3SFED

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and thiabendazole
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
102
structure length
102
Chain Sequence
b'SSKAASLHWTGERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGIGQVVTDYVRGDALQKAAKAGLLALSAFTFAGLCYFNYHDVGICKAVAMLWKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 43
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2011-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3sfeD00
3SFDC 2WP9C 1KFYC 1ZP0C 3VRAD 3AE2D 4YXDC 2BS3C 3AE5D 3P4QD 3SFED 3SFDD 3AECC 3P4PD 1NENC 1YQ3C 3AEGC 4YT0C 4YTPD 3AE4D 2WS3D 3AE1D 3AEBC 4YSYC 3VR8D 2H88D 3AECD 1ZOYC 3AEFD 1NEND 1YQ3D 4YSXC 3AEGD 3AE6C 4YSZC 3AE9C 3AEAD 4YSYD 1YQ4C 2WDVD 3ABVC 4KX6D 4YTND 3AE8D 3AE6D 3AE3C 5C3JC 2WQYC 2WP9D 1KFYD 1KF6C 1ZP0D 2H89C 1YQ4D 3AEEC 4YXDD 3P4RC 3AEDC 3AE7C 2WDRC 3VR9C 2WU5C 5C3JD 2BS2C 1KF6D 4YTMC 4YT0D 5C2TC 1L0VC 3P4SC 2ACZC 2WU2C 3AEBD 2WDQC 2FBWC 1ZOYD 4YSXD 4YTMD 4YSZD 3AE9D 3CIRC 3VRAC 3ABVD 2B76C 1QLBC 3SFEC 3AE3D 2WQYD 3P4PC 3CIRD 2H89D 4YTPC 3AE4C 2WS3C 3AE1C 3AEED 3P4RD 3AEDD 3AE7D 3VR8C 2B76D 2H88C 2WDRD 3VR9D 2WU5D 3AEFC 3VRBC 1NEKC 5C2TD 1L0VD 2BS4C 3P4SD 3AEAC 2ACZD 2WU2D 2WDQD 1E7PC 3AE2C 2FBWD 2WDVC 3AE5C 4KX6C 4YTNC 3P4QC 3VRBD 3AE8C 1NEKD
chains in the Genus database with same CATH superfamily
3SFDC 2WP9C 1KFYC 1ZP0C 3VRAD 3AE2D 4YXDC 2BS3C 3AE5D 3P4QD 3SFED 3SFDD 3AECC 3P4PD 1NENC 1YQ3C 3AEGC 4YT0C 4DDGA 4YTPD 3AE4D 2WS3D 3AE1D 3AEBC 4YSYC 3VR8D 2H88D 3AECD 1ZOYC 3AEFD 1NEND 1YQ3D 4YSXC 3AEGD 3AE6C 4YSZC 3AE9C 3AEAD 4YSYD 1YQ4C 2WDVD 3ABVC 4KX6D 4YTND 4DHIB 4DDIA 3AE8D 3AE6D 3AE3C 5C3JC 2WQYC 2WP9D 1KFYD 1KF6C 1ZP0D 2H89C 1YQ4D 3AEEC 4LDTA 4YXDD 3P4RC 3AEDC 3VONA 3AE7C 2WDRC 3VR9C 4FJVA 2WU5C 5C3JD 2BS2C 1KF6D 4YTMC 2ZFYA 4YT0D 5C2TC 1L0VC 3P4SC 2ACZC 2WU2C 3AEBD 2WDQC 2FBWC 1ZOYD 4I6LA 4YSXD 4YTMD 4DHZA 4YSZD 3AE9D 3CIRC 3VRAC 3ABVD 2B76C 1QLBC 3SFEC 1TFFA 3AE3D 2WQYD 3P4PC 3CIRD 2H89D 4YTPC 3AE4C 2WS3C 3AE1C 3AEED 3P4RD 3AEDD 3AE7D 3VR8C 2B76D 2H88C 2WDRD 3VR9D 2WU5D 3AEFC 3VRBC 1NEKC 5C2TD 1L0VD 2BS4C 4DHJA 3P4SD 3AEAC 2ACZD 2WU2D 2WDQD 1E7PC 3AE2C 2FBWD 2WDVC 3AE5C 4KX6C 4YTNC 3P4QC 3VRBD 3AE8C 1NEKD
chains in the Genus database with same CATH topology
3SFDC 2WP9C 1KFYC 1ZP0C 3VRAD 3AE2D 4YXDC 2BS3C 3AE5D 3P4QD 3SFED 3SFDD 3AECC 3P4PD 1NENC 1YQ3C 3AEGC 4YT0C 4YTPD 3AE4D 2WS3D 3AE1D 3AEBC 4YSYC 3VR8D 2H88D 3AECD 1ZOYC 3AEFD 1NEND 1YQ3D 4YSXC 3AEGD 3AE6C 4YSZC 3AE9C 3AEAD 4YSYD 1YQ4C 2WDVD 3ABVC 4KX6D 4YTND 3AE8D 3AE6D 3AE3C 5C3JC 2WQYC 2WP9D 1KFYD 1KF6C 1ZP0D 2H89C 1YQ4D 3AEEC 4YXDD 3P4RC 3AEDC 3AE7C 2WDRC 3VR9C 2WU5C 5C3JD 2BS2C 1KF6D 4YTMC 4YT0D 5C2TC 1L0VC 3P4SC 2ACZC 2WU2C 3AEBD 2WDQC 2FBWC 1ZOYD 4YSXD 4YTMD 4YSZD 3AE9D 3CIRC 3VRAC 3ABVD 2B76C 1QLBC 3SFEC 3AE3D 2WQYD 3P4PC 3CIRD 2H89D 4YTPC 3AE4C 2WS3C 3AE1C 3AEED 3P4RD 3AEDD 3AE7D 3VR8C 2B76D 2H88C 2WDRD 3VR9D 2WU5D 3AEFC 3VRBC 1NEKC 5C2TD 1L0VD 2BS4C 3P4SD 3AEAC 2ACZD 2WU2D 2WDQD 1E7PC 3AE2C 2FBWD 2WDVC 3AE5C 4KX6C 4YTNC 3P4QC 3VRBD 3AE8C 1NEKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFD C;  2WP9 C;  1KFY C;  1ZP0 C;  3VRA D;  3AE2 D;  4YXD C;  2BS3 C;  3AE5 D;  3P4Q D;  3SFE D;  3SFD D;  3AEC C;  3P4P D;  1NEN C;  1YQ3 C;  3AEG C;  4YT0 C;  4YTP D;  3AE4 D;  2WS3 D;  3AE1 D;  3AEB C;  4YSY C;  3VR8 D;  2H88 D;  3AEC D;  1ZOY C;  3AEF D;  1NEN D;  1YQ3 D;  4YSX C;  3AEG D;  3AE6 C;  4YSZ C;  3AE9 C;  3AEA D;  4YSY D;  1YQ4 C;  2WDV D;  3ABV C;  4KX6 D;  4YTN D;  3AE8 D;  3AE6 D;  3AE3 C;  5C3J C;  2WQY C;  2WP9 D;  1KFY D;  1KF6 C;  1ZP0 D;  2H89 C;  1YQ4 D;  3AEE C;  4YXD D;  3P4R C;  3AED C;  3AE7 C;  2WDR C;  3VR9 C;  2WU5 C;  5C3J D;  2BS2 C;  1KF6 D;  4YTM C;  4YT0 D;  5C2T C;  1L0V C;  3P4S C;  2ACZ C;  2WU2 C;  3AEB D;  2WDQ C;  2FBW C;  1ZOY D;  4YSX D;  4YTM D;  4YSZ D;  3AE9 D;  3CIR C;  3VRA C;  3ABV D;  2B76 C;  1QLB C;  3SFE C;  3AE3 D;  2WQY D;  3P4P C;  3CIR D;  2H89 D;  4YTP C;  3AE4 C;  2WS3 C;  3AE1 C;  3AEE D;  3P4R D;  3AED D;  3AE7 D;  3VR8 C;  2B76 D;  2H88 C;  2WDR D;  3VR9 D;  2WU5 D;  3AEF C;  3VRB C;  1NEK C;  5C2T D;  1L0V D;  2BS4 C;  3P4S D;  3AEA C;  2ACZ D;  2WU2 D;  2WDQ D;  1E7P C;  3AE2 C;  2FBW D;  2WDV C;  3AE5 C;  4KX6 C;  4YTN C;  3P4Q C;  3VRB D;  3AE8 C;  1NEK D; 
#chains in the Genus database with same CATH topology
 3SFD C;  2WP9 C;  1KFY C;  1ZP0 C;  3VRA D;  3AE2 D;  4YXD C;  2BS3 C;  3AE5 D;  3P4Q D;  3SFE D;  3SFD D;  3AEC C;  3P4P D;  1NEN C;  1YQ3 C;  3AEG C;  4YT0 C;  4DDG A;  4YTP D;  3AE4 D;  2WS3 D;  3AE1 D;  3AEB C;  4YSY C;  3VR8 D;  2H88 D;  3AEC D;  1ZOY C;  3AEF D;  1NEN D;  1YQ3 D;  4YSX C;  3AEG D;  3AE6 C;  4YSZ C;  3AE9 C;  3AEA D;  4YSY D;  1YQ4 C;  2WDV D;  3ABV C;  4KX6 D;  4YTN D;  4DHI B;  4DDI A;  3AE8 D;  3AE6 D;  3AE3 C;  5C3J C;  2WQY C;  2WP9 D;  1KFY D;  1KF6 C;  1ZP0 D;  2H89 C;  1YQ4 D;  3AEE C;  4LDT A;  4YXD D;  3P4R C;  3AED C;  3VON A;  3AE7 C;  2WDR C;  3VR9 C;  4FJV A;  2WU5 C;  5C3J D;  2BS2 C;  1KF6 D;  4YTM C;  2ZFY A;  4YT0 D;  5C2T C;  1L0V C;  3P4S C;  2ACZ C;  2WU2 C;  3AEB D;  2WDQ C;  2FBW C;  1ZOY D;  4I6L A;  4YSX D;  4YTM D;  4DHZ A;  4YSZ D;  3AE9 D;  3CIR C;  3VRA C;  3ABV D;  2B76 C;  1QLB C;  3SFE C;  1TFF A;  3AE3 D;  2WQY D;  3P4P C;  3CIR D;  2H89 D;  4YTP C;  3AE4 C;  2WS3 C;  3AE1 C;  3AEE D;  3P4R D;  3AED D;  3AE7 D;  3VR8 C;  2B76 D;  2H88 C;  2WDR D;  3VR9 D;  2WU5 D;  3AEF C;  3VRB C;  1NEK C;  5C2T D;  1L0V D;  2BS4 C;  4DHJ A;  3P4S D;  3AEA C;  2ACZ D;  2WU2 D;  2WDQ D;  1E7P C;  3AE2 C;  2FBW D;  2WDV C;  3AE5 C;  4KX6 C;  4YTN C;  3P4Q C;  3VRB D;  3AE8 C;  1NEK D; 
#chains in the Genus database with same CATH homology
 3SFD C;  2WP9 C;  1KFY C;  1ZP0 C;  3VRA D;  3AE2 D;  4YXD C;  2BS3 C;  3AE5 D;  3P4Q D;  3SFE D;  3SFD D;  3AEC C;  3P4P D;  1NEN C;  1YQ3 C;  3AEG C;  4YT0 C;  4YTP D;  3AE4 D;  2WS3 D;  3AE1 D;  3AEB C;  4YSY C;  3VR8 D;  2H88 D;  3AEC D;  1ZOY C;  3AEF D;  1NEN D;  1YQ3 D;  4YSX C;  3AEG D;  3AE6 C;  4YSZ C;  3AE9 C;  3AEA D;  4YSY D;  1YQ4 C;  2WDV D;  3ABV C;  4KX6 D;  4YTN D;  3AE8 D;  3AE6 D;  3AE3 C;  5C3J C;  2WQY C;  2WP9 D;  1KFY D;  1KF6 C;  1ZP0 D;  2H89 C;  1YQ4 D;  3AEE C;  4YXD D;  3P4R C;  3AED C;  3AE7 C;  2WDR C;  3VR9 C;  2WU5 C;  5C3J D;  2BS2 C;  1KF6 D;  4YTM C;  4YT0 D;  5C2T C;  1L0V C;  3P4S C;  2ACZ C;  2WU2 C;  3AEB D;  2WDQ C;  2FBW C;  1ZOY D;  4YSX D;  4YTM D;  4YSZ D;  3AE9 D;  3CIR C;  3VRA C;  3ABV D;  2B76 C;  1QLB C;  3SFE C;  3AE3 D;  2WQY D;  3P4P C;  3CIR D;  2H89 D;  4YTP C;  3AE4 C;  2WS3 C;  3AE1 C;  3AEE D;  3P4R D;  3AED D;  3AE7 D;  3VR8 C;  2B76 D;  2H88 C;  2WDR D;  3VR9 D;  2WU5 D;  3AEF C;  3VRB C;  1NEK C;  5C2T D;  1L0V D;  2BS4 C;  3P4S D;  3AEA C;  2ACZ D;  2WU2 D;  2WDQ D;  1E7P C;  3AE2 C;  2FBW D;  2WDV C;  3AE5 C;  4KX6 C;  4YTN C;  3P4Q C;  3VRB D;  3AE8 C;  1NEK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...