXPA 4IKGA 1TY0A 4DXGA 1L4DB 2NMQA 3CF4A 4TSSA 1XLPA 1IBXB 4WH4A 2WU5B 1NYRA 3HRDD 3N9YC 4PT5A 4RCOA 4M0WA 3MP9A 1T5XD 4AQ7A 4RF1A 2FE8A 1UUPA 3TEZA 3URYA 1FRRA 2RDHA 2WXFA 1SB3C 1AW7A 4H2AA 2DYMA 4YXDB 1DOIA 2SEBD 1JW9D 4RNAA 4RGNA 3ZJVA 3MJ5A 2M19A 1JWBD 5T8IA 2WP9B 1C77A 3FAHA 1A70A 1HZ5A 1H7XA 4P6VF 1D5XC 4WQMA 1NENB 3AECB 4HRSA 4CQNA 3CWIA 1C76A 3BYYB 1E0ZA 2ONQA 1UWXA 1ZDVA 4HEA1 1C79A 2L52A 1V1PB 2IGGA 4TMAB 3W5UB 1YQ4B 4TQ1A 3BIID 1FMAD 1E6EB 4D2KA 3BVZA 2QEJC 3Q8FA 1ZOYB 1ET9A 1TS3A 3VRAB 4JE3B 3RFZB 1IGCA 4ARCA 5HG2A 1QF6A 2H89B 2G9HD 1UWMA 3AEFB 1SE4A 3Q8AA 3Q8EA 2XNAC 3CIRB 1FO4A 1T6BX 2PVOD 1IBXA 1I4XA 1GTEA 3Q8CA 2LJIA 1WXQA 1K51A 3U2SC 2LFIA 4XWTA 4L23A 1OQQA 4A8XC 1FFVA 2WDQB 3OWEB 3ZQ4A 1FIQA 3AMZA 3Q8BA 1MHHE 5TSSA 2WXNA 4TQ0A 3DWMA 3AEBB 2BB6A 1AN8A 2JQRB 4A55A 1QQRA 1TS4A 5AUIA 2K9XA 4RGTA 3W9CB 1XCQL 3T3OA 1IGDA 3W5VB 1PFDA 2IGDA 4RFBA 5HI1A 1SXTA 3W2DA 1V97A 1WGKA 2AX5A 3IAM1 1I4PA 4C56C 4GDLB 3TEXA 3AE4B 1QOAA 4KKJA 1TS2A 4REZA 5EE1A 1TY2A 1C4PA 1FRDA 5HFYA 3Q69A 2RMMA 2K0PA 4R3DA 1V1PA 3EA6A 3J9CA 4RH6A 4DXFA 1CJEA 1FD6A 1XLQA 3RPFC 4XE0A 1XEEA 2INNE 1KLUD 1XLNA 2BS3B 4LTUA 2PLPA 2ZW0A 1VZ7A 1VR9A 2L1AA 4WIPA 3T3NA 1D5MC 2ACZB 1I4RA 3BK2A 1TJEA 1XCTL 1I7HA 1QLBB 5JXVA 2K22A 3R2TA 4NAWB 4YT0B 2DYOA 2GRIA 3FC4A 4FXCA 1MPEA 1HZ6A 2YEPB 1FNUA 1EU3A 1ZXIA 2I2YA 3IXSA 2KN4A 1E7PB 1L0YB 4XWWA 1M4VA 1N61A 1DOYA 4YSXB 3KLSX 2M56B 3NRZA 1YJJA 2IJ0A 1D6EC 2MJ3A 2Z8LA 1YN4A 1L6VA 5C3JB 1ZPSA 1QOFA 3WCQA 4MACA 1P7EA 4KGSA 2LHEA 1DYQA 2WXQA 3P4RB 3V05A 2WQYB 1CQVA 2SAKA 4KX6B 1PGXA 3E9SA 1KFYB 2DBYA 2IPKD 1PGBA 4LK0M 1I4GA 4DQOC 3NUHB 4HJGE 3BVMA 3SFDB 3GP7A 1L4ZB 4OZCA 2QSDA 4MT5A 3TSSA 1XLOA 5BYQA 1YN5A 1L0XB 2KWDA 5HHDG 1P7FA 2WXOA 1GB1A 4JX1C 2BYTA 1TZOA 3AE9B 1J7AA 3U4EG 1OQRA 3R2IA 2J52A 1AYFA 3IAS1 4YTMB 4NJCA 3NVZA 2QJLA 2N9KA 1QT9A 1QKZA 1PUTA 1ET6A 3GS2A 2RDGA 1YNTE 3MFGA 3B9JA 5GXGB 3BZDB 3P4PB 3ZJUA 1SF0A 1QILA 4P16A 1PDXA 2AQ1B 2PW9A 1TYGB 1KTKA 4N58A 2KQ4X 1STEA 4YWGG 2CJNA 3ETRA 4C80A 4A9AA 1KLGD 2OHFA 1WYGA 1L5PA 5BMHA 3I57A 2W3SA 1FEHA 1L6UA 1JWAD 1SJHD 3HVZA 4USAA 2INPE 1JQ4A 1K53A 2FBWB 3TEWA 4AS1A 3V3XA 3BWUD 4N6EB 3ZGZA 2L32A 4ZYSA 1GB4A 1JRPA 2L83A 1SE3A 2N0SB 2YEPF 3B2FA 4RF0A 3AEGB 4US9A 3PZ8A 1E9MA 3PZ7A 4WAFA 2EKIA 2J42A 2J4XA 1ZP0B 1SEBD 1C4CA 5BYRA 1RFKA 2BBCA 3VRBB 2E6XA 1JCKB 3ZJTA 1H7WA 3FILB 2WDVB 3AE5B 4XDCA 2KMMA 2IGHA 1WWTA 2BTEA 1PGAA 3E56A 1PYWD 2BS2B 1ZE3D 3ABVB 1NVID 3B2GA 3AB5A 1JALA 4KGRA 1WRIA 2RPVA 3HUIA 2JWUA 4B0MA 1NEKB 3L4PA 1HA5A 4NZLB 2BS4B 2LEKA 5D3DA 1Q10A 1D4BA 4A6QA 2W82A 1TKYA 3AE7B 1WSPA 2QILA 1EM7A 1F2RI 1SBBB 1GAQB 1HEZE 2GI9A 5G5GA 3P63A 5LNK1 2V3PA 4JPSA 1XF5L 1L0VB 1V1OA 3AN1A 2MJEA 2PVGC 1FM0D 3U7ZA 3R8BA 4IDIA 2J53A 2WXRA 2ICIA 1C78A 3C8YA 4YTNB 1T3QA 1R7SA 1F0ZA 2LGIA 1XXGA 1BUIC 5E6JA 3KWLA 1SE2A 1CK1A 5AUKA 4RGMA 2LMCA 4ZHOA 1J7BA 2WNMA 4OZAA 3SEBA 5G5HA 4KKIA 4IOIE 2WXIA 3P4SB 1CZPA 3P4QB 2M0AA 5EE3A 1I4HA 1C4AA 4GDKB 1VLBA 5BYSA 2LHDA 4N59A 2TSSA 3FILA 1N62A 2LUMA 2OEDA 4US8A 3P42A 1NYQA 2ZW1A 3BK1A 4B0EA 2N9LA 1TKGA 1UGJA 4ZOHC 1EWYC 3O13A 1DGJA 2CU3A 2QMTA 4GLSC 1NI3A 1N60A 2WXHA 5EE9A 2KAJA 4C7ZA 1OFFA 2KACA 5MPOA 1BMLC 1FXIA 2HDEA 3UI3A 4ARIA 2V0GA 1VJKA 1D5ZC 2WU2B 2XN9C 1ZDXA 2IDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C80 A;  4A9A A;  5C2T B;  1FRD A;  1IUE A;  1WYG A;  3AEE B;  1L5P A;  2OHF A;  2PKO A;  3NVV A;  1GPX A;  1J7C A;  1JRO A;  2BT6 A;  1L6U A;  2K5P A;  2W3S A;  3EUB 2;  1ZUD 2;  1JWA D;  3DWG C;  3HVZ A;  4JWU C;  4USA A;  3VR9 B;  1FFU A;  1JQ4 A;  2W55 A;  1CJE A;  2FBW B;  3AE8 B;  3AEA B;  1N63 A;  2MJD A;  2WS3 B;  1XLQ A;  3RPF C;  4N6E B;  1JRP A;  3LB8 C;  2L83 A;  1XLN A;  1GT8 A;  2BS3 B;  2H88 B;  1QOB A;  2N0S B;  4LTU A;  3B2F A;  3CF4 A;  4C7Y A;  3AEG B;  1XLP A;  4US9 A;  2WU5 B;  1E9M A;  1NYR A;  3HRD D;  1QOG A;  3VR8 B;  2ACZ B;  2EKI A;  1ZP0 B;  1TJE A;  1I7H A;  3P1M A;  1QLB B;  1RFK A;  3VRB B;  1KRH A;  2K22 A;  3AE2 B;  1FRR A;  4YT0 B;  1H7W A;  3FC4 A;  1SB3 C;  4FXC A;  2WDV B;  1FXA A;  1N5W A;  1ZXI A;  3AE5 B;  4YXD B;  1XO3 A;  1DOI A;  1DOX A;  2KMM A;  1JW9 D;  1E7P B;  1WWT A;  3LXF A;  1YQ3 B;  1N61 A;  2MH7 A;  1DOY A;  2BS2 B;  1RWS A;  4YSX B;  1JWB D;  2M19 A;  2M56 B;  3ABV B;  1NVI D;  1RYJ A;  2WP9 B;  3FAH A;  3B2G A;  3AB5 A;  2Q5W D;  1JAL A;  1AWD A;  1WRI A;  3HUI A;  3NRZ A;  2HTM E;  1A70 A;  3PO0 A;  1H7X A;  1NEK B;  1YJJ A;  4YSZ B;  3L4P A;  2PIA A;  4P6V F;  2MJ3 A;  4WQM A;  1NEN B;  3AEC B;  1SIJ A;  2BS4 B;  2LEK A;  4HRS A;  3CWI A;  4YTP B;  2Y5C A;  1TKE A;  1L6V A;  5C3J B;  3ZYY X;  1E0Z A;  1QOF A;  1TKY A;  3WCQ A;  3AE7 B;  4ITK A;  3AH7 A;  1E10 A;  2L52 A;  1GAQ B;  2WLB A;  3W5U B;  5G5G A;  3P4R B;  3P63 A;  2WQY B;  1YQ4 B;  2WDR B;  2DWQ A;  4KX6 B;  1L0V B;  1KFY B;  2DBY A;  2W3R A;  3AN1 A;  3BII D;  1FMA D;  2MJE A;  1E6E B;  2PVG C;  1FM0 D;  3SFD B;  5H92 C;  1ZOY B;  3VRA B;  3AV8 A;  4IDI A;  1F0Z A;  4YTN B;  1T3Q A;  1R7S A;  1XLO A;  2B76 B;  2E3T A;  3AM9 A;  5EE0 A;  2H89 B;  1QF6 A;  1UWM A;  3AEF B;  3KWL A;  5AUK A;  4ZHO A;  1VDV A;  3CIR B;  1J7B A;  4JX1 C;  1FO4 A;  2PVO D;  1GTH A;  2W54 A;  5G5H A;  1GTE A;  3AE9 B;  1J7A A;  3AE1 B;  3P4S B;  4YSY B;  1OQR A;  1CZP A;  3P4Q B;  1WXQ A;  2JX5 A;  5EE3 A;  4ZHP A;  1RM6 C;  1AYF A;  5H8Y E;  1OQQ A;  4YTM B;  1ROE A;  1VLB A;  3AE3 B;  2WDQ B;  1FFV A;  3NVZ A;  2QJL A;  1KF6 B;  4N59 A;  3NVW A;  3SR6 A;  4JWS C;  1FIQ A;  2G1E A;  1N62 A;  3AMZ A;  4WWM A;  4US8 A;  1QT9 A;  1NYQ A;  1PUT A;  3DWM A;  1N5X A;  1TKG A;  3B9J A;  5GXG B;  3AEB B;  4ZOH C;  1YJI A;  1EWY C;  3SFE B;  3P4P B;  1DGJ A;  2JQR B;  2CU3 A;  2CJO A;  1SF0 A;  5AUI A;  1NI3 A;  2K9X A;  3W9C B;  1PDX A;  3W5V B;  1N60 A;  1PFD A;  3NS1 A;  1TYG B;  5EE9 A;  2KAJ A;  1V97 A;  1OFF A;  1V8C A;  1WGK A;  2AX5 A;  1FXI A;  3NVY A;  4HRO A;  4C7Z A;  4N58 A;  5MPO A;  3AED B;  3AE6 B;  1VJK A;  2WU2 B;  3AE4 B;  1QOA A;  2CJN A;  5EE1 A;  3ETR A;  1B9R A;  2QIE B; 
#chains in the Genus database with same CATH topology
 1BXT A;  4EE2 A;  1B1Z A;  1GPX A;  1J7C A;  3X0W A;  2AYO B;  2KAN A;  3U8Z A;  1H8C A;  2R61 A;  2JUO A;  1KJT A;  3M62 B;  1GT8 A;  3JSV A;  5FKA C;  4C7Y A;  3LDZ E;  1KH0 A;  4W9F A;  3QJZ A;  3APF A;  3PSE B;  3KYD D;  1FNV A;  1VZ8 A;  3P1M A;  2DYB A;  2KQ7 A;  4FA6 A;  3AE2 B;  2BB5 A;  1LO5 D;  1DOX A;  2N9P C;  4C4V B;  3I9V 1;  1RYJ A;  4NJ6 A;  4A90 A;  2VZK D;  2HTM E;  4FJZ A;  4E71 A;  2PIA A;  2KHW B;  2WXL A;  2JXT A;  2LI5 A;  1VZ6 A;  3ZKJ C;  4C00 A;  1C1Y B;  2IZV B;  2W3R A;  4LNO A;  3W1S A;  1WXV A;  4RGO S;  2NTS A;  2FAZ A;  5EE0 A;  2B76 B;  1IP9 A;  4S0R A;  3ZO5 B;  3OG5 A;  3MHZ A;  2M4N A;  2RDB C;  5D3I B;  1VDV A;  3RMK C;  4A3O A;  1GTH A;  4BKS A;  1WX7 A;  3PLV A;  1MG4 A;  1WX9 A;  2JX5 A;  1UEL A;  3L10 B;  1RM6 C;  2FCS A;  1ZXH A;  4L2Y A;  1ROE A;  4MGK E;  1YD8 U;  4W9E A;  1YMH E;  4G3X B;  1FNW A;  3VQI A;  3U52 E;  4GU2 A;  4C4V A;  2KX3 A;  1P3Q U;  3L17 A;  4W9H A;  1SSN A;  2JT4 B;  3AE6 B;  3QQ8 B;  3BVG A;  2PKO A;  3JW0 X;  3NVV A;  2UYZ B;  1JRO A;  2BT6 A;  3EUB 2;  4OHJ A;  2N7J A;  2KT7 A;  1YN3 A;  5FK9 C;  1GC7 A;  2QHO A;  4CYE A;  3IHP C;  4IM3 A;  4DXG A;  3CF4 A;  3VH3 B;  1XLP A;  4M02 A;  4WH4 A;  2WU5 B;  3N9Y C;  4RCO A;  3DBR B;  3MP9 A;  1T5X D;  2FCQ A;  4RF1 A;  2N7E A;  3V61 A;  3GOE A;  3RI7 C;  3H7S A;  1SB3 C;  3C19 A;  3N1Z C;  4IM0 A;  2A5U A;  3OLM D;  1DOI A;  2SEB D;  2WX1 A;  1Q1O A;  3DVN U;  4RGN A;  1C77 A;  1GNU A;  4DWF A;  1WR1 A;  1H7X A;  4P6V F;  1NEN B;  4CQN A;  2MW5 A;  4GGQ A;  1OEY A;  1UWX A;  1ZKH A;  1ZDV A;  1V1P B;  4HDO A;  2HJ8 A;  3N1Y C;  5E6P A;  4MGI E;  4D2K A;  2QEJ C;  3Q8F A;  1ZOY B;  3UIO B;  1TS3 A;  4LDT B;  3VRA B;  4JE3 B;  4JQW C;  3RNF C;  2NBV B;  1QF6 A;  1UWM A;  4EOY A;  2D07 B;  4GIV A;  2Z59 B;  3Q8E A;  2LZ6 A;  2XNA C;  2PVO D;  3UF8 A;  1GTE A;  1K51 A;  3V6C B;  2LFI A;  2MBH A;  5DPW A;  3CST A;  3OWE B;  2FCN A;  4MH0 E;  1FIQ A;  3AMZ A;  2ZZP B;  5IN7 A;  3AEB B;  2QCZ A;  2MBE A;  5CHW A;  1AN8 A;  2INC C;  3DVG X;  1TS4 A;  2K9X A;  4RFB A;  1WR6 E;  3DVN V;  2KJR A;  1I4P A;  4KKJ A;  4OVU A;  1TY2 A;  3ZUN A;  1C4P A;  4W9G A;  1T0Y A;  4HVB A;  1V1P A;  3IG3 A;  3DVG Y;  1CJE A;  4HPM B;  3DOW A;  3UQB A;  4K1R B;  4M00 A;  1WE7 A;  3V60 A;  1V9J A;  4P1C C;  1I4R A;  2HTH A;  1TJE A;  5D2M B;  2K22 A;  4NAW B;  2ZVO A;  4YT0 B;  3KUC B;  1ZXI A;  3R66 C;  3IXS A;  3DBL I;  4ANW A;  1H4R A;  2LGD A;  4FN2 A;  4LNN A;  3NRZ A;  2C9W B;  1E7V A;  2ZVN A;  1ZPS A;  2N1W A;  4WWN A;  2WXQ A;  3O65 B;  2WQY B;  3A4S C;  1E8Y A;  2GBM A;  2LAS A;  1E8X A;  2L3Z A;  2KKC A;  2KWD A;  1L0X B;  3ZXV A;  3FKY A;  2WXO A;  1EO6 A;  4K81 A;  5JH5 C;  1WMH B;  4NJC A;  2RGF A;  4EEW A;  2QJL A;  2BKF A;  2LGY A;  2RDG A;  1U4A A;  1YNT E;  2KMC A;  5TR5 A;  2MRP A;  5GXG B;  3DDC B;  1OEY J;  1UZX B;  3R7R A;  4P16 A;  1WI0 A;  2KQ4 X;  4YWG G;  1TT5 B;  2CJN A;  2GBN A;  2QDF A;  3VUY A;  3QA8 A;  2FBW B;  3TEW A;  3V3X A;  2L32 A;  3PZD A;  4ZYS A;  4DHZ E;  1JRP A;  5JHB A;  1GB4 A;  3B2F A;  2L0T A;  1Z2M A;  4RF0 A;  5E6O A;  2DZK A;  3PZ7 A;  2EKI A;  3M63 B;  2IO2 B;  2BBC A;  2L7R A;  2RPQ A;  3ZJT A;  1H7W A;  3FIL B;  1UF0 A;  2PEA A;  4NY0 A;  4E74 A;  3LJ3 A;  4IWQ A;  2LVO A;  4MJS B;  4B9K A;  1WMH A;  4KDI C;  2KO3 A;  1NVI D;  3AB5 A;  1JAL A;  3RZF A;  2JWU A;  5IOI A;  2L0F A;  1HA5 A;  3KUZ A;  2LEK A;  3N1X C;  3QIJ A;  1F2R I;  1SBB B;  1GAQ B;  3WAL A;  2KWV B;  1HEZ E;  2GI9 A;  1L0V B;  1V1O A;  1YX6 B;  2MJE A;  3WAN A;  2XK5 B;  1V80 A;  2K8C A;  2IND C;  2ICI A;  2LGI A;  1XXG A;  4GMV A;  3PLU A;  2ZNV B;  1CK1 A;  3AU4 A;  5AUK A;  4RGM A;  1KLV A;  2WXI A;  1CZP A;  3QAR A;  2BYF A;  1VLB A;  2LGS A;  3FIL A;  4W9J A;  2N9L A;  4MJS A;  4ZOH C;  3O13 A;  4M01 A;  1N60 A;  2WXH A;  4A20 A;  4II2 B;  2HDE A;  4ARI A;  2XBB C;  3ZTC A;  4LLG M;  4ANV A;  3AEE B;  1VRA B;  1ACC A;  3DWG C;  4HKZ E;  2VZK B;  2PTL A;  5IKC M;  3HVD A;  2PMV A;  1WXM A;  2BPS A;  1F77 A;  2XK5 A;  5IAA C;  5J2R A;  1QOG A;  4MM3 B;  1OQY A;  2JZZ A;  1KRH A;  3WIM A;  3AU5 A;  4NQK E;  3NZU A;  1FXA A;  3IFW B;  1V5O A;  4FJV B;  2BWE S;  4DK5 A;  2AQ3 B;  3MC0 B;  1JWU D;  3PO0 A;  4XDD A;  2AQ2 B;  4YSZ B;  2LVQ A;  3MTN B;  1SIJ A;  5EDS A;  4YTP B;  2CU1 A;  4M8M A;  4JGH B;  4ITK A;  4O1N A;  2X38 A;  1E10 A;  2WLB A;  4L1B A;  3A9K B;  2DWQ A;  3VTU A;  1V2Y A;  2MEK A;  1K52 A;  3QC8 B;  3NHE B;  2V4I B;  1TS5 A;  5D94 A;  3LYY A;  2LVP A;  4A3P A;  1MJD A;  2N9E B;  2W54 A;  4FJY A;  4MM3 A;  2HE7 A;  3HHM A;  4PS8 A;  2K39 A;  4KGT A;  4JWS C;  2I38 A;  4MSQ B;  2KFJ A;  3W1S C;  4KSK C;  4EFO A;  4RM8 A;  2JRH A;  3CSF A;  3NS1 A;  3NZS A;  3NS8 A;  4HRO A;  2Y3A A;  2JZP A;  2QIE B;  5J18 A;  1B9R A;  1G6J A;  3SU8 X;  1NI2 A;  2NS5 A;  2K3U A;  1C9F A;  1ZUD 2;  1F52 A;  1WGR A;  4OW0 A;  3A9K A;  5L83 A;  5LXI B;  2KDM A;  4J3O D;  1UNS A;  3ZW3 A;  1TY0 A;  1L4D B;  1J0G A;  2G4S A;  2BGF A;  4XX5 A;  4AQ7 A;  4WWO A;  4G11 A;  4X57 B;  4H2A A;  2HD5 B;  2DYM A;  3ZJV A;  2GBK A;  3UIP B;  3VUW A;  2WP9 B;  2IO1 B;  1D5X C;  2K6Q A;  3AEC B;  3VTV A;  1C76 A;  3BYY B;  2MWS B;  1E0Z A;  2IY0 B;  1XT9 B;  2PJH A;  2M0X A;  3K9O B;  2MX2 A;  4I6L B;  1SE9 A;  2IGG A;  4TMA B;  3W5U B;  1YQ4 B;  1K8R B;  2CHW A;  4FHJ A;  1E6E B;  1HTQ A;  3BVZ A;  3ZIM A;  3C0R B;  1V49 A;  1IGC A;  4ARC A;  2V3S A;  1UH6 A;  5HG2 A;  1SE4 A;  1T6B X;  4FBJ B;  1D3Z A;  3UIN B;  2DNF A;  4L23 A;  1FFV A;  3Q8B A;  1MHH E;  5DPS A;  2WXN A;  1WGH A;  4TQ0 A;  1L7Y A;  1T0R C;  3DWM A;  3MC9 A;  1IPG A;  1QQR A;  5AUI A;  3W9C B;  1XCQ L;  1TZ1 A;  1Q5W B;  5HI1 A;  3W2D A;  1OTR B;  1GUA B;  2KXJ A;  2GBJ A;  4TV3 A;  1V6E A;  3T9L A;  3RUI B;  1Q0W B;  2GBR A;  5AZF A;  5HFY A;  2RMM A;  4LNI A;  4IWO A;  3NG0 A;  3L16 A;  2JZ3 B;  1FD6 A;  1XLQ A;  1XEE A;  1KLU D;  2BS3 B;  5CTR C;  2JWZ A;  2X8X X;  4ZRI A;  2KTF A;  5JXV A;  3TL5 A;  3R2T A;  2L00 B;  3FC4 A;  3NY5 A;  1MPE A;  1HZ6 A;  3RNB C;  2I2Y A;  3ECI A;  3MHS D;  1WM3 A;  1WFY A;  1L0Y B;  4XWW A;  3GE8 C;  1UGM A;  4M8N A;  3GZN I;  2KN5 A;  2OJR A;  2IJ0 A;  2Z8L A;  1YN4 A;  1LQB A;  1LM8 B;  3GE3 C;  4B95 A;  4MAC A;  2RD0 A;  2KX0 A;  3PRZ A;  4JIO U;  1DYQ A;  3HM6 X;  3TCA A;  3P4R B;  2KLG A;  1PGX A;  1RFA A;  2DBY A;  2IPK D;  1PGB A;  4LK0 M;  4HJG E;  4ICU A;  3B0A A;  2AL3 A;  4B6W A;  1P1A A;  2QSD A;  3JYU A;  5C1Z A;  3H7P B;  2KOX A;  4EUT A;  4KVG B;  3PS6 A;  5CHV C;  2FID A;  5HKH A;  1OQR A;  2C5L C;  3IAS 1;  1TIF A;  2N9K A;  1MG8 A;  1PUT A;  2DZM A;  4DDI D;  3BZD B;  2D3C A;  4AP4 C;  2JXX A;  4GXB A;  3ZJU A;  2AQ1 B;  1GC6 A;  3DPD A;  1KTK A;  3DBL B;  2NCN A;  5IA7 A;  1WY8 A;  3X23 A;  1L5P A;  1EF1 A;  4KZ0 A;  1L6U A;  1JWA D;  3VVW B;  4USA A;  2V4L A;  2INP E;  1JQ4 A;  3PTF C;  2ASQ A;  3ZGZ A;  2L8J A;  1R4M I;  2YEP F;  2DZJ A;  2EMS A;  3AEG B;  5D6J B;  3PZ8 A;  3RNA C;  2DX5 B;  2J4X A;  1YQB A;  2N1V A;  3H7P A;  5BYR A;  3RNG C;  3VRB B;  3NJT A;  1JCK B;  2KWU B;  2M1M A;  3L13 A;  3A9J B;  3Q14 C;  2FIF A;  1WZ3 A;  4XDC A;  4HDQ A;  3DBH I;  1S3S G;  2D3B A;  3L0W B;  1PYW D;  2R2O A;  2LXA A;  3B2G A;  4KGR A;  2RPV A;  3HUI A;  3ZNG C;  3Q2A C;  2MQJ A;  1ZGU B;  3BY4 B;  1Q10 A;  2DAJ A;  1TKY A;  3ML8 A;  4JL9 A;  1T0Q C;  4ACF A;  4II3 B;  3R8B A;  1WH3 A;  1C78 A;  2K1F A;  1BUI C;  2KK8 A;  2CHZ A;  4JLC A;  2C7M B;  4ZHO A;  1J7B A;  4OZA A;  1EF5 A;  4KDL B;  3WAO A;  4KKI A;  4BZA A;  4IOI E;  4PK1 A;  2ZCC A;  3P4S B;  2M0A A;  1UBQ A;  4GDK B;  2O6V D;  2LHD A;  4IC7 B;  3A9J A;  4N59 A;  2TSS A;  2OED A;  3MC8 A;  3RZW C;  3I3T B;  2ZW1 A;  4BVU C;  3ZNZ B;  1DGJ A;  2KLC A;  2CU3 A;  2QMT A;  4FUL A;  1NI3 A;  2AEH A;  4NQL B;  5EE9 A;  2KAJ A;  3AI5 A;  4C7Z A;  1ISN A;  3OJ3 A;  3M3J A;  3V62 A;  1D5Z C;  1OGW A;  1TTN A;  3EC8 A;  1IUE A;  2BW2 A;  1GJZ A;  2D5G A;  2N9X A;  2G3Q B;  2JSV X;  2PE6 B;  1HQR D;  1FFU A;  4NAW A;  3WA0 A;  1N63 A;  4LCD E;  1EWC A;  3JVZ X;  2KVZ A;  2H88 B;  2RR9 A;  2YLM A;  3IT4 B;  2MLB A;  3EEC A;  1WGD A;  4HJK A;  3H9D A;  3APC A;  3PRP B;  3GB1 A;  2MP2 B;  2B3A A;  2UU7 A;  1N5W A;  1XO3 A;  2DLB A;  3LXF A;  1YQ3 B;  2MH7 A;  4GDK A;  2AL6 A;  1RWS A;  1WJN A;  2K25 A;  4HLE A;  2Q5W D;  4EZJ A;  4IWP A;  4WWP A;  1WGG A;  2YVC A;  1E7U A;  3P2B A;  3ZNH B;  1TKE A;  4NAM A;  2D3A A;  2KNB A;  4Q2J A;  2KDE B;  2LRU A;  2JU6 X;  5I4D A;  3AH7 A;  1EU4 A;  4RM9 A;  1M94 A;  5KHO A;  2JYE A;  1K50 A;  4WQO B;  4ZRQ A;  2BWF A;  1HXY D;  2KFK B;  3PHX B;  1WGY A;  1WRD B;  3I5J C;  2ZPN A;  1YIW A;  1TBE A;  2GB1 A;  1KM7 A;  2G4D B;  3N3K B;  4WJN A;  4AUQ C;  1WIA A;  3TUO A;  3ZXR A;  3AE1 B;  2MHJ A;  4ZHP A;  5H8Y E;  4PS3 A;  4DHZ B;  2MP2 A;  1KF6 B;  2G1E A;  4MSM B;  4DDG D;  4WJP A;  1N5X A;  1JWM D;  1L2N A;  4IW0 A;  3SFE B;  2V3N A;  2EEL A;  4XYC A;  1FCL A;  4BOS C;  3AED B;  1E8W A;  1SJE D;  1WZ0 A;  2K8H A;  3R3M A;  3Q3O C;  2WDT B;  2VRR B;  4W9L A;  4HXD A;  3NZ3 A;  1T0S C;  4ZYN A;  1EUV B;  3AEA B;  3AE8 B;  2MJD A;  3DHI C;  3Q3N C;  2M8S A;  1I4Q A;  2ZJD A;  4ZRP A;  2WXP A;  4URK A;  4IKG A;  2NMQ A;  1F9J A;  2KFK A;  2NVU I;  3H1U A;  3ZNI D;  1NYR A;  3ENE A;  3PRE A;  2CKH B;  2WYQ A;  4G0N B;  4EZL A;  3RT3 B;  3TEZ A;  3A4R A;  2D2Q A;  1FRR A;  2RDH A;  3OJ4 B;  4AOF A;  4MEL A;  3U7D A;  1AW7 A;  4YXD B;  2D11 A;  4CO7 A;  4MDK E;  4WJQ A;  1P9D U;  3PVL A;  2RSU A;  3MJ5 A;  3FAH A;  2KZR A;  2KD0 A;  5KHQ A;  2QC8 A;  4QAY A;  4TKN A;  3CWI A;  2XEW A;  2ONQ A;  2FNJ B;  4HEA 1;  2IO3 B;  5AEK B;  1IYF A;  4WAA A;  2C60 A;  2JRI B;  4MGY E;  4EZK A;  2J0J A;  3BII D;  3IBE A;  1GG3 A;  1HTO A;  4J6I A;  2KMA A;  3A33 B;  2H89 B;  1R4N I;  4HPL B;  3CIR B;  1FO4 A;  1I4X A;  3Q8C A;  2LJI A;  2I1J A;  3ALB A;  3QX1 A;  1OQQ A;  1YJ1 A;  5TSS A;  4BKG A;  4AWJ A;  4ZRJ A;  2MBO A;  2FUH B;  4RGT A;  3T3O A;  3RCZ A;  2MA9 B;  1SXT A;  1V97 A;  1WGK A;  4C56 C;  4AJY B;  1QOA A;  1TS2 A;  4REZ A;  5EE1 A;  1FRD A;  3B08 A;  4DBG A;  4R3D A;  4RH6 A;  2Z0E B;  3RPF C;  2ZCB A;  2PLP A;  4LNK A;  1VZ7 A;  4WIP A;  3T3N A;  4PYU A;  1D5M C;  4N9F 4;  2ACZ B;  1YX5 B;  3BK2 A;  1I7H A;  3QHT A;  1YOV B;  3VUX A;  5FR6 A;  2DYO A;  4NJ7 A;  2MSE D;  3ZLZ A;  1E7P B;  2CR5 A;  2ZPY A;  1DOY A;  2M56 B;  4BAX A;  2HJ1 A;  1LGR A;  4LJO B;  3RN9 C;  3RUL A;  1D6E C;  3ZVV A;  4W9K A;  2WHI A;  3KH0 A;  5C3J B;  2C7N B;  3N30 A;  1C3T A;  3NOB A;  1P7E A;  2LHE A;  2KQS A;  2LUE A;  1KFY B;  2DEN B;  3AUL A;  4DQO C;  2GLS A;  3NUH B;  3SFD B;  3DCG A;  3EFC A;  3GP7 A;  1NDD A;  4MT5 A;  3VXW A;  5BYQ A;  1YN5 A;  5HHD G;  4JX1 C;  2BYT A;  3U4E G;  3U30 A;  3DHG C;  1J19 A;  2J52 A;  1P0R A;  4ICV A;  3ZRF A;  1QT9 A;  3B9J A;  3TIX A;  3P4P B;  3ZDM C;  4W9C A;  1QIL A;  1PDX A;  2PW9 A;  3K9P B;  4N58 A;  4E3C A;  1CMX B;  4KZC A;  4ZDV A;  2BKR B;  2D10 A;  4S17 A;  1LXD A;  3ETR A;  1HE8 A;  4NNJ B;  4A9A A;  5JZE B;  2KJ6 A;  3GZN B;  3VFK A;  5BMH A;  3I57 A;  1FEH A;  1SJH D;  3HVZ A;  1K53 A;  5DPT A;  3PV1 A;  1SIF A;  4US9 A;  1BT0 A;  2J42 A;  1ZP0 B;  1RFK A;  2C7H A;  3DHH C;  2WDV B;  2KMM A;  2IGH A;  1WWT A;  2BTE A;  3E56 A;  1MFW A;  1ZE3 D;  3ABV B;  4IM2 A;  1WRI A;  1NEK B;  3L4P A;  3I63 C;  4NZL B;  2BS4 B;  3HM3 A;  5D3D A;  4W9I A;  5GMV A;  2GOW A;  1Z5S B;  1WSP A;  2QIL A;  2O6V B;  2AWT A;  2IYD B;  5G5G A;  2L05 A;  2V3P A;  4JPS A;  4I6N B;  2EKE C;  1XD3 B;  1XF5 L;  2PE9 A;  3AN1 A;  3UQA A;  1Y8R C;  2PVG C;  2WX0 A;  4G50 A;  3L08 A;  2WXR A;  1E8Z A;  3C8Y A;  1F0Z A;  1R7S A;  4P1B C;  3ZDT A;  1SE2 A;  1RLF A;  1UBI A;  2PPH A;  3HK0 A;  3Q3M C;  3KW5 B;  1R4M B;  1X1M A;  5EE3 A;  1I4H A;  1C4A A;  1A5R A;  4GN1 A;  2LUM A;  1SGH A;  4US8 A;  3KYC D;  1NYQ A;  2CHX A;  1TKG A;  1EWY C;  4FLH A;  2UWQ A;  3ONS A;  1E5W A;  1OFF A;  2VH1 A;  3DBH B;  5MPO A;  1BML C;  1FXI A;  1P98 A;  2J0M A;  4TUU A;  1WJ4 A;  2V0G A;  1VJK A;  2WU2 B;  2XN9 C;  3QAQ A;  4F7Z A;  3ZRC A;  5C2T B;  1MI0 A;  1F1H A;  2WXJ A;  2WXG A;  2O6V A;  3H8H A;  2REX A;  4K7S A;  3VR9 B;  1Y56 A;  2W55 A;  1JML A;  2WS3 B;  1S1Q B;  1QOB A;  3T8M A;  2WXM A;  4GB9 A;  1I42 A;  3RD2 A;  3H6N A;  3KWV A;  1JWS D;  3VR8 B;  5D7G A;  4IG7 B;  3UGB B;  1MHX A;  4DHJ D;  4YL8 A;  2KWC A;  1WF9 A;  3TBL D;  2NTT A;  4BKT A;  2LRW A;  4HKQ A;  2WWZ A;  2Y5P A;  4MH8 A;  5CHF A;  1AWD A;  2JYT A;  5FR3 A;  5G55 A;  2Y5C A;  2OOB B;  3ZYY X;  5IO9 A;  1VD2 A;  2FCM A;  1FCC C;  4BKS D;  2JY6 A;  3HIZ A;  5IP4 D;  5BMG A;  3KVF B;  2WDR B;  1WXS A;  3DBR I;  2O2V B;  4WUR A;  3N20 C;  4MGZ E;  5H92 C;  2KC2 A;  3EGR A;  3WAM A;  2FUG 1;  1MVK A;  1UD7 A;  3AV8 A;  2V9H A;  4M0W B;  3KQ4 A;  2E3T A;  3AM9 A;  3VTW A;  4OZB A;  1N6Z A;  2V1Y A;  4HCP B;  3AXC A;  2OJW A;  4PS7 A;  4YSY B;  3TEY A;  3W1Y A;  2NBW B;  1GOZ A;  3AE3 B;  4NPN A;  2DAF A;  3SR6 A;  2WXK A;  3NVW A;  2GMI C;  4WWM A;  2KVR A;  5BMI A;  2ON8 A;  3TJP A;  2BVC A;  5G2N A;  1YJI A;  2KDB A;  2CJO A;  4HK2 A;  3BYT B;  4UDU C;  4ASW C;  2J7Q B;  1ENF A;  4K3B A;  4OVZ A;  2JVC A;  1V8C A;  3NVY A;  2N7D A;  1ESF A;  2WGS A;  3CF6 E;  3IT6 B;  1V86 A;  1F2R C;  4F1S A;  2K5P A;  4JWU C;  3CMM B;  2DHZ A;  4FAD A;  3S2A A;  3QCA A;  3LB8 C;  2O2V A;  2LD9 A;  4TSS A;  3EHV A;  1IBX B;  3HRD D;  4PT5 A;  4M0W A;  2BQQ A;  2NPT B;  3DQV A;  2CS4 A;  1JRU A;  2FE8 A;  1UUP A;  1WJU A;  3URY A;  2WXF A;  4EKU A;  4K7W A;  2JPH A;  4ANX A;  1JW9 D;  4RNA A;  4KSL C;  2W9N A;  1RRB A;  1JWB D;  2M19 A;  5T8I A;  1A70 A;  1HZ5 A;  2JF5 A;  4WQM A;  4HRS A;  5AZG A;  1FXT B;  5E6N A;  2M17 A;  1C79 A;  2L52 A;  2VH2 A;  1WYW B;  3SDL C;  4KIK B;  4TQ1 A;  3OAW A;  1FMA D;  2BYV E;  1ET9 A;  1E90 A;  3RFZ B;  2G9H D;  1VCB A;  3AEF B;  1RAX A;  3Q8A A;  4XGA B;  1WXA A;  1AAR A;  1IBX A;  3BIN A;  1WXQ A;  2NPT A;  3R7Q A;  3U2S C;  4XWT A;  1LFD A;  3DBS A;  4A8X C;  2WDQ B;  2Y5B B;  2LJ5 A;  2ZNV C;  1QZE A;  3ZQ4 A;  2MCN B;  4LNF A;  3M95 A;  2BB6 A;  4A55 A;  2JQR B;  2NR2 A;  2D3G A;  4RMA A;  1IGD A;  3W5V B;  1PFD A;  2IGD A;  4LDT D;  3IAM 1;  2AX5 A;  4GDL B;  3TEX A;  3AE4 B;  1J8C A;  4HWI B;  1XQQ A;  4DXA B;  1V81 A;  3B1L X;  2KYW A;  4OVV A;  3Q69 A;  2DZI A;  2K0P A;  4DXF A;  3EA6 A;  2IO0 B;  3J9C A;  2J0K A;  4HCN B;  5CX3 A;  4KIK A;  4XE0 A;  2INN E;  1XLN A;  4LTU A;  4BBN F;  2ZW0 A;  3PHW B;  5LLI A;  1VR9 A;  2L1A A;  3APD A;  2IBI B;  1NBF C;  4I6P A;  2KJH B;  1XCT L;  1QLB B;  2KTR B;  4P7I A;  2LWP A;  2GRI A;  4FXC A;  2YEP B;  5LXH A;  1FNU A;  1EU3 A;  3VH4 B;  1R4N B;  2KN4 A;  4WJO A;  3WAP A;  1M4V A;  1N61 A;  2R2Q A;  4YSX B;  3KLS X;  2ZEQ A;  3Q3J A;  3RYT A;  1WM2 A;  3KUD B;  1YJJ A;  2MJ3 A;  3IVF A;  2LXC A;  1I35 A;  1L6V A;  2G45 B;  1QOF A;  3WCQ A;  4KGS A;  3RNE C;  4GDL A;  4W9D A;  3V05 A;  1CQV A;  2SAK A;  2MBQ A;  4KX6 B;  3E9S A;  1I4G A;  4GSW A;  3BVM A;  1L4Z B;  4OZC A;  2MBB B;  1V5T A;  3TSS A;  1XLO A;  3VHT C;  2NBU A;  4FHK A;  1P7F A;  1GB1 A;  1TZO A;  3AE9 B;  1J7A A;  4K7U A;  3R2I A;  1AYF A;  4YTM B;  2KTR A;  3SHQ A;  3NVZ A;  2KDF B;  3A1Q B;  1QKZ A;  3GS2 A;  1ET6 A;  3MFG A;  3RNC C;  2KC1 A;  3QK0 A;  2A4Z A;  3QWZ B;  1SF0 A;  3SD5 A;  1TYG B;  4PYZ A;  1FPY A;  1STE A;  4HPP A;  4C80 A;  1KLG D;  2OHF A;  3N32 A;  1WYG A;  2W3S A;  3PT2 B;  3Q3F A;  4XC2 A;  4AS1 A;  5J17 A;  3BWU D;  4N6E B;  4KV2 A;  2L83 A;  1SE3 A;  2N0S B;  4XZ4 A;  3V6E B;  1E9M A;  2K8B A;  4WAF A;  5DCN A;  1SEB D;  1C4C A;  2E6X A;  5DPR A;  2Z0D B;  3PRM B;  4K3C A;  3AE5 B;  3D32 A;  5C23 A;  1PGA A;  2BS2 B;  4BOZ B;  3A1Q A;  5L95 C;  4CHK A;  4BBN C;  4B0M A;  1ZW7 A;  2N4F A;  4ZRK A;  1D4B A;  4A6Q A;  2W82 A;  1PQS A;  3AE7 B;  1EM7 A;  4GOC A;  4AJW A;  3P63 A;  5LNK 1;  3Q6B A;  2LGX A;  1KOT A;  3JSV B;  1FM0 D;  3U7Z A;  5BO4 B;  4IDI A;  3EFU A;  2J53 A;  4LJP B;  4YTN B;  1T3Q A;  1WE6 A;  4MEM A;  5AZH A;  5E6J A;  3KWL A;  2BYE A;  3ZTD A;  3VDZ A;  2LMC A;  2WNM A;  3PPA A;  3SEB A;  4IUM B;  3MJW A;  5G5H A;  4ANU A;  3P4Q B;  3TMP B;  2K6D B;  2BF8 B;  5BYS A;  3L54 A;  1N62 A;  2KDI A;  3P42 A;  3BK1 A;  3PGE A;  4B0E A;  1UGJ A;  2L76 A;  5JHA A;  4GLS C;  4F8C B;  1TGZ B;  2I1K A;  1WX8 A;  2EMT A;  3ML9 A;  4DHJ B;  3VAW A;  2KAC A;  4BFR A;  3UI3 A;  1WJ6 A;  1ZDX A;  2IY1 B;  2IDY A; 
#chains in the Genus database with same CATH homology
 1BXT A;  4LLG M;  4EE2 A;  5C2T B;  1MI0 A;  1IUE A;  3AEE B;  1VRA B;  2BW2 A;  1ACC A;  2D5G A;  1B1Z A;  1GPX A;  1J7C A;  2WXJ A;  2WXG A;  3H8H A;  3DWG C;  4HKZ E;  2VZK B;  3VR9 B;  1Y56 A;  1HQR D;  1FFU A;  2JSV X;  2PTL A;  2W55 A;  1N63 A;  1JML A;  2WS3 B;  2PMV A;  2R61 A;  1EWC A;  3HVD A;  1F77 A;  1GT8 A;  2H88 B;  1QOB A;  2WXM A;  5FKA C;  4C7Y A;  3KWV A;  1KH0 A;  3IT4 B;  1JWS D;  1QOG A;  3VR8 B;  5D7G A;  4MM3 B;  1MHX A;  1FNV A;  1VZ8 A;  3P1M A;  3GB1 A;  1KRH A;  3AE2 B;  2BB5 A;  2NTT A;  1FXA A;  1N5W A;  1LO5 D;  1XO3 A;  1DOX A;  2DLB A;  3LXF A;  4HKQ A;  1YQ3 B;  4MH8 A;  2MH7 A;  2Y5P A;  1RWS A;  2AQ3 B;  3I9V 1;  1RYJ A;  3MC0 B;  4A90 A;  2VZK D;  1JWU D;  2Q5W D;  1AWD A;  2JYT A;  2HTM E;  3PO0 A;  4XDD A;  2AQ2 B;  5FR3 A;  4YSZ B;  2PIA A;  1SIJ A;  4YTP B;  2Y5C A;  1TKE A;  3ZYY X;  4NAM A;  2WXL A;  2JXT A;  4Q2J A;  4ITK A;  1FCC C;  2JU6 X;  4O1N A;  3AH7 A;  5I4D A;  1EU4 A;  2X38 A;  1E10 A;  1VZ6 A;  2WLB A;  5BMG A;  4L1B A;  2WDR B;  2DWQ A;  2W3R A;  2JYE A;  1K50 A;  3W1S A;  4WUR A;  4ZRQ A;  1HXY D;  5H92 C;  2MEK A;  3EGR A;  2FUG 1;  4RGO S;  1MVK A;  2NTS A;  1K52 A;  3AV8 A;  3KQ4 A;  5EE0 A;  2B76 B;  2E3T A;  2V4I B;  3AM9 A;  1TS5 A;  2GB1 A;  3LYY A;  3MHZ A;  4OZB A;  5D3I B;  1VDV A;  3TUO A;  1GTH A;  2W54 A;  3AE1 B;  2JX5 A;  4YSY B;  4ZHP A;  3TEY A;  1RM6 C;  5H8Y E;  1ZXH A;  4L2Y A;  1GOZ A;  1ROE A;  3AE3 B;  3SR6 A;  1KF6 B;  2WXK A;  3NVW A;  4KGT A;  4JWS C;  2G1E A;  2I38 A;  4WWM A;  5BMI A;  1YMH E;  2ON8 A;  1N5X A;  1JWM D;  1FNW A;  3VQI A;  1YJI A;  3U52 E;  3SFE B;  2CJO A;  3BYT B;  4UDU C;  1ENF A;  2V3N A;  2EEL A;  3NS1 A;  4OVZ A;  1FCL A;  1V8C A;  3NVY A;  4HRO A;  1SSN A;  3AED B;  3AE6 B;  1ESF A;  1SJE D;  2Y3A A;  3IT6 B;  1F2R C;  2JZP A;  2QIE B;  1B9R A;  3BVG A;  2PKO A;  3NVV A;  2K3U A;  1JRO A;  2BT6 A;  2K5P A;  3EUB 2;  1C9F A;  4OHJ A;  1ZUD 2;  2N7J A;  4JWU C;  3NZ3 A;  1YN3 A;  4OW0 A;  5FK9 C;  3AEA B;  3AE8 B;  2MJD A;  1I4Q A;  2KDM A;  4J3O D;  4ZRP A;  1UNS A;  3LB8 C;  2WXP A;  4IKG A;  1TY0 A;  4DXG A;  1L4D B;  2NMQ A;  3CF4 A;  4TSS A;  1XLP A;  1IBX B;  4WH4 A;  2WU5 B;  1NYR A;  3HRD D;  3N9Y C;  4PT5 A;  4RCO A;  4M0W A;  3MP9 A;  1T5X D;  4AQ7 A;  4RF1 A;  2FE8 A;  1UUP A;  3TEZ A;  3URY A;  1FRR A;  2RDH A;  2WXF A;  1SB3 C;  1AW7 A;  4H2A A;  2DYM A;  4YXD B;  1DOI A;  2SEB D;  1JW9 D;  4RNA A;  4RGN A;  3ZJV A;  3MJ5 A;  2M19 A;  1JWB D;  5T8I A;  2WP9 B;  1C77 A;  3FAH A;  1A70 A;  1HZ5 A;  1H7X A;  4P6V F;  1D5X C;  4WQM A;  1NEN B;  3AEC B;  4HRS A;  4CQN A;  3CWI A;  1C76 A;  3BYY B;  1E0Z A;  2ONQ A;  1UWX A;  1ZDV A;  4HEA 1;  1C79 A;  2L52 A;  1V1P B;  2IGG A;  4TMA B;  3W5U B;  1YQ4 B;  4TQ1 A;  3BII D;  1FMA D;  1E6E B;  4D2K A;  3BVZ A;  2QEJ C;  3Q8F A;  1ZOY B;  1ET9 A;  1TS3 A;  3VRA B;  4JE3 B;  3RFZ B;  1IGC A;  4ARC A;  5HG2 A;  1QF6 A;  2H89 B;  2G9H D;  1UWM A;  3AEF B;  1SE4 A;  3Q8A A;  3Q8E A;  2XNA C;  3CIR B;  1FO4 A;  1T6B X;  2PVO D;  1IBX A;  1I4X A;  1GTE A;  3Q8C A;  2LJI A;  1WXQ A;  1K51 A;  3U2S C;  2LFI A;  4XWT A;  4L23 A;  1OQQ A;  4A8X C;  1FFV A;  2WDQ B;  3OWE B;  3ZQ4 A;  1FIQ A;  3AMZ A;  3Q8B A;  1MHH E;  5TSS A;  2WXN A;  4TQ0 A;  3DWM A;  3AEB B;  2BB6 A;  1AN8 A;  2JQR B;  4A55 A;  1QQR A;  1TS4 A;  5AUI A;  2K9X A;  4RGT A;  3W9C B;  1XCQ L;  3T3O A;  1IGD A;  3W5V B;  1PFD A;  2IGD A;  4RFB A;  5HI1 A;  1SXT A;  3W2D A;  1V97 A;  1WGK A;  2AX5 A;  3IAM 1;  1I4P A;  4C56 C;  4GDL B;  3TEX A;  3AE4 B;  1QOA A;  4KKJ A;  1TS2 A;  4REZ A;  5EE1 A;  1TY2 A;  1C4P A;  1FRD A;  5HFY A;  3Q69 A;  2RMM A;  2K0P A;  4R3D A;  1V1P A;  3EA6 A;  3J9C A;  4RH6 A;  4DXF A;  1CJE A;  1FD6 A;  1XLQ A;  3RPF C;  4XE0 A;  1XEE A;  2INN E;  1KLU D;  1XLN A;  2BS3 B;  4LTU A;  2PLP A;  2ZW0 A;  1VZ7 A;  1VR9 A;  2L1A A;  4WIP A;  3T3N A;  1D5M C;  2ACZ B;  1I4R A;  3BK2 A;  1TJE A;  1XCT L;  1I7H A;  1QLB B;  5JXV A;  2K22 A;  3R2T A;  4NAW B;  4YT0 B;  2DYO A;  2GRI A;  3FC4 A;  4FXC A;  1MPE A;  1HZ6 A;  2YEP B;  1FNU A;  1EU3 A;  1ZXI A;  2I2Y A;  3IXS A;  2KN4 A;  1E7P B;  1L0Y B;  4XWW A;  1M4V A;  1N61 A;  1DOY A;  4YSX B;  3KLS X;  2M56 B;  3NRZ A;  1YJJ A;  2IJ0 A;  1D6E C;  2MJ3 A;  2Z8L A;  1YN4 A;  1L6V A;  5C3J B;  1ZPS A;  1QOF A;  3WCQ A;  4MAC A;  1P7E A;  4KGS A;  2LHE A;  1DYQ A;  2WXQ A;  3P4R B;  3V05 A;  2WQY B;  1CQV A;  2SAK A;  4KX6 B;  1PGX A;  3E9S A;  1KFY B;  2DBY A;  2IPK D;  1PGB A;  4LK0 M;  1I4G A;  4DQO C;  3NUH B;  4HJG E;  3BVM A;  3SFD B;  3GP7 A;  1L4Z B;  4OZC A;  2QSD A;  4MT5 A;  3TSS A;  1XLO A;  5BYQ A;  1YN5 A;  1L0X B;  2KWD A;  5HHD G;  1P7F A;  2WXO A;  1GB1 A;  4JX1 C;  2BYT A;  1TZO A;  3AE9 B;  1J7A A;  3U4E G;  1OQR A;  3R2I A;  2J52 A;  1AYF A;  3IAS 1;  4YTM B;  4NJC A;  3NVZ A;  2QJL A;  2N9K A;  1QT9 A;  1QKZ A;  1PUT A;  1ET6 A;  3GS2 A;  2RDG A;  1YNT E;  3MFG A;  3B9J A;  5GXG B;  3BZD B;  3P4P B;  3ZJU A;  1SF0 A;  1QIL A;  4P16 A;  1PDX A;  2AQ1 B;  2PW9 A;  1TYG B;  1KTK A;  4N58 A;  2KQ4 X;  1STE A;  4YWG G;  2CJN A;  3ETR A;  4C80 A;  4A9A A;  1KLG D;  2OHF A;  1WYG A;  1L5P A;  5BMH A;  3I57 A;  2W3S A;  1FEH A;  1L6U A;  1JWA D;  1SJH D;  3HVZ A;  4USA A;  2INP E;  1JQ4 A;  1K53 A;  2FBW B;  3TEW A;  4AS1 A;  3V3X A;  3BWU D;  4N6E B;  3ZGZ A;  2L32 A;  4ZYS A;  1GB4 A;  1JRP A;  2L83 A;  1SE3 A;  2N0S B;  2YEP F;  3B2F A;  4RF0 A;  3AEG B;  4US9 A;  3PZ8 A;  1E9M A;  3PZ7 A;  4WAF A;  2EKI A;  2J42 A;  2J4X A;  1ZP0 B;  1SEB D;  1C4C A;  5BYR A;  1RFK A;  2BBC A;  3VRB B;  2E6X A;  1JCK B;  3ZJT A;  1H7W A;  3FIL B;  2WDV B;  3AE5 B;  4XDC A;  2KMM A;  2IGH A;  1WWT A;  2BTE A;  1PGA A;  3E56 A;  1PYW D;  2BS2 B;  1ZE3 D;  3ABV B;  1NVI D;  3B2G A;  3AB5 A;  1JAL A;  4KGR A;  1WRI A;  2RPV A;  3HUI A;  2JWU A;  4B0M A;  1NEK B;  3L4P A;  1HA5 A;  4NZL B;  2BS4 B;  2LEK A;  5D3D A;  1Q10 A;  1D4B A;  4A6Q A;  2W82 A;  1TKY A;  3AE7 B;  1WSP A;  2QIL A;  1EM7 A;  1F2R I;  1SBB B;  1GAQ B;  1HEZ E;  2GI9 A;  5G5G A;  3P63 A;  5LNK 1;  2V3P A;  4JPS A;  1XF5 L;  1L0V B;  1V1O A;  3AN1 A;  2MJE A;  2PVG C;  1FM0 D;  3U7Z A;  3R8B A;  4IDI A;  2J53 A;  2WXR A;  2ICI A;  1C78 A;  3C8Y A;  4YTN B;  1T3Q A;  1R7S A;  1F0Z A;  2LGI A;  1XXG A;  1BUI C;  5E6J A;  3KWL A;  1SE2 A;  1CK1 A;  5AUK A;  4RGM A;  2LMC A;  4ZHO A;  1J7B A;  2WNM A;  4OZA A;  3SEB A;  5G5H A;  4KKI A;  4IOI E;  2WXI A;  3P4S B;  1CZP A;  3P4Q B;  2M0A A;  5EE3 A;  1I4H A;  1C4A A;  4GDK B;  1VLB A;  5BYS A;  2LHD A;  4N59 A;  2TSS A;  3FIL A;  1N62 A;  2LUM A;  2OED A;  4US8 A;  3P42 A;  1NYQ A;  2ZW1 A;  3BK1 A;  4B0E A;  2N9L A;  1TKG A;  1UGJ A;  4ZOH C;  1EWY C;  3O13 A;  1DGJ A;  2CU3 A;  2QMT A;  4GLS C;  1NI3 A;  1N60 A;  2WXH A;  5EE9 A;  2KAJ A;  4C7Z A;  1OFF A;  2KAC A;  5MPO A;  1BML C;  1FXI A;  2HDE A;  3UI3 A;  4ARI A;  2V0G A;  1VJK A;  1D5Z C;  2WU2 B;  2XN9 C;  1ZDX A;  2IDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...