3SFYA

Cryptococcus neoformans protein farnesyltransferase in complex with fpt-ii and ethylenediamine inhibitor 2
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
330
structure length
315
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSPLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase/transferase inhibitor
molecule keywords Cryptococcus neoformans protein farnesyltransferase alpha su
total genus 132
structure length 315
sequence length 330
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3sfyA00
4GTTA 1TN6A 3Q79A 3PZ3A 1LD7A 1TNOA 3KSQA 2H6IA 3DSTA 4GTPA 1N4PA 4GTRA 3Q78A 3HXCA 1TNZA 4GTQA 3E37A 1O1RA 2R2LA 1MZCA 4EHMA 4GTMA 1JCSA 1KZOA 2H6FA 3PZ2A 1D8DA 3E33A 3EUVA 1O1SA 1S64A 1N9AA 1D8EA 3E34A 3E32A 1TNUA 1TN8A 3Q7AA 3SFXA 4GTVA 4GTSA 3KSLA 1LD8A 1TNYA 1NL4A 1TNBA 1N94A 1FPPA 2BEDA 2ZIRA 3PZ4A 1LTXA 1N4QA 3DPYA 3DRAA 3HXFA 2ZISA 1X81A 4MBGA 1QBQA 2H6HA 3Q73A 4GTOA 1O1TA 3DSWA 1DCEA 4L9PA 3DSVA 1N4SA 1TN7A 1N95A 2H6GA 4LNBA 3DSSA 3HXEA 1FT1A 3HXDA 3SFYA 3E30A 3DSXA 2IEJA 3Q7FA 1JCRA 3HXBA 4YDEA 2F0YA 1O5MA 1N4RA 1S63A 3Q75A 1KZPA 1SA5A 3C72A 1NI1A 3EU5A 1FT2A 3PZ1A 1SA4A 1JCQA 4YDOA 4LNGA 3DSUA
chains in the Genus database with same CATH superfamily
5CEAA 3QKYA 3KEZA 4LCTA 2DCPA 4GAAA 3JXJA 3W9GA 1NZNA 2H6IA 5J90A 3AU4A 2BKGA 1K1BA 4PS7A 1MZCA 3JXIA 3P2BA 1BI8B 1KZOA 5G55A 4R7LA 5ARGA 3TAXA 5LCWJ 5T4YA 2WXQA 2L6JA 2WQHA 3ISMC 4O60A 2FO7A 2UY1B 1TN8A 4ANUA 3QB2A 3MYVA 1HG2A 3CQGB 4XI9A 2ZU6B 4UQZA 4BWRA 5A7DB 4YVOA 3NAWA 1E96B 1LTXA 3B7SA 1N4QA 3QJZA 4HOQA 3BG0B 3UM2A 3ZYQA 3CHOA 2M63A 3WXXA 5CMYA 3FTSA 2F8YA 3UXGA 2VTBA 5BT1A 2L0TB 3UT4A 3EU9A 3CVUA 3MEKA 3WG7E 1E90A 4EBAA 2PM7A 1IXVA 2J07A 4G24A 2KCKA 4MRUA 2KXPC 3HG0D 2R02A 3F6QA 3L16A 4B93B 2I1KA 2IOLA 4CDNA 2JABA 2ETAA 4K5CA 4HFGA 4GCNA 4N5QA 3L82A 4KT6B 1PAQA 3EU5A 4A1SA 4ATGA 2PL2A 3TWRA 1OCRE 2OVBA 2XEHA 4IULA 2VYIA 2MYOA 4GTTA 2AXUA 1S0PA 4HB5A 4WNEA 4AM9A 3FDHA 3FUMA 3R7RA 4TUMA 3X2QE 2A4ZA 3SD5A 4LUNU 1H2TC 4GA0A 1N4PA 5CRUA 3N71A 4HXIA 3ZNGA 4Q96A 1UJKA 4UUCA 2ONDA 3MV3B 3Q15A 3T9KA 2XGSA 4U0ZA 5AENA 5AQBA 4CRWA 4V3IA 5LOZA 1KLXA 2WXFA 5KJLA 2F37A 5LX8A 2QYUA 4ILIA 5FZQA 4WNGA 2KBXA 4GMLA 4JC8A 3NZSA 4ANXA 2GROB 2KZTB 3D9MA 4WWPA 3PEVB 3DSSA 5D0QD 3VLEA 4L2LA 2V4HC 3ZYLA 2WQ6A 3L54A 1AWCB 3C72A 2AJAA 3GW4A 1FT2A 4DLOA 4DLQA 2I6HA 3DPDA 3ML8A 4YDOA 4LNGA 4AY5A 4KYOB 3ZXSA 1BI7B 1IKND 4AOFA 4GZCA 5AYWD 3VLFA 5FWQA 4MLPA 3U9WA 3ULEG 1E8WA 3HDXA 1HE8A 2ZGGA 5KCMA 4I6EA 5FTPA 3D9JA 1O1RA 5FINA 3SQVA 3I4GA 2MOWA 2VQ2A 2J4BA 4XEIG 2E0IA 3CVWA 3FUEA 5BPPA 2HM8A 2XQ0A 2J08A 4I6JA 1TNUA 5KWDA 4X8QA 5J08A 2FF4A 1TNBA 1U2VG 5ITZF 3IHYA 3D9LA 1EF1C 3PVLA 5EDSA 5EILA 2XS8A 1U3DA 3AG1E 4IYPA 2WPVA 2PQRA 2X6FA 2KATA 4U07A 3FHEA 2DYSE 1HU3A 4G25A 2IONA 1N54A 3IHVA 4OVUA 5HRYA 4DRXE 5KBAA 4DX6D 2WVIA 3C3OA 3D9HA 4WWOA 3D9OA 3EDTB 2IU1A 1ZBPA 3PZ1A 2QC9A 1MX4A 4U8HA 3O4ZA 2L9BA 3ESKA 3MZLB 2AW6A 1P5QA 3UM1A 2UWJG 2FO1E 1U3CA 3TJPA 4LERA 4J6IA 2WXLA 2BF0X 2KC7A 2DIWA 3QNKA 4HOTA 1MQSA 3Q78A 2A5EA 1H6PA 4DPRA 3D9NA 5G05C 3FTXA 2IF4A 2P9LG 1W3BA 4WNDA 4AP2A 5FQ4A 2CG3A 4HI8A 4J8YA 2PM6A 4UWGA 1A5EA 2XZDG 4J8FA 3QAQA 3SFXA 2WXGA 1LD8A 1TNYA 4LG6A 3LY8A 3HHMA 1JWGA 1FPPA 1TYQG 2LNIA 4J8EA 4GA1A 4Q94A 2CFZA 2GRNB 4AVXA 3ZYKA 3DRAA 3EHMA 3SBTB 4EBAG 4GTOA 1O1TA 2NC9A 2I9CA 3DSVA 5B1AE 3CVQA 5CBNA 3UX4A 3ONKA 3L17A 1K1AA 4GYYA 2X38A 3DEOA 5G04J 1TEZA 1H6OA 1N0QA 1JCRA 4YDYA 2ETCA 5HQ8A 5FQ7A 4BY6A 3AJIA 1SA5A 4GPMA 4K0RA 1JPLA 3I5PA 3S7DA 1X81A 2L0IA 2VGYA 3LVRE 2J9QA 4HRNA 3TGOA 4AJWA 2XENA 3FTYA 1TNOA 2KCLA 5EX3A 3ZHEB 4PDXA 1SQMA 4KZCA 2OV8A 3LYAA 4E6HA 5T3RA 4PS8A 3TWQA 3TWUA 2J49A 1O1SA 3FWVA 4XKCA 2WM9A 4L7TA 2GRQB 3MKQA 4J7WA 4BTBA 2R03A 1FCHA 3ZFWA 2BEDA 4FHJA 1UN8A 2X3MA 2QY7A 3EHNA 3ML9A 3PZ4A 3CLJA 2EIJE 1DCQA 3DPYA 5CECB 4OAUC 4BESA 4CYMD 3JUIA 4JEHA 4FLBA 2CG2A 2DVWA 4CGWA 1OXJA 1H6KA 2IEJA 3KAEA 4K5BA 4GZ5A 3PUKA 2F0YA 4D10C 3Q75A 5G04C 1MX2A 3ASHA 4G1TA 2HYZA 1Y6IA 2LO6A 1V54E 1MYOA 1HO8A 1QNFA 4N5CA 4N39A 3FUDA 3AG2E 3CSTA 3VTXA 5BXOA 3SBSA 4ATZD 2IO3C 4H7XA 1BLXB 3UIOC 1WG0A 2R17C 3DSTA 3PEUB 4GPKA 1NFIE 2AXVA 3Q47B 3RSEG 2H6FA 3CR3A 1IYGA 2WXNA 5LP0A 1N11A 3PNTB 2R5SA 2PZIA 3ZGQA 3RU0A 4GYOA 2AXZA 3V2OA 3DXKG 4GTSA 3RO3A 3KSLA 4GZ6A 3AS4A 3TWWA 3AS5A 3ASNE 4FHKA 1E8YA 2CHWA 2UY1A 1UN9A 2YHCA 1OWLA 3C98A 3QK0A 1BPOA 4GZ3A 4K03A 3NZUA 1DCEA 2GRMA 5BW8C 3TL5A 3Q4AB 4ABNA 1WM5A 4GU5A 1N4SA 1N95A 3V31A 4B89A 4XI0A 4WWNA 3U66A 4EQFA 3E30A 1IHBA 3FULA 3FU5A 3UQ3A 4YDEA 4F6RD 3ZRHA 5CBOA 3ASOE 1X5BA 3FU0A 1NI1A 4AEZC 3G2UA 4UI9K 5FT9A 4B94A 3CIAA 3HVEB 3IKOB 3C3QA 1SA4A 3JQ0A 3KD7A 3ESLA 3EIJA 5CCLA 2CFUA 3AS8A 5ENPD 3IBEA 5BNWA 3ZIMA 4AY6A 5DIZA 4DI4A 2EIME 4N2SA 4CEMA 2P9KG 2XGOA 4OYSA 4IN3B 2L6BA 5FQ6A 2R2LA 5ANLA 3B7UX 1D8DA 4NURA 1XGWA 3BEEA 1NA0A 5AN8A 4BSXA 1S64A 3ZU7B 3B13A 3LKUA 5CCMA 4JW1A 3Q7AA 3UUXA 1TJFA 4JA9A 3UI2A 3FUKA 4URKA 4JD2G 3ZUVB 3CKCA 5FZSA 2P9UG 3L08A 1YCSB 3RRUA 2ZIRA 3SGHA 3FFLA 1OCZE 4B8AA 3I4RB 4GZDA 4UI9C 2KCVA 4XX5A 4A55A 3QWPA 2LSUA 1EDUA 2B0OE 5A23A 1ELWA 2BTDA 1EYHA 4TXPA 3QDNA 4CT4A 1L5JA 2H6GA 3EHRA 2XHEA 4WUYA 1HS6A 5ENTD 3SFYA 3UM3A 4RG9A 1Z5SC 4N3CA 2WXOA 3LVQE 4JEUA 3D9PA 4BSZB 1KPSB 1DNPA 1JCQA 3OXGA 1H19A 5E76A 4KVOA 4FP7A 4F3VA 1LF8A 3LCAA 2WMNA 5HS0A 4GTPA 3PNLB 1KT1A 3NB2A 4FJYA 3CVNA 4L1BA 4BFRA 2P9IG 4KBQA 2EQXA 2FULA 3CSFA 2IJGX 5CHEE 1ELKA 4EZLA 2GRLA 2XGMA 4CZ2D 2OCCE 3KEAA 3Q9UC 3S7BA 4EPZA 4A63B 4ACKA 2V5QC 4RG6A 4UQYA 3JYSA 2RFAA 3B7BA 4XKBA 3QOUA 1RZ4A 2R05A 2XCCA 5B1BE 3S7FA 2NSZA 5FIOA 4NRHB 3FUHA 2VGXA 3CEQA 1QBQA 3NOGD 2JLBA 3CVPA 4Y6WA 3KS2A 1A17A 3ZEFA 4B8CB 1SW6A 1Y8MA 2EIKE 4G26A 1QZ2A 3RK6A 3ASGA 4J8SA 1TN7A 3CHRA 4JA7A 3HXEA 3LXUX 4O1PA 4ZFHA 4FULA 4A1GA 4FLHA 4UWKA 2V5FA 1YYHA 3CVXA 4U95D 1WY6A 3ZXPA 1MJ0A 2IFUA 3G2VA 4CGVA 1ZU2A 5AQ7A 5ENRD 3DSUA 4AIFA 3PZ3A 2ZGDA 3PUJA 4U0UA 2LXMA 4YNDA 4W9RA 1EPUA 5DBKA 3C5RA 3RRNB 3UPVA 4HLEA 4GTRA 1TNZA 3APDA 2P9NG 2Q7FA 3S2AA 2GW1A 4U0SA 3MKRA 1IQUA 2HR2A 1Z3XA 1BD8A 2FEZA 3Q49B 3PZ2A 2E2EA 1S70B 2VSNA 3E34A 1OCCE 4OVVA 4I9CA 1IQRA 3FUIA 2VGEA 4F1SA 4FADA 3Q9NC 3R9MA 3FUJA 1SVXA 3UTMA 2KZTA 3BQOA 3ABKE 4G2VA 4O6FA 4I1MA 3DXMG 4TV3A 2B6CA 2RG8A 2X6KA 4HBDA 5KJMA 5AAOA 4UWLA 5BXUA 5EX0A 5H7PA 2WB2A 2VSXE 4DX5D 2X6HA 4XE0A 3BUAA 2CHZA 2DWZA 5BV0A 5ARFA 1O5MA 5KJNA 3QC1A 2YHEA 4I1AA 2YQ8A 2VSYA 3SFZA 4C0EA 4F7AA 4HQDA 1NP7A 2AWIA 4U8YD 4AV7A 4DJAA 2PNNA 3TWTA 4HS2A 4GA2A 1E8XA 4CDRA 3IEGA 2BKKB 3RRMB 3PE4A 1OT8A 3UKRG 3D3MA 1LD7A 3V79K 3CGHA 3LJ3A 4CCAA 5D66A 1VDYA 1H2UA 3EUVA 2C2LA 3PE3A 1N9AA 3PZDA 1ELRA 2IY0C 5ANRA 3TG5A 3QARA 4ANVA 1UG3A 1NL4A 3PDNA 4KZ0A 1UW4B 4FA6A 3U64A 4CDMA 3CHMA 3SF4A 3SHFA 1DVPA 4GMJA 3O48A 4TXQA 2XPIA 3UT8A 2NYJA 3MX3A 4L9PA 2Y3AA 3I3NA 2XCBA 3FP3A 3FTVA 1OWPA 3K9IA 4DX2A 5T8IA 1FT1A 2XPZA 1HX8A 4U7EB 3HXBA 2WXIA 4ANWA 1OCOE 1N4RA 1S63A 3HIZA 4RVBA 3ASDA 2V8SE 5KNHD 3U3WA 1YA0A 4DX1A 5AQ9A 5D2MC 4BETA 4BT8A 4DX7D 2CHXA 5FJYA 3LJNA 3CK9A 2MHKA 3SZ7A 3DWLG 4Q69A 3QWWA 5JA4D 3CQCB 4FU3A 5KNGA 3AU5A 2J8SD 5AIJA 4ME2A 3BG1B 3GYZA 3E37A 4EHMA 4GTMA 2MRIA 3OXLA 4ZHBA 1JCSA 1Z3YA 3E33A 1JUQA 2DZNA 5LCWC 1QYMA 3E32A 3GZ1A 1E7UA 5FQ8A 2XPYA 4U96D 3CVYA 5JJ7A 2VTBB 1N94A 3B7TA 2NXPA 3TWSA 1H0AA 3ULQA 2P2CP 4JHRA 4GB9A 2HO1A 4QFVA 3ZKJA 4RQIA 4MBGA 5ENOD 5B3SE 2XZTG 1HG5A 3L13A 2GRRB 4JXTA 4JHKA 3TG4A 4HORA 3FUFA 4JPSA 5G2NA 1GW6A 3FEXA 3RO2A 3AG3E 1TJCA 1HF8A 2VJ8A 3CK8A 3RIBA 3MCXA 1BU9A 4J0UA 3NBNB 4HOSA 2ETBA 2GRPB 1HZ4A 3OAWA 1K8KG 3G2TA 3UM0A 1KZPA 2OEWA 1V55E 2P58C 1UOHA 4I43A 4EZKA 1TR4A 4N3BA 4PS3A 4GYWA 4DI3A 3TXMA 3OXFA 1NA3A 5EKQD 3P1UA 4BX8A 1DC2A 4G8KA 1FVHA 2I2OA 4I1OB 1PY1A 1ZB1A 2HE0A 3HVEA 2XEVA 3ONLA 4B0ZA 2YNQA 2WXKA 3RJVA 2X6IA 4F1PA 3MA5A 2OVFA 4LNUD 1D9SA 4Y6CA 2V0PA 3JCKC 3SNXA 3T8KA 4A3VA 3PRZA 5BV1A 1G3NB 2DZOA 4BEPA 2XRZA 3APFA 3BU8A 3T5VA 3Q73A 3CHPA 3ZVVA 3CVVA 3R9AB 3ABME 3ENEA 2YINA 3HXDA 1FVFA 4UQXA 1HXIA 2QFCA 1INZA 4C0MA 2FBNA 2VGXB 2IO2C 3OTNA 3J5PA 1E7VA 4U8VD 2I1JA 4BT9A 3ZN3A 2OOEA 1RW2A 4M3OA 5C2YA 3Q79A 3T5XA 3EIQC 4UI9J 4C48B 4BX9A 5CRVA 4Z68A 3KSQA 3CKBA 1SZ9A 3CVLA 3MGBA 4DK5A 4GTQA 3UINC 3D9IA 4BTAA 1OWMA 3ABLE 4KMOA 3UT7A 3FUNA 3LY7A 3TWVA 2XEEA 4RSYA 4ACLA 2EINE 2QYJA 4OAVB 3AG4E 4TXRA 3ULYA 3ZYMA 3SI5A 3RKVA 3G2SA 4UWFA 2JEKA 5HI7A 1PC2A 4I9EA 4H7YA 4FJZA 3B7RL 3LY9A 4XIFA 4NQ0A 2V4LA 2RKKA 5IY5E 4MS6A 1Q2ZA 2H6HA 4N3AA 4N2QA 2OEVA 3SO8A 4O1OA 2QZAA 3Q5MA 5D0OD 3MJWA 2ILRA 2KM4A 3RAUA 5CERB 3FTWA 2P9PG 1HH8A 1OY3D 2Y0BG 4I6GA 3LPZA 3FH5A 4AXHA 3FU6A 3TWXA 4LSZE 4FC8A 4GCOA 4J8DA 3APCA 4JHJA 2BUGA 4EZJA 4IRUA 4L2YA 2Y1LE 4ILHB 3GZSA 3GZ2A 5EN5D 3V2XA 4DUIA 3IV0A 1JWFA 4APOA 3FEYA 4MKTA 2WMOA 5JMND 4CT0A 5CEDB 4HOUA 3ZHEA 5EYPF 5CMWA 5ENSD 3PH0C 2DBAA 1OUVA 4F53A 4GTVA 1YMPA 2LXLA 4GMRA 4PH4B 3G2WA 3ZPJA 1UJJA 3PREA 4E85A 5ENNA 5M72A 2C0LA 4JB8P 3HXFA 1MHQA 2IQCA 4JZYA 3MKQB 1HFAA 4U63A 1OWOA 3T8MA 5KJKA 4NACA 1N0RA 2A5UA 3FTZA 5EIDA 3EHQA 3ZW3A 4HVBA 3L22A 3FU3A 2F8XK 5EIBE 2AVPA 4G11A 3MV2B 2X6JA 3ASFA 3L6AA 5EYLA 1TN6A 1OWNA 5LFAA 2WXPA 2ZXWE 2Y69E 3VLDA 4NIKA 3C3RA 5HKPA 4PUCA 1MX6A 3S7JA 5AJLA 3FH7A 4YDWA 4HRMB 4LEUA 1H2VC 4A3TA 3CV0A 2LSVA 4HNAD 5A6CA 4C9BB 2WQ7A 1IHGA 3FH8A 5AARA 1QQEA 4G23A 5FZRA 2GGFA 4ILGA 3R7QA 2RFMA 2RD0A 4WNFA 4JL0A 4TUUA 1WAO1 4BERA 2XS1A 4M7CA 4APFA 3NF1A 5JJ6A 2VSOE 3PS6A 3DSWA 4KXKB 1K3ZD 3E4BA 2EILE 3HYMB 3JQ1A 3U4TA 1B89A 3B95A 3AAAC 4HI9A 4P29A 3FY4A 3CHQA 3L9TA 3JUEA 4YVQC 1SZAA 2P9SG 3DEPA 2LUHA 2XRYA 1Z6TA 4KVMA 5C1DA 2J4DA 3FTUA 3NOCD 3W9FA 3HRAA 4U04A 1E8ZA 3TXNA 2PQNA 3V30A 4RLYA 4XZ4A 5AJDA 3J5QB 2IOSA 3QWVA 3HXCA 2DYRE 4L23A 3CHSA 3SY2A 4LRZA 3LEWA 2J09A 3NQPA 5JHAA 3VTYA 3UMVA 1D8EA 4JVSA 2WXJA 1KT0A 1AP7A 3UIPC 3IXEA 2Y4UA 3UKUG 5BUZA 3URZA 4G8LA 3DBSA 2WXHA 5G05J 2LAIA 5JHBA 3EJNA 3CK7A 1N52A 2ZISA 2R59A 4I2WA 3LDZA 5JJTA 4TRQA 4QQIA 4EECA 1WDYA 3LS8A 2C0MA 4I2ZA 3D9KA 4LNBA 5ENQD 2Y4TA 4HRLA 2LAHA 4I17A 2WXMA 3DSXA 4WAFA 2WXRA 3Q7FA 5E75A 5AQAA 2FI7A 4K5AB 1XNFA 4UWHA 4HLLA
chains in the Genus database with same CATH topology
4GTTA 1TN6A 3Q79A 3PZ3A 1LD7A 1TNOA 3KSQA 2H6IA 3DSTA 4GTPA 1N4PA 4GTRA 3Q78A 3HXCA 1TNZA 4GTQA 3E37A 1O1RA 2R2LA 1MZCA 4EHMA 4GTMA 1JCSA 1KZOA 2H6FA 3PZ2A 1D8DA 3E33A 3EUVA 1O1SA 1S64A 1N9AA 1D8EA 3E34A 3E32A 1TNUA 1TN8A 3Q7AA 3SFXA 4GTVA 4GTSA 3KSLA 1LD8A 1TNYA 1NL4A 1TNBA 1N94A 1FPPA 2BEDA 2ZIRA 3PZ4A 1LTXA 1N4QA 3DPYA 3DRAA 3HXFA 2ZISA 1X81A 4MBGA 1QBQA 2H6HA 3Q73A 4GTOA 1O1TA 3DSWA 1DCEA 4L9PA 3DSVA 1N4SA 1TN7A 1N95A 2H6GA 4LNBA 3DSSA 3HXEA 1FT1A 3HXDA 3SFYA 3E30A 3DSXA 2IEJA 3Q7FA 1JCRA 3HXBA 4YDEA 2F0YA 1O5MA 1N4RA 1S63A 3Q75A 1KZPA 1SA5A 3C72A 1NI1A 3EU5A 1FT2A 3PZ1A 1SA4A 1JCQA 4YDOA 4LNGA 3DSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTT A;  1TN6 A;  3Q79 A;  3PZ3 A;  1LD7 A;  1TNO A;  3KSQ A;  2H6I A;  3DST A;  4GTP A;  1N4P A;  4GTR A;  3Q78 A;  3HXC A;  1TNZ A;  4GTQ A;  3E37 A;  1O1R A;  2R2L A;  1MZC A;  4EHM A;  4GTM A;  1JCS A;  1KZO A;  2H6F A;  3PZ2 A;  1D8D A;  3E33 A;  3EUV A;  1O1S A;  1S64 A;  1N9A A;  1D8E A;  3E34 A;  3E32 A;  1TNU A;  1TN8 A;  3Q7A A;  3SFX A;  4GTV A;  4GTS A;  3KSL A;  1LD8 A;  1TNY A;  1NL4 A;  1TNB A;  1N94 A;  1FPP A;  2BED A;  2ZIR A;  3PZ4 A;  1LTX A;  1N4Q A;  3DPY A;  3DRA A;  3HXF A;  2ZIS A;  1X81 A;  4MBG A;  1QBQ A;  2H6H A;  3Q73 A;  4GTO A;  1O1T A;  3DSW A;  1DCE A;  4L9P A;  3DSV A;  1N4S A;  1TN7 A;  1N95 A;  2H6G A;  4LNB A;  3DSS A;  3HXE A;  1FT1 A;  3HXD A;  3SFY A;  3E30 A;  3DSX A;  2IEJ A;  3Q7F A;  1JCR A;  3HXB A;  4YDE A;  2F0Y A;  1O5M A;  1N4R A;  1S63 A;  3Q75 A;  1KZP A;  1SA5 A;  3C72 A;  1NI1 A;  3EU5 A;  1FT2 A;  3PZ1 A;  1SA4 A;  1JCQ A;  4YDO A;  4LNG A;  3DSU A; 
#chains in the Genus database with same CATH topology
 5CEA A;  3QKY A;  3KEZ A;  4LCT A;  2DCP A;  4GAA A;  3JXJ A;  3W9G A;  1NZN A;  2H6I A;  5J90 A;  3AU4 A;  2BKG A;  1K1B A;  4PS7 A;  1MZC A;  3JXI A;  3P2B A;  1BI8 B;  1KZO A;  5G55 A;  4R7L A;  5ARG A;  3TAX A;  5LCW J;  5T4Y A;  2WXQ A;  2L6J A;  2WQH A;  3ISM C;  4O60 A;  2FO7 A;  2UY1 B;  1TN8 A;  4ANU A;  3QB2 A;  3MYV A;  1HG2 A;  3CQG B;  4XI9 A;  2ZU6 B;  4UQZ A;  4BWR A;  5A7D B;  4YVO A;  3NAW A;  1E96 B;  1LTX A;  3B7S A;  1N4Q A;  3QJZ A;  4HOQ A;  3BG0 B;  3UM2 A;  3ZYQ A;  3CHO A;  2M63 A;  3WXX A;  5CMY A;  3FTS A;  2F8Y A;  3UXG A;  2VTB A;  5BT1 A;  2L0T B;  3UT4 A;  3EU9 A;  3CVU A;  3MEK A;  3WG7 E;  1E90 A;  4EBA A;  2PM7 A;  1IXV A;  2J07 A;  4G24 A;  2KCK A;  4MRU A;  2KXP C;  3HG0 D;  2R02 A;  3F6Q A;  3L16 A;  4B93 B;  2I1K A;  2IOL A;  4CDN A;  2JAB A;  2ETA A;  4K5C A;  4HFG A;  4GCN A;  4N5Q A;  3L82 A;  4KT6 B;  1PAQ A;  3EU5 A;  4A1S A;  4ATG A;  2PL2 A;  3TWR A;  1OCR E;  2OVB A;  2XEH A;  4IUL A;  2VYI A;  2MYO A;  4GTT A;  2AXU A;  1S0P A;  4HB5 A;  4WNE A;  4AM9 A;  3FDH A;  3FUM A;  3R7R A;  4TUM A;  3X2Q E;  2A4Z A;  3SD5 A;  4LUN U;  1H2T C;  4GA0 A;  1N4P A;  5CRU A;  3N71 A;  4HXI A;  3ZNG A;  4Q96 A;  1UJK A;  4UUC A;  2OND A;  3MV3 B;  3Q15 A;  3T9K A;  2XGS A;  4U0Z A;  5AEN A;  5AQB A;  4CRW A;  4V3I A;  5LOZ A;  1KLX A;  2WXF A;  5KJL A;  2F37 A;  5LX8 A;  2QYU A;  4ILI A;  5FZQ A;  4WNG A;  2KBX A;  4GML A;  4JC8 A;  3NZS A;  4ANX A;  2GRO B;  2KZT B;  3D9M A;  4WWP A;  3PEV B;  3DSS A;  5D0Q D;  3VLE A;  4L2L A;  2V4H C;  3ZYL A;  2WQ6 A;  3L54 A;  1AWC B;  3C72 A;  2AJA A;  3GW4 A;  1FT2 A;  4DLO A;  4DLQ A;  2I6H A;  3DPD A;  3ML8 A;  4YDO A;  4LNG A;  4AY5 A;  4KYO B;  3ZXS A;  1BI7 B;  1IKN D;  4AOF A;  4GZC A;  5AYW D;  3VLF A;  5FWQ A;  4MLP A;  3U9W A;  3ULE G;  1E8W A;  3HDX A;  1HE8 A;  2ZGG A;  5KCM A;  4I6E A;  5FTP A;  3D9J A;  1O1R A;  5FIN A;  3SQV A;  3I4G A;  2MOW A;  2VQ2 A;  2J4B A;  4XEI G;  2E0I A;  3CVW A;  3FUE A;  5BPP A;  2HM8 A;  2XQ0 A;  2J08 A;  4I6J A;  1TNU A;  5KWD A;  4X8Q A;  5J08 A;  2FF4 A;  1TNB A;  1U2V G;  5ITZ F;  3IHY A;  3D9L A;  1EF1 C;  3PVL A;  5EDS A;  5EIL A;  2XS8 A;  1U3D A;  3AG1 E;  4IYP A;  2WPV A;  2PQR A;  2X6F A;  2KAT A;  4U07 A;  3FHE A;  2DYS E;  1HU3 A;  4G25 A;  2ION A;  1N54 A;  3IHV A;  4OVU A;  5HRY A;  4DRX E;  5KBA A;  4DX6 D;  2WVI A;  3C3O A;  3D9H A;  4WWO A;  3D9O A;  3EDT B;  2IU1 A;  1ZBP A;  3PZ1 A;  2QC9 A;  1MX4 A;  4U8H A;  3O4Z A;  2L9B A;  3ESK A;  3MZL B;  2AW6 A;  1P5Q A;  3UM1 A;  2UWJ G;  2FO1 E;  1U3C A;  3TJP A;  4LER A;  4J6I A;  2WXL A;  2BF0 X;  2KC7 A;  2DIW A;  3QNK A;  4HOT A;  1MQS A;  3Q78 A;  2A5E A;  1H6P A;  4DPR A;  3D9N A;  5G05 C;  3FTX A;  2IF4 A;  2P9L G;  1W3B A;  4WND A;  4AP2 A;  5FQ4 A;  2CG3 A;  4HI8 A;  4J8Y A;  2PM6 A;  4UWG A;  1A5E A;  2XZD G;  4J8F A;  3QAQ A;  3SFX A;  2WXG A;  1LD8 A;  1TNY A;  4LG6 A;  3LY8 A;  3HHM A;  1JWG A;  1FPP A;  1TYQ G;  2LNI A;  4J8E A;  4GA1 A;  4Q94 A;  2CFZ A;  2GRN B;  4AVX A;  3ZYK A;  3DRA A;  3EHM A;  3SBT B;  4EBA G;  4GTO A;  1O1T A;  2NC9 A;  2I9C A;  3DSV A;  5B1A E;  3CVQ A;  5CBN A;  3UX4 A;  3ONK A;  3L17 A;  1K1A A;  4GYY A;  2X38 A;  3DEO A;  5G04 J;  1TEZ A;  1H6O A;  1N0Q A;  1JCR A;  4YDY A;  2ETC A;  5HQ8 A;  5FQ7 A;  4BY6 A;  3AJI A;  1SA5 A;  4GPM A;  4K0R A;  1JPL A;  3I5P A;  3S7D A;  1X81 A;  2L0I A;  2VGY A;  3LVR E;  2J9Q A;  4HRN A;  3TGO A;  4AJW A;  2XEN A;  3FTY A;  1TNO A;  2KCL A;  5EX3 A;  3ZHE B;  4PDX A;  1SQM A;  4KZC A;  2OV8 A;  3LYA A;  4E6H A;  5T3R A;  4PS8 A;  3TWQ A;  3TWU A;  2J49 A;  1O1S A;  3FWV A;  4XKC A;  2WM9 A;  4L7T A;  2GRQ B;  3MKQ A;  4J7W A;  4BTB A;  2R03 A;  1FCH A;  3ZFW A;  2BED A;  4FHJ A;  1UN8 A;  2X3M A;  2QY7 A;  3EHN A;  3ML9 A;  3PZ4 A;  3CLJ A;  2EIJ E;  1DCQ A;  3DPY A;  5CEC B;  4OAU C;  4BES A;  4CYM D;  3JUI A;  4JEH A;  4FLB A;  2CG2 A;  2DVW A;  4CGW A;  1OXJ A;  1H6K A;  2IEJ A;  3KAE A;  4K5B A;  4GZ5 A;  3PUK A;  2F0Y A;  4D10 C;  3Q75 A;  5G04 C;  1MX2 A;  3ASH A;  4G1T A;  2HYZ A;  1Y6I A;  2LO6 A;  1V54 E;  1MYO A;  1HO8 A;  1QNF A;  4N5C A;  4N39 A;  3FUD A;  3AG2 E;  3CST A;  3VTX A;  5BXO A;  3SBS A;  4ATZ D;  2IO3 C;  4H7X A;  1BLX B;  3UIO C;  1WG0 A;  2R17 C;  3DST A;  3PEU B;  4GPK A;  1NFI E;  2AXV A;  3Q47 B;  3RSE G;  2H6F A;  3CR3 A;  1IYG A;  2WXN A;  5LP0 A;  1N11 A;  3PNT B;  2R5S A;  2PZI A;  3ZGQ A;  3RU0 A;  4GYO A;  2AXZ A;  3V2O A;  3DXK G;  4GTS A;  3RO3 A;  3KSL A;  4GZ6 A;  3AS4 A;  3TWW A;  3AS5 A;  3ASN E;  4FHK A;  1E8Y A;  2CHW A;  2UY1 A;  1UN9 A;  2YHC A;  1OWL A;  3C98 A;  3QK0 A;  1BPO A;  4GZ3 A;  4K03 A;  3NZU A;  1DCE A;  2GRM A;  5BW8 C;  3TL5 A;  3Q4A B;  4ABN A;  1WM5 A;  4GU5 A;  1N4S A;  1N95 A;  3V31 A;  4B89 A;  4XI0 A;  4WWN A;  3U66 A;  4EQF A;  3E30 A;  1IHB A;  3FUL A;  3FU5 A;  3UQ3 A;  4YDE A;  4F6R D;  3ZRH A;  5CBO A;  3ASO E;  1X5B A;  3FU0 A;  1NI1 A;  4AEZ C;  3G2U A;  4UI9 K;  5FT9 A;  4B94 A;  3CIA A;  3HVE B;  3IKO B;  3C3Q A;  1SA4 A;  3JQ0 A;  3KD7 A;  3ESL A;  3EIJ A;  5CCL A;  2CFU A;  3AS8 A;  5ENP D;  3IBE A;  5BNW A;  3ZIM A;  4AY6 A;  5DIZ A;  4DI4 A;  2EIM E;  4N2S A;  4CEM A;  2P9K G;  2XGO A;  4OYS A;  4IN3 B;  2L6B A;  5FQ6 A;  2R2L A;  5ANL A;  3B7U X;  1D8D A;  4NUR A;  1XGW A;  3BEE A;  1NA0 A;  5AN8 A;  4BSX A;  1S64 A;  3ZU7 B;  3B13 A;  3LKU A;  5CCM A;  4JW1 A;  3Q7A A;  3UUX A;  1TJF A;  4JA9 A;  3UI2 A;  3FUK A;  4URK A;  4JD2 G;  3ZUV B;  3CKC A;  5FZS A;  2P9U G;  3L08 A;  1YCS B;  3RRU A;  2ZIR A;  3SGH A;  3FFL A;  1OCZ E;  4B8A A;  3I4R B;  4GZD A;  4UI9 C;  2KCV A;  4XX5 A;  4A55 A;  3QWP A;  2LSU A;  1EDU A;  2B0O E;  5A23 A;  1ELW A;  2BTD A;  1EYH A;  4TXP A;  3QDN A;  4CT4 A;  1L5J A;  2H6G A;  3EHR A;  2XHE A;  4WUY A;  1HS6 A;  5ENT D;  3SFY A;  3UM3 A;  4RG9 A;  1Z5S C;  4N3C A;  2WXO A;  3LVQ E;  4JEU A;  3D9P A;  4BSZ B;  1KPS B;  1DNP A;  1JCQ A;  3OXG A;  1H19 A;  5E76 A;  4KVO A;  4FP7 A;  4F3V A;  1LF8 A;  3LCA A;  2WMN A;  5HS0 A;  4GTP A;  3PNL B;  1KT1 A;  3NB2 A;  4FJY A;  3CVN A;  4L1B A;  4BFR A;  2P9I G;  4KBQ A;  2EQX A;  2FUL A;  3CSF A;  2IJG X;  5CHE E;  1ELK A;  4EZL A;  2GRL A;  2XGM A;  4CZ2 D;  2OCC E;  3KEA A;  3Q9U C;  3S7B A;  4EPZ A;  4A63 B;  4ACK A;  2V5Q C;  4RG6 A;  4UQY A;  3JYS A;  2RFA A;  3B7B A;  4XKB A;  3QOU A;  1RZ4 A;  2R05 A;  2XCC A;  5B1B E;  3S7F A;  2NSZ A;  5FIO A;  4NRH B;  3FUH A;  2VGX A;  3CEQ A;  1QBQ A;  3NOG D;  2JLB A;  3CVP A;  4Y6W A;  3KS2 A;  1A17 A;  3ZEF A;  4B8C B;  1SW6 A;  1Y8M A;  2EIK E;  4G26 A;  1QZ2 A;  3RK6 A;  3ASG A;  4J8S A;  1TN7 A;  3CHR A;  4JA7 A;  3HXE A;  3LXU X;  4O1P A;  4ZFH A;  4FUL A;  4A1G A;  4FLH A;  4UWK A;  2V5F A;  1YYH A;  3CVX A;  4U95 D;  1WY6 A;  3ZXP A;  1MJ0 A;  2IFU A;  3G2V A;  4CGV A;  1ZU2 A;  5AQ7 A;  5ENR D;  3DSU A;  4AIF A;  3PZ3 A;  2ZGD A;  3PUJ A;  4U0U A;  2LXM A;  4YND A;  4W9R A;  1EPU A;  5DBK A;  3C5R A;  3RRN B;  3UPV A;  4HLE A;  4GTR A;  1TNZ A;  3APD A;  2P9N G;  2Q7F A;  3S2A A;  2GW1 A;  4U0S A;  3MKR A;  1IQU A;  2HR2 A;  1Z3X A;  1BD8 A;  2FEZ A;  3Q49 B;  3PZ2 A;  2E2E A;  1S70 B;  2VSN A;  3E34 A;  1OCC E;  4OVV A;  4I9C A;  1IQR A;  3FUI A;  2VGE A;  4F1S A;  4FAD A;  3Q9N C;  3R9M A;  3FUJ A;  1SVX A;  3UTM A;  2KZT A;  3BQO A;  3ABK E;  4G2V A;  4O6F A;  4I1M A;  3DXM G;  4TV3 A;  2B6C A;  2RG8 A;  2X6K A;  4HBD A;  5KJM A;  5AAO A;  4UWL A;  5BXU A;  5EX0 A;  5H7P A;  2WB2 A;  2VSX E;  4DX5 D;  2X6H A;  4XE0 A;  3BUA A;  2CHZ A;  2DWZ A;  5BV0 A;  5ARF A;  1O5M A;  5KJN A;  3QC1 A;  2YHE A;  4I1A A;  2YQ8 A;  2VSY A;  3SFZ A;  4C0E A;  4F7A A;  4HQD A;  1NP7 A;  2AWI A;  4U8Y D;  4AV7 A;  4DJA A;  2PNN A;  3TWT A;  4HS2 A;  4GA2 A;  1E8X A;  4CDR A;  3IEG A;  2BKK B;  3RRM B;  3PE4 A;  1OT8 A;  3UKR G;  3D3M A;  1LD7 A;  3V79 K;  3CGH A;  3LJ3 A;  4CCA A;  5D66 A;  1VDY A;  1H2U A;  3EUV A;  2C2L A;  3PE3 A;  1N9A A;  3PZD A;  1ELR A;  2IY0 C;  5ANR A;  3TG5 A;  3QAR A;  4ANV A;  1UG3 A;  1NL4 A;  3PDN A;  4KZ0 A;  1UW4 B;  4FA6 A;  3U64 A;  4CDM A;  3CHM A;  3SF4 A;  3SHF A;  1DVP A;  4GMJ A;  3O48 A;  4TXQ A;  2XPI A;  3UT8 A;  2NYJ A;  3MX3 A;  4L9P A;  2Y3A A;  3I3N A;  2XCB A;  3FP3 A;  3FTV A;  1OWP A;  3K9I A;  4DX2 A;  5T8I A;  1FT1 A;  2XPZ A;  1HX8 A;  4U7E B;  3HXB A;  2WXI A;  4ANW A;  1OCO E;  1N4R A;  1S63 A;  3HIZ A;  4RVB A;  3ASD A;  2V8S E;  5KNH D;  3U3W A;  1YA0 A;  4DX1 A;  5AQ9 A;  5D2M C;  4BET A;  4BT8 A;  4DX7 D;  2CHX A;  5FJY A;  3LJN A;  3CK9 A;  2MHK A;  3SZ7 A;  3DWL G;  4Q69 A;  3QWW A;  5JA4 D;  3CQC B;  4FU3 A;  5KNG A;  3AU5 A;  2J8S D;  5AIJ A;  4ME2 A;  3BG1 B;  3GYZ A;  3E37 A;  4EHM A;  4GTM A;  2MRI A;  3OXL A;  4ZHB A;  1JCS A;  1Z3Y A;  3E33 A;  1JUQ A;  2DZN A;  5LCW C;  1QYM A;  3E32 A;  3GZ1 A;  1E7U A;  5FQ8 A;  2XPY A;  4U96 D;  3CVY A;  5JJ7 A;  2VTB B;  1N94 A;  3B7T A;  2NXP A;  3TWS A;  1H0A A;  3ULQ A;  2P2C P;  4JHR A;  4GB9 A;  2HO1 A;  4QFV A;  3ZKJ A;  4RQI A;  4MBG A;  5ENO D;  5B3S E;  2XZT G;  1HG5 A;  3L13 A;  2GRR B;  4JXT A;  4JHK A;  3TG4 A;  4HOR A;  3FUF A;  4JPS A;  5G2N A;  1GW6 A;  3FEX A;  3RO2 A;  3AG3 E;  1TJC A;  1HF8 A;  2VJ8 A;  3CK8 A;  3RIB A;  3MCX A;  1BU9 A;  4J0U A;  3NBN B;  4HOS A;  2ETB A;  2GRP B;  1HZ4 A;  3OAW A;  1K8K G;  3G2T A;  3UM0 A;  1KZP A;  2OEW A;  1V55 E;  2P58 C;  1UOH A;  4I43 A;  4EZK A;  1TR4 A;  4N3B A;  4PS3 A;  4GYW A;  4DI3 A;  3TXM A;  3OXF A;  1NA3 A;  5EKQ D;  3P1U A;  4BX8 A;  1DC2 A;  4G8K A;  1FVH A;  2I2O A;  4I1O B;  1PY1 A;  1ZB1 A;  2HE0 A;  3HVE A;  2XEV A;  3ONL A;  4B0Z A;  2YNQ A;  2WXK A;  3RJV A;  2X6I A;  4F1P A;  3MA5 A;  2OVF A;  4LNU D;  1D9S A;  4Y6C A;  2V0P A;  3JCK C;  3SNX A;  3T8K A;  4A3V A;  3PRZ A;  5BV1 A;  1G3N B;  2DZO A;  4BEP A;  2XRZ A;  3APF A;  3BU8 A;  3T5V A;  3Q73 A;  3CHP A;  3ZVV A;  3CVV A;  3R9A B;  3ABM E;  3ENE A;  2YIN A;  3HXD A;  1FVF A;  4UQX A;  1HXI A;  2QFC A;  1INZ A;  4C0M A;  2FBN A;  2VGX B;  2IO2 C;  3OTN A;  3J5P A;  1E7V A;  4U8V D;  2I1J A;  4BT9 A;  3ZN3 A;  2OOE A;  1RW2 A;  4M3O A;  5C2Y A;  3Q79 A;  3T5X A;  3EIQ C;  4UI9 J;  4C48 B;  4BX9 A;  5CRV A;  4Z68 A;  3KSQ A;  3CKB A;  1SZ9 A;  3CVL A;  3MGB A;  4DK5 A;  4GTQ A;  3UIN C;  3D9I A;  4BTA A;  1OWM A;  3ABL E;  4KMO A;  3UT7 A;  3FUN A;  3LY7 A;  3TWV A;  2XEE A;  4RSY A;  4ACL A;  2EIN E;  2QYJ A;  4OAV B;  3AG4 E;  4TXR A;  3ULY A;  3ZYM A;  3SI5 A;  3RKV A;  3G2S A;  4UWF A;  2JEK A;  5HI7 A;  1PC2 A;  4I9E A;  4H7Y A;  4FJZ A;  3B7R L;  3LY9 A;  4XIF A;  4NQ0 A;  2V4L A;  2RKK A;  5IY5 E;  4MS6 A;  1Q2Z A;  2H6H A;  4N3A A;  4N2Q A;  2OEV A;  3SO8 A;  4O1O A;  2QZA A;  3Q5M A;  5D0O D;  3MJW A;  2ILR A;  2KM4 A;  3RAU A;  5CER B;  3FTW A;  2P9P G;  1HH8 A;  1OY3 D;  2Y0B G;  4I6G A;  3LPZ A;  3FH5 A;  4AXH A;  3FU6 A;  3TWX A;  4LSZ E;  4FC8 A;  4GCO A;  4J8D A;  3APC A;  4JHJ A;  2BUG A;  4EZJ A;  4IRU A;  4L2Y A;  2Y1L E;  4ILH B;  3GZS A;  3GZ2 A;  5EN5 D;  3V2X A;  4DUI A;  3IV0 A;  1JWF A;  4APO A;  3FEY A;  4MKT A;  2WMO A;  5JMN D;  4CT0 A;  5CED B;  4HOU A;  3ZHE A;  5EYP F;  5CMW A;  5ENS D;  3PH0 C;  2DBA A;  1OUV A;  4F53 A;  4GTV A;  1YMP A;  2LXL A;  4GMR A;  4PH4 B;  3G2W A;  3ZPJ A;  1UJJ A;  3PRE A;  4E85 A;  5ENN A;  5M72 A;  2C0L A;  4JB8 P;  3HXF A;  1MHQ A;  2IQC A;  4JZY A;  3MKQ B;  1HFA A;  4U63 A;  1OWO A;  3T8M A;  5KJK A;  4NAC A;  1N0R A;  2A5U A;  3FTZ A;  5EID A;  3EHQ A;  3ZW3 A;  4HVB A;  3L22 A;  3FU3 A;  2F8X K;  5EIB E;  2AVP A;  4G11 A;  3MV2 B;  2X6J A;  3ASF A;  3L6A A;  5EYL A;  1TN6 A;  1OWN A;  5LFA A;  2WXP A;  2ZXW E;  2Y69 E;  3VLD A;  4NIK A;  3C3R A;  5HKP A;  4PUC A;  1MX6 A;  3S7J A;  5AJL A;  3FH7 A;  4YDW A;  4HRM B;  4LEU A;  1H2V C;  4A3T A;  3CV0 A;  2LSV A;  4HNA D;  5A6C A;  4C9B B;  2WQ7 A;  1IHG A;  3FH8 A;  5AAR A;  1QQE A;  4G23 A;  5FZR A;  2GGF A;  4ILG A;  3R7Q A;  2RFM A;  2RD0 A;  4WNF A;  4JL0 A;  4TUU A;  1WAO 1;  4BER A;  2XS1 A;  4M7C A;  4APF A;  3NF1 A;  5JJ6 A;  2VSO E;  3PS6 A;  3DSW A;  4KXK B;  1K3Z D;  3E4B A;  2EIL E;  3HYM B;  3JQ1 A;  3U4T A;  1B89 A;  3B95 A;  3AAA C;  4HI9 A;  4P29 A;  3FY4 A;  3CHQ A;  3L9T A;  3JUE A;  4YVQ C;  1SZA A;  2P9S G;  3DEP A;  2LUH A;  2XRY A;  1Z6T A;  4KVM A;  5C1D A;  2J4D A;  3FTU A;  3NOC D;  3W9F A;  3HRA A;  4U04 A;  1E8Z A;  3TXN A;  2PQN A;  3V30 A;  4RLY A;  4XZ4 A;  5AJD A;  3J5Q B;  2IOS A;  3QWV A;  3HXC A;  2DYR E;  4L23 A;  3CHS A;  3SY2 A;  4LRZ A;  3LEW A;  2J09 A;  3NQP A;  5JHA A;  3VTY A;  3UMV A;  1D8E A;  4JVS A;  2WXJ A;  1KT0 A;  1AP7 A;  3UIP C;  3IXE A;  2Y4U A;  3UKU G;  5BUZ A;  3URZ A;  4G8L A;  3DBS A;  2WXH A;  5G05 J;  2LAI A;  5JHB A;  3EJN A;  3CK7 A;  1N52 A;  2ZIS A;  2R59 A;  4I2W A;  3LDZ A;  5JJT A;  4TRQ A;  4QQI A;  4EEC A;  1WDY A;  3LS8 A;  2C0M A;  4I2Z A;  3D9K A;  4LNB A;  5ENQ D;  2Y4T A;  4HRL A;  2LAH A;  4I17 A;  2WXM A;  3DSX A;  4WAF A;  2WXR A;  3Q7F A;  5E75 A;  5AQA A;  2FI7 A;  4K5A B;  1XNF A;  4UWH A;  4HLL A; 
#chains in the Genus database with same CATH homology
 4GTT A;  1TN6 A;  3Q79 A;  3PZ3 A;  1LD7 A;  1TNO A;  3KSQ A;  2H6I A;  3DST A;  4GTP A;  1N4P A;  4GTR A;  3Q78 A;  3HXC A;  1TNZ A;  4GTQ A;  3E37 A;  1O1R A;  2R2L A;  1MZC A;  4EHM A;  4GTM A;  1JCS A;  1KZO A;  2H6F A;  3PZ2 A;  1D8D A;  3E33 A;  3EUV A;  1O1S A;  1S64 A;  1N9A A;  1D8E A;  3E34 A;  3E32 A;  1TNU A;  1TN8 A;  3Q7A A;  3SFX A;  4GTV A;  4GTS A;  3KSL A;  1LD8 A;  1TNY A;  1NL4 A;  1TNB A;  1N94 A;  1FPP A;  2BED A;  2ZIR A;  3PZ4 A;  1LTX A;  1N4Q A;  3DPY A;  3DRA A;  3HXF A;  2ZIS A;  1X81 A;  4MBG A;  1QBQ A;  2H6H A;  3Q73 A;  4GTO A;  1O1T A;  3DSW A;  1DCE A;  4L9P A;  3DSV A;  1N4S A;  1TN7 A;  1N95 A;  2H6G A;  4LNB A;  3DSS A;  3HXE A;  1FT1 A;  3HXD A;  3SFY A;  3E30 A;  3DSX A;  2IEJ A;  3Q7F A;  1JCR A;  3HXB A;  4YDE A;  2F0Y A;  1O5M A;  1N4R A;  1S63 A;  3Q75 A;  1KZP A;  1SA5 A;  3C72 A;  1NI1 A;  3EU5 A;  1FT2 A;  3PZ1 A;  1SA4 A;  1JCQ A;  4YDO A;  4LNG A;  3DSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...