3SFYA

Cryptococcus neoformans protein farnesyltransferase in complex with fpt-ii and ethylenediamine inhibitor 2
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
330
structure length
315
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSPLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptococcus neoformans protein farnesyltransferase alpha su
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase/transferase inhibitor
total genus 132
structure length 315
sequence length 330
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3sfyA00
4GTVA 1NI1A 2ZISA 3PZ4A 1O1RA 1N9AA 3KSLA 3DRAA 3HXFA 3DSTA 1N4RA 1FT2A 1O1TA 1S63A 2H6GA 1JCRA 4GTQA 3HXDA 1DCEA 4YDOA 1KZOA 3EU5A 4GTRA 1TN7A 1X81A 2H6IA 4EHMA 4GTMA 3PZ1A 1TNOA 3PZ3A 3E30A 1KZPA 3DPYA 1TNZA 3Q75A 2R2LA 3DSWA 3E33A 2H6HA 4LNBA 1MZCA 3PZ2A 3DSVA 1N94A 3Q7FA 1S64A 1N4SA 3HXBA 1D8DA 1LTXA 1N95A 1SA5A 2H6FA 3DSXA 3EUVA 3HXEA 1O5MA 2F0YA 3E37A 4L9PA 1TNUA 1LD7A 3Q7AA 3Q78A 1FT1A 3SFXA 1N4QA 3KSQA 3E34A 1TNYA 1QBQA 1LD8A 4GTTA 4LNGA 4GTOA 3HXCA 1SA4A 3DSUA 4MBGA 2IEJA 3DSSA 1TNBA 1JCSA 1N4PA 3Q79A 1TN6A 4YDEA 3Q73A 1TN8A 3E32A 1O1SA 1JCQA 4GTPA 2BEDA 2ZIRA 3C72A 1NL4A 1D8EA 4GTSA 3SFYA 1FPPA
chains in the Genus database with same CATH superfamily
4J8YA 4GZ6A 3SHFA 2WXGA 2HO1A 4G8LA 3DSTA 1N4RA 3LY7A 4XKCA 4KZ0A 2WXOA 5D66A 2I1KA 3L82A 4TUMA 4FULA 4DPRA 5G55A 1K8KG 4EHMA 1KZPA 3S7FA 2QYJA 4H7XA 4N5QA 3CK8A 3D9JA 4U0UA 1ELRA 1H6OA 2OEVA 2I6HA 1NA3A 2XHEA 2VJ8A 4DK5A 3DSVA 1W3BA 1WDYA 1N4SA 1U3CA 5ENRD 4RVBA 5FQ6A 4APOA 3NB2A 3OXGA 1N0QA 4HLLA 3JUEA 1OWLA 3BU8A 4HI8A 5G2NA 5JJ6A 1RW2A 5CERB 1EPUA 4M7CA 5AQ7A 3FH8A 4BFRA 4ILGA 2KATA 4WNFA 2Q7FA 3C3QA 3CVPA 4MBGA 1TNBA 5AJDA 3R9MA 3EDTB 4CGVA 2XGMA 1TJCA 2VGXB 3FTYA 1MX4A 4QQIA 2J07A 3CV0A 5ENOD 1D8EA 1Y6IA 5EX0A 5FT9A 4CCAA 3FUIA 4DLOA 2JLBA 2ZISA 3QWPA 1FCHA 3CVXA 4L2LA 1YA0A 1MX6A 2ILRA 4UWFA 4HOSA 1ZBPA 4QFVA 2EILE 3K9IA 3TWWA 3U9WA 4BETA 4ZFHA 1QQEA 4IRUA 5BUZA 3ASNE 4IN3B 4WWNA 3T9KA 2WQ6A 1OWOA 2BTDA 3D9IA 3LVQE 4Q96A 5G05C 5B1AE 3WXXA 1E8XA 3OXLA 4BTAA 3FTVA 3MKRA 4AY5A 4HOQA 2WXMA 2E2EA 4UWKA 1H2VC 5FZSA 1V54E 3TAXA 4DI4A 4A63B 4APFA 4C0MA 3UXGA 4U0ZA 2AVPA 3G2SA 1BI8B 3CVNA 4CYMD 3UTMA 1IXVA 2NXPA 4YDEA 3B7TA 3UT8A 4EBAA 1O1SA 2ZIRA 4N5CA 1DNPA 1NFIE 4BX8A 2VTBB 4B8CB 4Z68A 1NI1A 2CFUA 2DYSE 5KJNA 5CEAA 1IKND 2BKGA 1HXIA 3ZNGA 3U66A 1ZU2A 4LRZA 2A5UA 2IOSA 4ANUA 1KLXA 1SVXA 5CEDB 1AP7A 5ENNA 4I43A 2AXZA 1HS6A 4YVQC 3NQPA 3GZSA 5AENA 5BXOA 4U7EB 3HG0D 5CMYA 2OOEA 4ATZD 2LXMA 4XX5A 4PS8A 1YCSB 2DYRE 3HVEB 3S7BA 2VGYA 3MA5A 3PUKA 3RO2A 3Q4AB 2L0TB 3FTUA 5J08A 5G05J 5JMND 1D9SA 3ZKJA 2Y4UA 3UQ3A 4UI9C 4F1PA 1TNYA 2MOWA 4KVOA 4DX6D 3ML9A 4K5BA 2X6HA 3QKYA 3J5QB 1BLXB 2R05A 3MX3A 5KWDA 2EIJE 2GRRB 3DWLG 4PDXA 3D9HA 2WB2A 2CG2A 2M63A 2VYIA 3RU0A 3B7RL 1N4PA 2XZTG 5EDSA 3E32A 4J8DA 3SF4A 2WQHA 4GPKA 2GRNB 4HNAD 3G2UA 5CRUA 4H7YA 4GTVA 4KBQA 3B7BA 2J4DA 1N9AA 4JPSA 3D3MA 2KBXA 4BERA 4U07A 3HXFA 3LY9A 4XE0A 3LXUX 1OT8A 4L23A 4K0RA 1JCRA 3APDA 2BUGA 4NURA 1JUQA 4GU5A 3D9LA 3EIJA 3LVRE 3PZ1A 4K5CA 2R03A 1EDUA 1PY1A 4F3VA 1UJJA 1UJKA 4BSXA 2FO7A 3ENEA 2PZIA 3X2QE 1EF1C 1MZCA 2A4ZA 3ZYKA 1HE8A 2XRZA 3ZYMA 3UX4A 3TGOA 2DZOA 2P9KG 3IBEA 4L2YA 4NQ0A 3MEKA 4L9PA 3MYVA 3Q15A 4N2SA 2VSXE 4BY6A 3ABLE 1Z3XA 3RRNB 3JXIA 4LNGA 4JA9A 1L5JA 3HYMB 4AY6A 3BG1B 4UI9J 2P9LG 4OVVA 4B89A 3HIZA 4AIFA 3SFZA 1TN8A 1OWPA 5ARFA 1JCQA 2P9IG 4I1AA 5B1BE 2C0MA 1E90A 3C72A 4JD2G 1QYMA 1JPLA 3U3WA 2WXIA 3FY4A 4WUYA 3SD5A 1LF8A 3L54A 4FJYA 4FA6A 2XS8A 3DEOA 3UM0A 4WWOA 3DRAA 2ZU6B 5FJYA 3AU5A 2PNNA 5EX3A 5JA4D 2H6GA 3KD7A 4U04A 3FU3A 3KEZA 4GAAA 3MV3B 4HRNA 2KZTA 4FLBA 4J7WA 1KZOA 2FEZA 3NOGD 4GTRA 3PNLB 4DLQA 1TN7A 3L16A 4N39A 3PVLA 3E30A 3UIPC 5JHAA 1U3DA 3UT4A 3C98A 3CVQA 4UI9K 4CDMA 5ENTD 3RRMB 4MLPA 3EHRA 3PUJA 1BI7B 4GYYA 5JJ7A 3EU9A 3LY8A 3ZHEA 1S64A 3FU5A 2RFAA 3FP3A 4OAVB 2LNIA 3ZXSA 3MZLB 4L7TA 1UW4B 2V5FA 3NZUA 3WG7E 4MKTA 1E7UA 4JXTA 4AV7A 2VQ2A 4JHRA 4MS6A 3Q7AA 4G2VA 3UKUG 1PAQA 2IO3C 5C1DA 4GTOA 4LEUA 3MGBA 3FTSA 4N2QA 1NZNA 2J4BA 1YMPA 4HQDA 4Q69A 3DEPA 4I1MA 2Y69E 2V5QC 5EYPF 4BTBA 4GMLA 3SFYA 3IHVA 1MQSA 4OVUA 3GZ1A 4N3AA 4I9EA 5EIDA 3ISMC 3RSEG 3V2OA 2FO1E 2L6JA 5DIZA 5FINA 3B7UX 1OWNA 2JEKA 4GYWA 2AW6A 4RQIA 4U63A 4YVOA 5BNWA 4NACA 2YQ8A 3DPYA 4AEZC 4BT8A 2ETAA 2AJAA 2WXNA 5AYWD 4IYPA 3APCA 3R7RA 4GPMA 5LFAA 5CCMA 5ANRA 4I6JA 3Q5MA 4ANVA 1IHBA 1K1AA 3C5RA 1D8DA 4DUIA 1SW6A 4CT0A 3ZYQA 3BEEA 2LSVA 4GTTA 4URKA 5LOZA 4D10C 2KCLA 2KCVA 2XPIA 5CMWA 4ILIA 3ZFWA 3P1UA 4BWRA 2IFUA 4CT4A 2XGSA 2WXFA 2MYOA 4ATGA 3OAWA 2I9CA 2P9PG 5A23A 4DJAA 5KJLA 3GZ2A 5CECB 1E8WA 4CEMA 1WAO1 2IU1A 3C3RA 4UQZA 1N54A 1O1TA 1TJFA 3JUIA 4HS2A 2X3MA 3ESLA 3ZEFA 3GYZA 4LSZE 3PEUB 3G2WA 4G24A 1XNFA 4G26A 1X81A 4FHJA 4I6GA 4OAUC 3NOCD 5ITZF 3KS2A 1HFAA 4RG6A 4LUNU 1OCRE 2R2LA 2P9SG 4TXRA 1HG5A 3G2TA 2L0IA 3CHRA 5HS0A 1Z6TA 3ASOE 2LAIA 3DSXA 4CZ2D 5JJTA 2F0YA 2XPYA 1WY6A 2LUHA 1HG2A 5C2YA 3JQ1A 4RLYA 2AWIA 1MHQA 4BT9A 4XZ4A 5T3RA 5D0OD 3LDZA 2WMNA 2VGEA 4U95D 4FC8A 3UKRG 3EJNA 4TXQA 4E6HA 5D0QD 1JCSA 3CQGB 3FUNA 3W9FA 1BD8A 2ZGGA 3U64A 1OUVA 2LSUA 4LNUD 3PEVB 4W9RA 4ANXA 3I4GA 3FUDA 2HM8A 4JB8P 5BPPA 2FULA 5JHBA 2Y4TA 1O1RA 3FUKA 3V2XA 2WXPA 2ZXWE 2WM9A 2FF4A 3QK0A 2F8XK 1DCQA 3QB2A 3VLDA 3P2BA 4JHJA 3FH7A 4HRMB 4O1OA 3TWVA 4DX1A 2XEHA 5BV0A 3CHOA 4V3IA 2H6IA 1HF8A 2F8YA 3PZ3A 4F6RD 5B3SE 3IXEA 5EILA 3ASFA 3Q75A 3QWWA 4FP7A 3TWSA 4U0SA 2H6HA 4LNBA 2DBAA 1N52A 4U96D 4HXIA 2DIWA 3T8KA 1RZ4A 1OCZE 4K03A 3DBSA 2H6FA 3G2VA 1ELKA 4NRHB 1K3ZD 5KJKA 4TUUA 5FQ4A 4O1PA 1FT1A 3SFXA 1N11A 2WPVA 1HH8A 4BESA 4ME2A 4GMJA 1SA4A 2X6IA 2XCCA 4CGWA 3TJPA 4PUCA 3CVWA 3EHMA 1H2TC 1V55E 2YHEA 4NIKA 3E4BA 3PE4A 3Q73A 3VLFA 5H7PA 2WQ7A 2BEDA 4DX2A 1QNFA 2XS1A 3PREA 3SQVA 2GW1A 5CBOA 3CR3A 1TR4A 3TXNA 2IQCA 2R5SA 2ETBA 5FWQA 2HR2A 4TRQA 3R9AB 2R02A 2NYJA 3QJZA 2KZTB 4JZYA 4U8VD 4GZCA 3QDNA 5KCMA 2B6CA 4AVXA 1MX2A 3CEQA 5T8IA 3UUXA 4DX5D 3EHNA 3SNXA 3FU6A 3PZ2A 4JW1A 4DI3A 5AJLA 2NSZA 4OYSA 3SBTB 1KT0A 4WNEA 4WAFA 3HXBA 1OWMA 3LYAA 1N95A 3ZHEB 4I1OB 4JC8A 2FI7A 3FUJA 3QOUA 2AXUA 2GRMA 1OXJA 3HXCA 4KMOA 5J90A 3ZGQA 2XZDG 3CHSA 4HBDA 2IEJA 3CHQA 4FU3A 4HOUA 4KVMA 3Q79A 1TN6A 2XQ0A 1UN8A 3AS5A 4G23A 3UT7A 3N71A 1S0PA 2XGOA 3FEYA 4GCOA 1Q2ZA 3TWXA 3LS8A 4N3CA 4UQYA 3PZ4A 3DXMG 5A7DB 1DC2A 3TG5A 4ABNA 3ZXPA 2YNQA 1X5BA 3RKVA 4F1SA 3B13A 3PE3A 4C48B 1SQMA 4FHKA 2P58C 2XEEA 3ULQA 1MJ0A 4DRXE 3LJ3A 2QY7A 4GB9A 1FVHA 4AJWA 2RD0A 3LEWA 4IULA 1HZ4A 3SGHA 1JWFA 3SY2A 5ENPD 3O48A 4KT6B 2J8SD 4B93B 4Y6CA 3EUVA 4A3VA 4CDRA 1O5MA 5CHEE 3EHQA 1LD7A 3UM2A 1KPSB 4J8EA 2UY1A 1LD8A 2B0OE 4I17A 3L6AA 2PQRA 3TL5A 3Q9NC 5A6CA 3JXJA 3URZA 5ENSD 4GA2A 4GZ5A 5T4YA 3CIAA 2FBNA 4UWHA 4KZCA 3I4RB 3I5PA 5AN8A 1NL4A 1IQUA 3SI5A 1SZAA 4LERA 1H6KA 3JQ0A 3AU4A 4EQFA 4O60A 3CSFA 3T8MA 3AJIA 1KT1A 3W9GA 1OY3D 2XENA 4I2WA 3ML8A 3Q9UC 4PS7A 4G25A 1AWCB 3CHPA 4X8QA 4GTQA 3VTYA 3OTNA 3HXDA 3VTXA 4RG9A 4CRWA 2VSOE 4YDOA 5BXUA 1FVFA 1IHGA 3IV0A 5BV1A 1TNOA 2GROB 3TWTA 3ZVVA 3KEAA 2IOLA 2KM4A 2P9UG 3CKBA 2OVFA 2UWJG 1Z3YA 2JABA 3AG3E 4CDNA 1P5QA 3Q7FA 2V0PA 1EYHA 4YDWA 5G04C 4EZJA 1S70B 3B95A 3D9NA 1TNUA 5D2MC 4LG6A 5EN5D 3UINC 5IY5E 4ACKA 3TWQA 3AG4E 2CHXA 2I2OA 3CK7A 3RAUA 2YHCA 3VLEA 4EZKA 5CRVA 3FUEA 3NZSA 1B89A 4HORA 4F53A 2P2CP 3V30A 4B0ZA 4F7AA 4AP2A 3D9PA 4A1SA 4XKBA 3LKUA 5E75A 2DVWA 3AG2E 3FEXA 2YINA 4BEPA 2KCKA 3EIQC 4FJZA 3FH5A 2GRPB 3APFA 3CVLA 4JHKA 4I2ZA 2IY0C 4HVBA 4GMRA 2CHWA 2GRLA 3NAWA 3LPZA 2KC7A 4UUCA 3ASGA 3SZ7A 3BUAA 1NP7A 3UPVA 3CLJA 1IQRA 2ONDA 3ZUVB 2WVIA 5FZQA 4A1GA 2X38A 2PL2A 2CHZA 2X6KA 3ABKE 3FTZA 4JL0A 4JEHA 5LCWC 5CBNA 3QC1A 1N4QA 3NBNB 3E34A 1ELWA 2V8SE 5AQAA 5G04J 4HB5A 5DBKA 3QARA 3DXKG 3GW4A 4GZ3A 2WMOA 1YYHA 4UQXA 4YDYA 4Y6WA 4HRLA 2WXJA 3DSSA 3PZDA 3MKQA 1UN9A 3RJVA 2WXKA 1A5EA 1U2VG 2CFZA 2X6JA 1H0AA 5HKPA 1N0RA 2EQXA 3UI2A 3QAQA 3RK6A 3IHYA 4RSYA 5ENQD 3S2AA 2ZGDA 3RO3A 5KNGA 3ZIMA 4DX7D 4MRUA 2DWZA 5ARGA 4EBAG 2WXRA 1WG0A 2LO6A 2F37A 3EU5A 4B94A 3PDNA 3L13A 1MYOA 3O4ZA 3FHEA 3TG4A 4AOFA 3AS8A 3ZN3A 3ASDA 3BG0B 5KBAA 4J6IA 4N3BA 2C0LA 3ULEG 2QYUA 1H19A 3E37A 3Q78A 3CVVA 1TEZA 2IF4A 2OV8A 2GRQB 2R59A 4XEIG 1Z5SC 1PC2A 2DCPA 4C9BB 5LCWJ 5EIBE 2J09A 4B8AA 4ZHBA 3FTXA 4G11A 2VGXA 3CVUA 4PH4B 4E85A 3TWRA 3BQOA 1GW6A 2I1JA 4UWGA 5LX8A 3D9OA 4J8FA 4XIFA 3JCKC 4GA0A 2EINE 1INZA 3ZU7B 3L22A 2J49A 3LCAA 2HE0A 2L6BA 4FADA 4Q94A 1VDYA 2RKKA 3OXFA 1FT2A 3LJNA 3FFLA 3FULA 1S63A 4WWPA 3CSTA 3PRZA 4HFGA 4UWLA 1BU9A 1QZ2A 1UOHA 2RG8A 5AQBA 4A55A 5FTPA 5FIOA 4LCTA 2V4HC 3IEGA 1H6PA 3ULYA 4ILHB 3AG1E 1ZB1A 4C0EA 2VSYA 3ESKA 1N94A 2P9NG 4XI9A 2AXVA 4WNDA 1LTXA 1SA5A 1HO8A 1E8YA 2A5EA 4AM9A 3F6QA 3D9MA 3SBSA 2LAHA 3CQCB 3U4TA 3TWUA 1QBQA 3L17A 2GGFA 5HRYA 3FWVA 2UY1B 4I6EA 3S7JA 2QFCA 5HQ8A 3MJWA 1IYGA 4GA1A 5ANLA 4L1BA 3ZPJA 3FUFA 1BPOA 4GTPA 2C2LA 5M72A 2VTBA 3L9TA 2J08A 4G8KA 3KAEA 3MCXA 2QZAA 2BF0X 2XCBA 3S7DA 5LP0A 3I3NA 3B7SA 3KSLA 3FUHA 5EKQD 4WNGA 2Y3AA 3FTWA 4U8HA 3HDXA 2EIKE 5FQ8A 1DCEA 3QNKA 4J0UA 4PS3A 1WM5A 1Y8MA 2VSNA 4GZDA 4K5AB 3HHMA 2QC9A 3T5VA 1TNZA 2R17C 3ABME 5CCLA 3JYSA 4AXHA 3ZW3A 3C3OA 3J5PA 2EIME 3DSWA 5KJMA 3E33A 4KYOB 3HVEA 2ETCA 4ANWA 4HI9A 5BT1A 4KXKB 1UG3A 3CKCA 4HLEA 1TYQG 3FDHA 3FU0A 1JWGA 3UM3A 1E8ZA 3HXEA 2J9QA 4EZLA 2DZNA 4A3TA 3KSQA 2IO2C 2Y1LE 1K1BA 5FZRA 2E0IA 2L9BA 3ASHA 2CG3A 3PNTB 5FQ7A 2PM6A 3RRUA 5BW8C 2PM7A 4R7LA 2HYZA 4JVSA 4M3OA 3V31A 2OCCE 4HOTA 2NC9A 3CGHA 1E96B 2Y0BG 3MV2B 3ZYLA 3UM1A 4GTSA 2OVBA 1FPPA 4GCNA 1H2UA 3T5XA 2WXLA 2WXQA 4GYOA 3TXMA 4EECA 3ONKA 3CVYA 1NA0A 5EYLA 4ACLA 2MHKA 5AIJA 4JEUA 1G3NB 5AQ9A 4O6FA 1SZ9A 5KNHD 3V79K 3PH0C 3PS6A 2WXHA 4P29A 4GTMA 2XPZA 3D9KA 3CHMA 3DPDA 2XEVA 4TXPA 1HX8A 3Q47B 1OCCE 1DVPA 1HU3A 3AS4A 2LXLA 3FUMA 3CK9A 4J8SA 4I9CA 2XRYA 3R7QA 3HRAA 4EPZA 4G1TA 2PQNA 3UMVA 4BSZB 3L08A 5AAOA 1E7VA 1A17A 4FLHA 3NF1A 3ZRHA 3Q49B 2V4LA 2RFMA 5AARA 2OEWA 4XI0A 3DSUA 2KXPC 4YNDA 3UIOC 1XGWA 4U8YD 5HI7A 2IJGX 3RIBA 2MRIA 4BX9A 4TV3A 2X6FA 3MKQB 3IKOB 1OCOE 3AAAC 4JA7A 5E76A 3QWVA 3SO8A 2BKKB 3ONLA 2IONA
chains in the Genus database with same CATH topology
4GTVA 1NI1A 2ZISA 3PZ4A 1O1RA 1N9AA 3KSLA 3DRAA 3HXFA 3DSTA 1N4RA 1FT2A 1O1TA 1S63A 2H6GA 1JCRA 4GTQA 3HXDA 1DCEA 4YDOA 1KZOA 3EU5A 4GTRA 1TN7A 1X81A 2H6IA 4EHMA 4GTMA 3PZ1A 1TNOA 3PZ3A 3E30A 1KZPA 3DPYA 1TNZA 3Q75A 2R2LA 3DSWA 3E33A 2H6HA 4LNBA 1MZCA 3PZ2A 3DSVA 1N94A 3Q7FA 1S64A 1N4SA 3HXBA 1D8DA 1LTXA 1N95A 1SA5A 2H6FA 3DSXA 3EUVA 3HXEA 1O5MA 2F0YA 3E37A 4L9PA 1TNUA 1LD7A 3Q7AA 3Q78A 1FT1A 3SFXA 1N4QA 3KSQA 3E34A 1TNYA 1QBQA 1LD8A 4GTTA 4LNGA 4GTOA 3HXCA 1SA4A 3DSUA 4MBGA 2IEJA 3DSSA 1TNBA 1JCSA 1N4PA 3Q79A 1TN6A 4YDEA 3Q73A 1TN8A 3E32A 1O1SA 1JCQA 4GTPA 2BEDA 2ZIRA 3C72A 1NL4A 1D8EA 4GTSA 3SFYA 1FPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTV A;  1NI1 A;  2ZIS A;  3PZ4 A;  1O1R A;  1N9A A;  3KSL A;  3DRA A;  3HXF A;  3DST A;  1N4R A;  1FT2 A;  1O1T A;  1S63 A;  2H6G A;  1JCR A;  4GTQ A;  3HXD A;  1DCE A;  4YDO A;  1KZO A;  3EU5 A;  4GTR A;  1TN7 A;  1X81 A;  2H6I A;  4EHM A;  4GTM A;  3PZ1 A;  1TNO A;  3PZ3 A;  3E30 A;  1KZP A;  3DPY A;  1TNZ A;  3Q75 A;  2R2L A;  3DSW A;  3E33 A;  2H6H A;  4LNB A;  1MZC A;  3PZ2 A;  3DSV A;  1N94 A;  3Q7F A;  1S64 A;  1N4S A;  3HXB A;  1D8D A;  1LTX A;  1N95 A;  1SA5 A;  2H6F A;  3DSX A;  3EUV A;  3HXE A;  1O5M A;  2F0Y A;  3E37 A;  4L9P A;  1TNU A;  1LD7 A;  3Q7A A;  3Q78 A;  1FT1 A;  3SFX A;  1N4Q A;  3KSQ A;  3E34 A;  1TNY A;  1QBQ A;  1LD8 A;  4GTT A;  4LNG A;  4GTO A;  3HXC A;  1SA4 A;  3DSU A;  4MBG A;  2IEJ A;  3DSS A;  1TNB A;  1JCS A;  1N4P A;  3Q79 A;  1TN6 A;  4YDE A;  3Q73 A;  1TN8 A;  3E32 A;  1O1S A;  1JCQ A;  4GTP A;  2BED A;  2ZIR A;  3C72 A;  1NL4 A;  1D8E A;  4GTS A;  3SFY A;  1FPP A; 
#chains in the Genus database with same CATH topology
 4J8Y A;  4GZ6 A;  3SHF A;  2WXG A;  2HO1 A;  4G8L A;  3DST A;  1N4R A;  3LY7 A;  4XKC A;  4KZ0 A;  2WXO A;  5D66 A;  2I1K A;  3L82 A;  4TUM A;  4FUL A;  4DPR A;  5G55 A;  1K8K G;  4EHM A;  1KZP A;  3S7F A;  2QYJ A;  4H7X A;  4N5Q A;  3CK8 A;  3D9J A;  4U0U A;  1ELR A;  1H6O A;  2OEV A;  2I6H A;  1NA3 A;  2XHE A;  2VJ8 A;  4DK5 A;  3DSV A;  1W3B A;  1WDY A;  1N4S A;  1U3C A;  5ENR D;  4RVB A;  5FQ6 A;  4APO A;  3NB2 A;  3OXG A;  1N0Q A;  4HLL A;  3JUE A;  1OWL A;  3BU8 A;  4HI8 A;  5G2N A;  5JJ6 A;  1RW2 A;  5CER B;  1EPU A;  4M7C A;  5AQ7 A;  3FH8 A;  4BFR A;  4ILG A;  2KAT A;  4WNF A;  2Q7F A;  3C3Q A;  3CVP A;  4MBG A;  1TNB A;  5AJD A;  3R9M A;  3EDT B;  4CGV A;  2XGM A;  1TJC A;  2VGX B;  3FTY A;  1MX4 A;  4QQI A;  2J07 A;  3CV0 A;  5ENO D;  1D8E A;  1Y6I A;  5EX0 A;  5FT9 A;  4CCA A;  3FUI A;  4DLO A;  2JLB A;  2ZIS A;  3QWP A;  1FCH A;  3CVX A;  4L2L A;  1YA0 A;  1MX6 A;  2ILR A;  4UWF A;  4HOS A;  1ZBP A;  4QFV A;  2EIL E;  3K9I A;  3TWW A;  3U9W A;  4BET A;  4ZFH A;  1QQE A;  4IRU A;  5BUZ A;  3ASN E;  4IN3 B;  4WWN A;  3T9K A;  2WQ6 A;  1OWO A;  2BTD A;  3D9I A;  3LVQ E;  4Q96 A;  5G05 C;  5B1A E;  3WXX A;  1E8X A;  3OXL A;  4BTA A;  3FTV A;  3MKR A;  4AY5 A;  4HOQ A;  2WXM A;  2E2E A;  4UWK A;  1H2V C;  5FZS A;  1V54 E;  3TAX A;  4DI4 A;  4A63 B;  4APF A;  4C0M A;  3UXG A;  4U0Z A;  2AVP A;  3G2S A;  1BI8 B;  3CVN A;  4CYM D;  3UTM A;  1IXV A;  2NXP A;  4YDE A;  3B7T A;  3UT8 A;  4EBA A;  1O1S A;  2ZIR A;  4N5C A;  1DNP A;  1NFI E;  4BX8 A;  2VTB B;  4B8C B;  4Z68 A;  1NI1 A;  2CFU A;  2DYS E;  5KJN A;  5CEA A;  1IKN D;  2BKG A;  1HXI A;  3ZNG A;  3U66 A;  1ZU2 A;  4LRZ A;  2A5U A;  2IOS A;  4ANU A;  1KLX A;  1SVX A;  5CED B;  1AP7 A;  5ENN A;  4I43 A;  2AXZ A;  1HS6 A;  4YVQ C;  3NQP A;  3GZS A;  5AEN A;  5BXO A;  4U7E B;  3HG0 D;  5CMY A;  2OOE A;  4ATZ D;  2LXM A;  4XX5 A;  4PS8 A;  1YCS B;  2DYR E;  3HVE B;  3S7B A;  2VGY A;  3MA5 A;  3PUK A;  3RO2 A;  3Q4A B;  2L0T B;  3FTU A;  5J08 A;  5G05 J;  5JMN D;  1D9S A;  3ZKJ A;  2Y4U A;  3UQ3 A;  4UI9 C;  4F1P A;  1TNY A;  2MOW A;  4KVO A;  4DX6 D;  3ML9 A;  4K5B A;  2X6H A;  3QKY A;  3J5Q B;  1BLX B;  2R05 A;  3MX3 A;  5KWD A;  2EIJ E;  2GRR B;  3DWL G;  4PDX A;  3D9H A;  2WB2 A;  2CG2 A;  2M63 A;  2VYI A;  3RU0 A;  3B7R L;  1N4P A;  2XZT G;  5EDS A;  3E32 A;  4J8D A;  3SF4 A;  2WQH A;  4GPK A;  2GRN B;  4HNA D;  3G2U A;  5CRU A;  4H7Y A;  4GTV A;  4KBQ A;  3B7B A;  2J4D A;  1N9A A;  4JPS A;  3D3M A;  2KBX A;  4BER A;  4U07 A;  3HXF A;  3LY9 A;  4XE0 A;  3LXU X;  1OT8 A;  4L23 A;  4K0R A;  1JCR A;  3APD A;  2BUG A;  4NUR A;  1JUQ A;  4GU5 A;  3D9L A;  3EIJ A;  3LVR E;  3PZ1 A;  4K5C A;  2R03 A;  1EDU A;  1PY1 A;  4F3V A;  1UJJ A;  1UJK A;  4BSX A;  2FO7 A;  3ENE A;  2PZI A;  3X2Q E;  1EF1 C;  1MZC A;  2A4Z A;  3ZYK A;  1HE8 A;  2XRZ A;  3ZYM A;  3UX4 A;  3TGO A;  2DZO A;  2P9K G;  3IBE A;  4L2Y A;  4NQ0 A;  3MEK A;  4L9P A;  3MYV A;  3Q15 A;  4N2S A;  2VSX E;  4BY6 A;  3ABL E;  1Z3X A;  3RRN B;  3JXI A;  4LNG A;  4JA9 A;  1L5J A;  3HYM B;  4AY6 A;  3BG1 B;  4UI9 J;  2P9L G;  4OVV A;  4B89 A;  3HIZ A;  4AIF A;  3SFZ A;  1TN8 A;  1OWP A;  5ARF A;  1JCQ A;  2P9I G;  4I1A A;  5B1B E;  2C0M A;  1E90 A;  3C72 A;  4JD2 G;  1QYM A;  1JPL A;  3U3W A;  2WXI A;  3FY4 A;  4WUY A;  3SD5 A;  1LF8 A;  3L54 A;  4FJY A;  4FA6 A;  2XS8 A;  3DEO A;  3UM0 A;  4WWO A;  3DRA A;  2ZU6 B;  5FJY A;  3AU5 A;  2PNN A;  5EX3 A;  5JA4 D;  2H6G A;  3KD7 A;  4U04 A;  3FU3 A;  3KEZ A;  4GAA A;  3MV3 B;  4HRN A;  2KZT A;  4FLB A;  4J7W A;  1KZO A;  2FEZ A;  3NOG D;  4GTR A;  3PNL B;  4DLQ A;  1TN7 A;  3L16 A;  4N39 A;  3PVL A;  3E30 A;  3UIP C;  5JHA A;  1U3D A;  3UT4 A;  3C98 A;  3CVQ A;  4UI9 K;  4CDM A;  5ENT D;  3RRM B;  4MLP A;  3EHR A;  3PUJ A;  1BI7 B;  4GYY A;  5JJ7 A;  3EU9 A;  3LY8 A;  3ZHE A;  1S64 A;  3FU5 A;  2RFA A;  3FP3 A;  4OAV B;  2LNI A;  3ZXS A;  3MZL B;  4L7T A;  1UW4 B;  2V5F A;  3NZU A;  3WG7 E;  4MKT A;  1E7U A;  4JXT A;  4AV7 A;  2VQ2 A;  4JHR A;  4MS6 A;  3Q7A A;  4G2V A;  3UKU G;  1PAQ A;  2IO3 C;  5C1D A;  4GTO A;  4LEU A;  3MGB A;  3FTS A;  4N2Q A;  1NZN A;  2J4B A;  1YMP A;  4HQD A;  4Q69 A;  3DEP A;  4I1M A;  2Y69 E;  2V5Q C;  5EYP F;  4BTB A;  4GML A;  3SFY A;  3IHV A;  1MQS A;  4OVU A;  3GZ1 A;  4N3A A;  4I9E A;  5EID A;  3ISM C;  3RSE G;  3V2O A;  2FO1 E;  2L6J A;  5DIZ A;  5FIN A;  3B7U X;  1OWN A;  2JEK A;  4GYW A;  2AW6 A;  4RQI A;  4U63 A;  4YVO A;  5BNW A;  4NAC A;  2YQ8 A;  3DPY A;  4AEZ C;  4BT8 A;  2ETA A;  2AJA A;  2WXN A;  5AYW D;  4IYP A;  3APC A;  3R7R A;  4GPM A;  5LFA A;  5CCM A;  5ANR A;  4I6J A;  3Q5M A;  4ANV A;  1IHB A;  1K1A A;  3C5R A;  1D8D A;  4DUI A;  1SW6 A;  4CT0 A;  3ZYQ A;  3BEE A;  2LSV A;  4GTT A;  4URK A;  5LOZ A;  4D10 C;  2KCL A;  2KCV A;  2XPI A;  5CMW A;  4ILI A;  3ZFW A;  3P1U A;  4BWR A;  2IFU A;  4CT4 A;  2XGS A;  2WXF A;  2MYO A;  4ATG A;  3OAW A;  2I9C A;  2P9P G;  5A23 A;  4DJA A;  5KJL A;  3GZ2 A;  5CEC B;  1E8W A;  4CEM A;  1WAO 1;  2IU1 A;  3C3R A;  4UQZ A;  1N54 A;  1O1T A;  1TJF A;  3JUI A;  4HS2 A;  2X3M A;  3ESL A;  3ZEF A;  3GYZ A;  4LSZ E;  3PEU B;  3G2W A;  4G24 A;  1XNF A;  4G26 A;  1X81 A;  4FHJ A;  4I6G A;  4OAU C;  3NOC D;  5ITZ F;  3KS2 A;  1HFA A;  4RG6 A;  4LUN U;  1OCR E;  2R2L A;  2P9S G;  4TXR A;  1HG5 A;  3G2T A;  2L0I A;  3CHR A;  5HS0 A;  1Z6T A;  3ASO E;  2LAI A;  3DSX A;  4CZ2 D;  5JJT A;  2F0Y A;  2XPY A;  1WY6 A;  2LUH A;  1HG2 A;  5C2Y A;  3JQ1 A;  4RLY A;  2AWI A;  1MHQ A;  4BT9 A;  4XZ4 A;  5T3R A;  5D0O D;  3LDZ A;  2WMN A;  2VGE A;  4U95 D;  4FC8 A;  3UKR G;  3EJN A;  4TXQ A;  4E6H A;  5D0Q D;  1JCS A;  3CQG B;  3FUN A;  3W9F A;  1BD8 A;  2ZGG A;  3U64 A;  1OUV A;  2LSU A;  4LNU D;  3PEV B;  4W9R A;  4ANX A;  3I4G A;  3FUD A;  2HM8 A;  4JB8 P;  5BPP A;  2FUL A;  5JHB A;  2Y4T A;  1O1R A;  3FUK A;  3V2X A;  2WXP A;  2ZXW E;  2WM9 A;  2FF4 A;  3QK0 A;  2F8X K;  1DCQ A;  3QB2 A;  3VLD A;  3P2B A;  4JHJ A;  3FH7 A;  4HRM B;  4O1O A;  3TWV A;  4DX1 A;  2XEH A;  5BV0 A;  3CHO A;  4V3I A;  2H6I A;  1HF8 A;  2F8Y A;  3PZ3 A;  4F6R D;  5B3S E;  3IXE A;  5EIL A;  3ASF A;  3Q75 A;  3QWW A;  4FP7 A;  3TWS A;  4U0S A;  2H6H A;  4LNB A;  2DBA A;  1N52 A;  4U96 D;  4HXI A;  2DIW A;  3T8K A;  1RZ4 A;  1OCZ E;  4K03 A;  3DBS A;  2H6F A;  3G2V A;  1ELK A;  4NRH B;  1K3Z D;  5KJK A;  4TUU A;  5FQ4 A;  4O1P A;  1FT1 A;  3SFX A;  1N11 A;  2WPV A;  1HH8 A;  4BES A;  4ME2 A;  4GMJ A;  1SA4 A;  2X6I A;  2XCC A;  4CGW A;  3TJP A;  4PUC A;  3CVW A;  3EHM A;  1H2T C;  1V55 E;  2YHE A;  4NIK A;  3E4B A;  3PE4 A;  3Q73 A;  3VLF A;  5H7P A;  2WQ7 A;  2BED A;  4DX2 A;  1QNF A;  2XS1 A;  3PRE A;  3SQV A;  2GW1 A;  5CBO A;  3CR3 A;  1TR4 A;  3TXN A;  2IQC A;  2R5S A;  2ETB A;  5FWQ A;  2HR2 A;  4TRQ A;  3R9A B;  2R02 A;  2NYJ A;  3QJZ A;  2KZT B;  4JZY A;  4U8V D;  4GZC A;  3QDN A;  5KCM A;  2B6C A;  4AVX A;  1MX2 A;  3CEQ A;  5T8I A;  3UUX A;  4DX5 D;  3EHN A;  3SNX A;  3FU6 A;  3PZ2 A;  4JW1 A;  4DI3 A;  5AJL A;  2NSZ A;  4OYS A;  3SBT B;  1KT0 A;  4WNE A;  4WAF A;  3HXB A;  1OWM A;  3LYA A;  1N95 A;  3ZHE B;  4I1O B;  4JC8 A;  2FI7 A;  3FUJ A;  3QOU A;  2AXU A;  2GRM A;  1OXJ A;  3HXC A;  4KMO A;  5J90 A;  3ZGQ A;  2XZD G;  3CHS A;  4HBD A;  2IEJ A;  3CHQ A;  4FU3 A;  4HOU A;  4KVM A;  3Q79 A;  1TN6 A;  2XQ0 A;  1UN8 A;  3AS5 A;  4G23 A;  3UT7 A;  3N71 A;  1S0P A;  2XGO A;  3FEY A;  4GCO A;  1Q2Z A;  3TWX A;  3LS8 A;  4N3C A;  4UQY A;  3PZ4 A;  3DXM G;  5A7D B;  1DC2 A;  3TG5 A;  4ABN A;  3ZXP A;  2YNQ A;  1X5B A;  3RKV A;  4F1S A;  3B13 A;  3PE3 A;  4C48 B;  1SQM A;  4FHK A;  2P58 C;  2XEE A;  3ULQ A;  1MJ0 A;  4DRX E;  3LJ3 A;  2QY7 A;  4GB9 A;  1FVH A;  4AJW A;  2RD0 A;  3LEW A;  4IUL A;  1HZ4 A;  3SGH A;  1JWF A;  3SY2 A;  5ENP D;  3O48 A;  4KT6 B;  2J8S D;  4B93 B;  4Y6C A;  3EUV A;  4A3V A;  4CDR A;  1O5M A;  5CHE E;  3EHQ A;  1LD7 A;  3UM2 A;  1KPS B;  4J8E A;  2UY1 A;  1LD8 A;  2B0O E;  4I17 A;  3L6A A;  2PQR A;  3TL5 A;  3Q9N C;  5A6C A;  3JXJ A;  3URZ A;  5ENS D;  4GA2 A;  4GZ5 A;  5T4Y A;  3CIA A;  2FBN A;  4UWH A;  4KZC A;  3I4R B;  3I5P A;  5AN8 A;  1NL4 A;  1IQU A;  3SI5 A;  1SZA A;  4LER A;  1H6K A;  3JQ0 A;  3AU4 A;  4EQF A;  4O60 A;  3CSF A;  3T8M A;  3AJI A;  1KT1 A;  3W9G A;  1OY3 D;  2XEN A;  4I2W A;  3ML8 A;  3Q9U C;  4PS7 A;  4G25 A;  1AWC B;  3CHP A;  4X8Q A;  4GTQ A;  3VTY A;  3OTN A;  3HXD A;  3VTX A;  4RG9 A;  4CRW A;  2VSO E;  4YDO A;  5BXU A;  1FVF A;  1IHG A;  3IV0 A;  5BV1 A;  1TNO A;  2GRO B;  3TWT A;  3ZVV A;  3KEA A;  2IOL A;  2KM4 A;  2P9U G;  3CKB A;  2OVF A;  2UWJ G;  1Z3Y A;  2JAB A;  3AG3 E;  4CDN A;  1P5Q A;  3Q7F A;  2V0P A;  1EYH A;  4YDW A;  5G04 C;  4EZJ A;  1S70 B;  3B95 A;  3D9N A;  1TNU A;  5D2M C;  4LG6 A;  5EN5 D;  3UIN C;  5IY5 E;  4ACK A;  3TWQ A;  3AG4 E;  2CHX A;  2I2O A;  3CK7 A;  3RAU A;  2YHC A;  3VLE A;  4EZK A;  5CRV A;  3FUE A;  3NZS A;  1B89 A;  4HOR A;  4F53 A;  2P2C P;  3V30 A;  4B0Z A;  4F7A A;  4AP2 A;  3D9P A;  4A1S A;  4XKB A;  3LKU A;  5E75 A;  2DVW A;  3AG2 E;  3FEX A;  2YIN A;  4BEP A;  2KCK A;  3EIQ C;  4FJZ A;  3FH5 A;  2GRP B;  3APF A;  3CVL A;  4JHK A;  4I2Z A;  2IY0 C;  4HVB A;  4GMR A;  2CHW A;  2GRL A;  3NAW A;  3LPZ A;  2KC7 A;  4UUC A;  3ASG A;  3SZ7 A;  3BUA A;  1NP7 A;  3UPV A;  3CLJ A;  1IQR A;  2OND A;  3ZUV B;  2WVI A;  5FZQ A;  4A1G A;  2X38 A;  2PL2 A;  2CHZ A;  2X6K A;  3ABK E;  3FTZ A;  4JL0 A;  4JEH A;  5LCW C;  5CBN A;  3QC1 A;  1N4Q A;  3NBN B;  3E34 A;  1ELW A;  2V8S E;  5AQA A;  5G04 J;  4HB5 A;  5DBK A;  3QAR A;  3DXK G;  3GW4 A;  4GZ3 A;  2WMO A;  1YYH A;  4UQX A;  4YDY A;  4Y6W A;  4HRL A;  2WXJ A;  3DSS A;  3PZD A;  3MKQ A;  1UN9 A;  3RJV A;  2WXK A;  1A5E A;  1U2V G;  2CFZ A;  2X6J A;  1H0A A;  5HKP A;  1N0R A;  2EQX A;  3UI2 A;  3QAQ A;  3RK6 A;  3IHY A;  4RSY A;  5ENQ D;  3S2A A;  2ZGD A;  3RO3 A;  5KNG A;  3ZIM A;  4DX7 D;  4MRU A;  2DWZ A;  5ARG A;  4EBA G;  2WXR A;  1WG0 A;  2LO6 A;  2F37 A;  3EU5 A;  4B94 A;  3PDN A;  3L13 A;  1MYO A;  3O4Z A;  3FHE A;  3TG4 A;  4AOF A;  3AS8 A;  3ZN3 A;  3ASD A;  3BG0 B;  5KBA A;  4J6I A;  4N3B A;  2C0L A;  3ULE G;  2QYU A;  1H19 A;  3E37 A;  3Q78 A;  3CVV A;  1TEZ A;  2IF4 A;  2OV8 A;  2GRQ B;  2R59 A;  4XEI G;  1Z5S C;  1PC2 A;  2DCP A;  4C9B B;  5LCW J;  5EIB E;  2J09 A;  4B8A A;  4ZHB A;  3FTX A;  4G11 A;  2VGX A;  3CVU A;  4PH4 B;  4E85 A;  3TWR A;  3BQO A;  1GW6 A;  2I1J A;  4UWG A;  5LX8 A;  3D9O A;  4J8F A;  4XIF A;  3JCK C;  4GA0 A;  2EIN E;  1INZ A;  3ZU7 B;  3L22 A;  2J49 A;  3LCA A;  2HE0 A;  2L6B A;  4FAD A;  4Q94 A;  1VDY A;  2RKK A;  3OXF A;  1FT2 A;  3LJN A;  3FFL A;  3FUL A;  1S63 A;  4WWP A;  3CST A;  3PRZ A;  4HFG A;  4UWL A;  1BU9 A;  1QZ2 A;  1UOH A;  2RG8 A;  5AQB A;  4A55 A;  5FTP A;  5FIO A;  4LCT A;  2V4H C;  3IEG A;  1H6P A;  3ULY A;  4ILH B;  3AG1 E;  1ZB1 A;  4C0E A;  2VSY A;  3ESK A;  1N94 A;  2P9N G;  4XI9 A;  2AXV A;  4WND A;  1LTX A;  1SA5 A;  1HO8 A;  1E8Y A;  2A5E A;  4AM9 A;  3F6Q A;  3D9M A;  3SBS A;  2LAH A;  3CQC B;  3U4T A;  3TWU A;  1QBQ A;  3L17 A;  2GGF A;  5HRY A;  3FWV A;  2UY1 B;  4I6E A;  3S7J A;  2QFC A;  5HQ8 A;  3MJW A;  1IYG A;  4GA1 A;  5ANL A;  4L1B A;  3ZPJ A;  3FUF A;  1BPO A;  4GTP A;  2C2L A;  5M72 A;  2VTB A;  3L9T A;  2J08 A;  4G8K A;  3KAE A;  3MCX A;  2QZA A;  2BF0 X;  2XCB A;  3S7D A;  5LP0 A;  3I3N A;  3B7S A;  3KSL A;  3FUH A;  5EKQ D;  4WNG A;  2Y3A A;  3FTW A;  4U8H A;  3HDX A;  2EIK E;  5FQ8 A;  1DCE A;  3QNK A;  4J0U A;  4PS3 A;  1WM5 A;  1Y8M A;  2VSN A;  4GZD A;  4K5A B;  3HHM A;  2QC9 A;  3T5V A;  1TNZ A;  2R17 C;  3ABM E;  5CCL A;  3JYS A;  4AXH A;  3ZW3 A;  3C3O A;  3J5P A;  2EIM E;  3DSW A;  5KJM A;  3E33 A;  4KYO B;  3HVE A;  2ETC A;  4ANW A;  4HI9 A;  5BT1 A;  4KXK B;  1UG3 A;  3CKC A;  4HLE A;  1TYQ G;  3FDH A;  3FU0 A;  1JWG A;  3UM3 A;  1E8Z A;  3HXE A;  2J9Q A;  4EZL A;  2DZN A;  4A3T A;  3KSQ A;  2IO2 C;  2Y1L E;  1K1B A;  5FZR A;  2E0I A;  2L9B A;  3ASH A;  2CG3 A;  3PNT B;  5FQ7 A;  2PM6 A;  3RRU A;  5BW8 C;  2PM7 A;  4R7L A;  2HYZ A;  4JVS A;  4M3O A;  3V31 A;  2OCC E;  4HOT A;  2NC9 A;  3CGH A;  1E96 B;  2Y0B G;  3MV2 B;  3ZYL A;  3UM1 A;  4GTS A;  2OVB A;  1FPP A;  4GCN A;  1H2U A;  3T5X A;  2WXL A;  2WXQ A;  4GYO A;  3TXM A;  4EEC A;  3ONK A;  3CVY A;  1NA0 A;  5EYL A;  4ACL A;  2MHK A;  5AIJ A;  4JEU A;  1G3N B;  5AQ9 A;  4O6F A;  1SZ9 A;  5KNH D;  3V79 K;  3PH0 C;  3PS6 A;  2WXH A;  4P29 A;  4GTM A;  2XPZ A;  3D9K A;  3CHM A;  3DPD A;  2XEV A;  4TXP A;  1HX8 A;  3Q47 B;  1OCC E;  1DVP A;  1HU3 A;  3AS4 A;  2LXL A;  3FUM A;  3CK9 A;  4J8S A;  4I9C A;  2XRY A;  3R7Q A;  3HRA A;  4EPZ A;  4G1T A;  2PQN A;  3UMV A;  4BSZ B;  3L08 A;  5AAO A;  1E7V A;  1A17 A;  4FLH A;  3NF1 A;  3ZRH A;  3Q49 B;  2V4L A;  2RFM A;  5AAR A;  2OEW A;  4XI0 A;  3DSU A;  2KXP C;  4YND A;  3UIO C;  1XGW A;  4U8Y D;  5HI7 A;  2IJG X;  3RIB A;  2MRI A;  4BX9 A;  4TV3 A;  2X6F A;  3MKQ B;  3IKO B;  1OCO E;  3AAA C;  4JA7 A;  5E76 A;  3QWV A;  3SO8 A;  2BKK B;  3ONL A;  2ION A; 
#chains in the Genus database with same CATH homology
 4GTV A;  1NI1 A;  2ZIS A;  3PZ4 A;  1O1R A;  1N9A A;  3KSL A;  3DRA A;  3HXF A;  3DST A;  1N4R A;  1FT2 A;  1O1T A;  1S63 A;  2H6G A;  1JCR A;  4GTQ A;  3HXD A;  1DCE A;  4YDO A;  1KZO A;  3EU5 A;  4GTR A;  1TN7 A;  1X81 A;  2H6I A;  4EHM A;  4GTM A;  3PZ1 A;  1TNO A;  3PZ3 A;  3E30 A;  1KZP A;  3DPY A;  1TNZ A;  3Q75 A;  2R2L A;  3DSW A;  3E33 A;  2H6H A;  4LNB A;  1MZC A;  3PZ2 A;  3DSV A;  1N94 A;  3Q7F A;  1S64 A;  1N4S A;  3HXB A;  1D8D A;  1LTX A;  1N95 A;  1SA5 A;  2H6F A;  3DSX A;  3EUV A;  3HXE A;  1O5M A;  2F0Y A;  3E37 A;  4L9P A;  1TNU A;  1LD7 A;  3Q7A A;  3Q78 A;  1FT1 A;  3SFX A;  1N4Q A;  3KSQ A;  3E34 A;  1TNY A;  1QBQ A;  1LD8 A;  4GTT A;  4LNG A;  4GTO A;  3HXC A;  1SA4 A;  3DSU A;  4MBG A;  2IEJ A;  3DSS A;  1TNB A;  1JCS A;  1N4P A;  3Q79 A;  1TN6 A;  4YDE A;  3Q73 A;  1TN8 A;  3E32 A;  1O1S A;  1JCQ A;  4GTP A;  2BED A;  2ZIR A;  3C72 A;  1NL4 A;  1D8E A;  4GTS A;  3SFY A;  1FPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...