3SG2A

Crystal structure of gcamp2-t116v,d381y
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
409
structure length
394
Chain Sequence
b'SSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKYTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 142
structure length 394
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg2A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg2A02
1BMOA 3NSIA 1J1DA 1AVSA 3SIBA 2QLHA 1M63B 5EXBA 2O60A 1YFPA 3H1RA 3M22A 2M1KB 1UISA 2G5ZB 4YGCB 3SVSA 1C07A 3RM1A 2JADA 4NWSA 1KQMC 1SYMA 3PJBA 1YRUB 1DGUA 2KSPA 3V3DA 2AHAA 5DTZA 1CDLA 3EK7A 2WISA 3IP2A 1XSSA 2B3QA 1YHHA 2KHNA 3UG0A 2LMTA 1TCFA 3BXBA 5I2QA 4GGFA 3DQJA 3SVBA 4DXOA 2I18A 4E68A 4IZNA 2I7AA 2PRUA 2P4MA 1RFJA 1LA0A 3LVAA 2HFCA 3VRPA 1XFYO 5AEQA 1EMFA 1GFLA 1SY9A 4FQOA 4Z4KA 2BCBA 1M46A 5EB7A 1KWOC 1ZOTB 2M7LA 2WURA 2G6YA 3CZTX 3NEZA 4PE0A 2LAPA 2DOQA 2Q6PA 2VADA 2LC5A 3SSYA 3OX6A 4MRXA 3BUMB 3WLCA 1BLQA 1WRZA 2NCOA 2KGRA 5AQBB 3TMTA 2SCPA 1B7TY 3IF7A 3UFZA 2VVIA 2LLUA 4N5XA 1KP5A 1DJXA 4JGEA 1SRAA 2F33A 1V1GA 4GUKA 1C7WA 3WHTB 2F2PA 1YX7A 2R2IA 3H1OA 3TDZA 1YTZC 4DKNA 1QVIZ 2LVKA 3SG4A 5CSFA 4MEWA 5KU1A 5HLOA 1A75A 2RGIA 4QJ4B 1PVBA 4AR7A 2LUCA 5DTYA 2ZMWA 2BBNA 2JQ6A 3MGFA 4LJDC 3WHUB 4W6PA 1CM4A 2JTZA 4W69A 3DF0B 4EDOA 1EMGA 4PPLA 2HPWA 4R6DA 4IK1A 3F45A 3ZUJA 1N0YA 4W6FA 3O2PA 2JRFA 3O77A 1S5GZ 2KBMA 1MR8A 2LHLA 4GFTA 4TNCA 4OKHA 1GGXA 3A4UB 2O24A 1QXTA 1QIVA 4W74A 3TS5B 3LVCA 3RLZA 4GF6B 3KEVA 2H9WA 1UHNA 2IE2A 3ST2A 1GGWA 4EMQA 4PCWA 4B5YA 3SVCA 4DS7A 2KAVA 3ZNIA 1UHIA 2ZKMX 1KFXL 3FS7A 2H5RA 3I5IB 4IL1A 4OR9B 1ODBA 3LVDA 3PIBA 1OQPA 1F4OA 2LLTA 3GOFA 2SASA 3O4YA 3LL8B 4B30B 1MYWA 2PXSA 1H8BA 1A29A 2A54B 5DPIA 4ZF5A 3TZ1A 2KYCA 2AMIA 3PATA 4U2VA 1JBZA 4EN1A 1DJHA 4W73A 1PALA 4Q9WA 5BTTA 1LVCD 1KK7Y 1YVLA 1OMRA 3OSRA 1ALVA 1CMGA 3DD4A 3CLNA 4H3NA 3ZTFA 1JUOA 2G6EA 1EMLA 2QT2A 3SVEA 2DUEA 3AKBA 3SVRA 1IH0A 1JFJA 2LHIA 2M0RA 1Y0VH 1YUTA 1OXFA 3ST0A 1B9AA 2HPSA 1EMCA 3DQ9A 4JEOA 1CMFA 1FI5A 2BKHB 1MHOA 4KGFA 2WC8A 2HJOA 3FWBA 4LJDA 1G4YR 3P28A 2ZN8A 3ZUFA 4JRBA 4ZB1A 1K9PA 2H6VA 2LMUA 2LV7A 2GX2A 4BY5A 1U5IB 3BXCA 3GJ1A 3DVJA 3SJSA 2KOTA 2HRSA 2BECA 4AS8A 1SW8A 2L98A 4AOMA 2KAYA 3IQOA 4L1IA 2QLGA 2TN4A 4CIDA 4IK3A 2V4EC 1NX3A 4OY4A 2C9IA 4A4CA 2IS9A 2HF5A 1UHHA 4DXMA 4W7DA 3OB1B 2I2RE 1KYRA 3U0MA 1TNQA 3RWTA 3TDIA 3SRYA 1J7OA 3VHTB 4W7AA 2LVVA 2JC2A 5PALA 3TS5C 4JWQA 4I2YA 4W6RA 1DJYA 2WNDA 1WRLA 1EMAA 4IK9A 4I5NB 1XFWO 4WQ2A 1ZGOA 5EJUA 4I5JA 4XVPA 1IJ5A 1QX7A 1AHRA 1S5GY 2FOTA 1DF0B 4IK4A 2YE1A 1YJFA 1EG3A 3DQUA 3DQ7A 3KF9A 3ST4A 2KI4B 5DPJA 1NX2A 5DQBA 3DQ1A 2NXQA 1TNXA 1LA3A 3I5IC 2HGDA 5EBJA 2HETA 1FBVA 1MXLC 1SL8A 2LVJA 2A46A 2JNXA 3WXAA 4DXPA 5LTRA 2MLEC 1Q4DA 2LP2A 3KHEA 3H4SE 1EH2A 1XA9A 4J88A 1LINA 5HZOA 1B7TZ 4I5KA 3E5WA 1UHKA 3CR5X 3OSQA 1J7RA 1S3PA 5ER4X 3D10A 2HQ8A 4ZBLA 1OZSA 1YR5A 2HQWA 5EXCI 1QLKA 3CFFA 1MXEA 2KQYA 4YGAA 3OHMB 5D7FA 4Q9XA 4TZGA 1EMBA 1XAEA 1OSAA 3WLDA 3DQKA 2PVBA 3CD1A 2EMOA 2DUFA 1HUYA 2PSRA 2JT8A 2QLIA 4HREE 2CNPA 1QATA 2Y5IA 2MJWB 3KO0A 2Z6YA 1KYPA 4PHKA 3PJ7A 2M29A 3TMRA 1CM1A 3SG5A 4Q7TA 3DF0A 3SS0A 1YURA 2M1UA 4PE1A 5D69A 4PFEA 2V4EA 5F9GA 4M2QA 4Z4MA 3U8AA 1BT6A 3BQ3A 4W6SA 4JC2A 3E5TA 1RTP1 4F0ZB 1QV0A 4ZINA 1K9UA 5T3IA 3SSKA 1A4PA 3SV5A 5HBDA 3TDUA 1CFDA 3BUXB 2ZNEA 1SCVA 2OJKA 3SSVA 1F8HA 1DJZA 2E30A 1DT7B 2RH7A 2LANA 2K61A 3OX5A 4KGEA 2ZMUA 2KGBC 2WORA 2A50B 1SR6B 1BOCA 2H2KA 4LJCA 1Q4BA 2WOSA 2LE9B 2L51A 1JF2A 2MA2A 3K1KA 2LNKA 2F8PA 4W6BA 2ZN9A 3RWAA 1IG5A 1XFZO 2KI4C 3DQIA 1KK7Z 4DCKA 5H88A 1BU3A 1SL9A 3GL4A 1HQVA 4W7XA 5TNCA 5HYDA 1F55A 2JU0A 2M9GA 2DD7A 3W1CA 1XK4C 3AI4A 3GK4X 3AAJA 2ICRA 1DTLA 1SNLA 2GX0A 1BODA 1F4QA 4AQJA 3DQEA 3U0LA 1X02A 4PE4A 2WSOA 4ZF3A 4N1FA 3BUNB 1TN4A 1YZWA 1YJ2A 1B8RA 1SK6D 1D1OA 1Y1AA 4GGNA 4NDBA 2DD9A 2GW3A 2G3DB 1AJ4A 2GV5A 2K2AA 3DQLA 2QPTA 4Q7RA 1AP4A 3DQNA 4XJKB 2YFPA 4KW8A 1U5IA 4W77A 2IB6A 1QS7A 5J3XA 4LQUA 4ANJA 5DU0A 1WDCB 2HGYA 4W7RA 2FWQA 1DMOA 1JBYA 4I5LB 1L2OB 4KW9A 4P76A 1H6RA 1CDMA 4FTGA 2MLFC 1KFUS 3DQ4A 5HKWA 1XYDA 1SCMB 1S36A 1CV7A 3VHTA 5LTPA 1NWDA 1YUSA 2C9JA 4DKMA 4CFQA 1PK0D 2A53B 4HQCA 4BDUA 3JVTB 3NSOA 1NX0A 2LP3A 2WCEA 1DF0A 1RMMA 3BXKA 1SBJA 4OQWA 1XFUO 3HX4A 3LS3A 2LLSA 2EMNA 2ZFDA 1SR6C 1KCYA 1GL4A 2PXWA 2ZO6A 1KK8B 2DDDA 2WHTA 1A2XA 4YGEB 1AK8A 5FVGA 1OMDA 1J7PA 1XO5A 1ZGQA 1KSMA 2D8NA 3M24A 1XK4A 2HQZA 1SKTA 2O5GA 5H89A 4DXNA 4J89A 3ZWHA 4ORAB 2G6XA 1Z1QA 3NXAA 3I5GB 3SIAA 3CD9A 1B1GA 2QLEA 2QACA 4L9MA 1B9CA 1K9KA 5DKQA 2A52B 4ORCB 1FI6A 4JQ0D 4PE7A 3BUOB 1A03A 2LM5A 3DQOA 1EMEA 1OE9B 2HCGA 1JC0A 4MRYA 2B1UA 2M3WA 5LTQA 2AUCA 2OGRA 4RTCA 1IRJA 1YX8A 3DQAA 2IB5A 4YI8A 3CBEA 2JNFA 5K89A 3I5FB 2A47A 1LKJA 5CSJA 4MBEA 4W6MA 1XVJA 4W6NA 2VVHA 3NSKA 3M0WA 4CLNA 4P1QA 3ADFA 1WLMA 5DPGA 3BOWB 1EMMA 3U8CA 4OGSA 4R1EA 5EXUA 2H5OA 4DUQA 1CLBA 3BXAA 1TTXA 1WDCC 2K7BA 5F6TA 3EVVA 2KNEA 1JSAA 2KBIA 1UP5A 3PLFB 4C0LA 1L2OC 1ZUZA 2CBLA 5AERA 1BR1B 5I2OA 5DPHA 1M39A 2JXLA 4DRWA 2OPOA 2KFHA 1MOUA 1GQMA 2H8QA 4W7EA 1SCMC 2E6WA 3DQHA 2AWJA 3A8SA 2IOVA 1A75B 1YHGA 1MQ1A 2CXJA 1EJ3A 3DQ2A 3BYAA 5EHUA 1JC1A 1JWDA 3A8RA 1W7TA 2BKIB 2P6BB 1RECA 3DQMA 2WHUA 3SVNA 1Q4EA 1ZMZA 4PPJA 1Y1XA 5LK4A 2KI6C 4HVFA 3LK1A 1H4BA 3LLEA 2BE6A 3EK4A 3GJ2A 3SG7A 1FF1A 5I2LA 1KK8C 4PPKA 1EG4A 2MBXA 1K2HA 1HT9A 3OGOA 1E8AA 2WCFA 3PALA 5JOLA 2O29A 1NCXA 2DUGA 3ZULA 4KEXA 4W6DA 3JTDB 4W6JA 2L50A 2FZUA 3DQ3A 1OXEA 1L7ZA 1QJTA 3VROA 3EKHA 3HCMA 1B4CA 5FHVA 2F3ZA 3I5GC 4CPVA 3EK8A 5HLVA 4HRGA 4ORNA 1XA5A 3ED8A 1WY9A 1G7KA 2EHBA 4MVFA 4YI9A 3GK1A 2VZXA 2KFGA 4USLA 2JPTA 1AUIB 3PSRA 1GJYA 1N65A 5CPVA 3DPWA 1YVHA 4W6GA 4XJKA 3SSPA 5IBWA 2L0PA 2F3YA 2KQ6A 2JOJA 4GGFC 1FW4A 3LF3A 1KSOA 4MZJA 3I5FC 1EMKA 2Y0GA 2AWLA 5FYXA 2WCBA 5HZTA 1BJFA 5AANA 3LA1A 2K7OA 2K8MB 5H87A 3VRQA 3PN7B 1TNWA 5B8IB 2K7DA 3G9AA 2G3OA 4W7FA 3PJ5A 4GESB 3LCPC 4WRIA 3SG2A 4LQTA 2GW4B 2OKYA 3U0NA 1JBAA 1K95A 1Y6WA 4ICBA 2MHHA 4YGDB 2MAZA 2GGMA 2B3PA 4W72A 2WSNA 1EXRA 2KDHA 5AXIA 1W7UA 2AAOA 4IK5A 3NF0A 5BT0A 1QASA 3DQCA 1IKUA 1R2UA 4HSZA 2V53A 5I8NA 1OMVA 1B8CA 4H3LA 3ICBA 3S05A 4U8DA 2FCDA 1G33A 5HW9A 1AJ5A 5DY6A 2PALA 2A4JA 3BUWB 4EDSA 3IR8A 2ZNDA 3MSEB 4KW4A 4ETOA 1KFUL 1MUXA 1IGVA 5J2OA 4B30A 4PHJA 4C0JA 4W7CA 3VRNA 3EVRA 3CR4X 3EKJA 2LVIA 1K8UA 1DJIA 2LMVA 1B47A 2ISDA 3VK1A 2A56B 3I19A 4ZFSA 3JTDC 1UURA 3CFAA 2OTGB 3CTNA 1RMPA 3NSLA 1ALWA 4DXQA 4P2YB 4JPZB 1WLZA 2AWMA 2BE4A 4XYNA 2O2BA 1ZGPA 1XMZA 4MSPA 3NT9A 2OS8B 4XGYA 4QJ5B 2PMYA 4J8AA 3SSTA 3FWCA 3GB3A 3D0YB 4W6TA 1PSRA 4YGBB 1NUBA 3CR2A 1CLMA 4A4BA 1TCOB 4RYSA 1CB1A 1S6JA 2JZIA 5GQQC 4BY4A 2COLB 5G08A 3BOWA 3AKOA 1RMOA 1Y1UA 4W6CA 2L2EA 1UUSA 4L13A 2M97A 1VRKA 3DQFA 4KA9A 3DQDA 2F2OA 1RRXA 3DPXA 2K7CA 4W6OA 2OKWA 1CFFA 5DRGA 2NZ0A 2NLNA 3PN7C 1S6ZA 2M7NA 2Z1OA 4W6UA 2Y1NA 4W75A 1NCYA 1TNPA 3NEDA 2DDCA 4WQ3A 1QIWA 1YUUA 1B8LA 3DVKA 2ZRTA 1EL4A 4DXIA 1IQ5A 2EC6B 3WNXB 3DPZA 1G8IA 2LCPA 2PASA 2JT0A 1NSHA 1YHIA 4JF9A 3U0KA 2V4EB 4MZLA 1QYOA 3DVMA 3KCTA 5EB6A 5HZSA 1QTXA 3SG6A 3SSLA 1GGZA 1OZOA 4N3DA 1Q73A 3GK2A 4N1GA 3VGOA 1RK9A 2CT9A 1Q80A 1BFPA 1J1EA 3CGLA 2QU1A 2BBMA 4ZIOA 1M31A 2KAXA 1K93D 3DQ6A 5HKYA 2JWWA 3CS1A 1F71A 1BG1A 4KAGA 2POXA 3E3RA 5FVIA 2CCMA 2JXCA 2BL0B 1CFCA 2FL1A 2OTGC 2WHSA 1SL7A 1TIZA 1KYSA 1UHJA 1QV1A 4UPGA 2CTNA 1IWQA 1CLLA 1RM9A 2JT3A 2BTJA 4M2OA 4KPIA 4H47A 1N2DA 2Q91A 3KCSA 3EVPA 4LJBA 4W6AA 1S6CA 3LF4B 3DVEA 2G2SB 3CFHA 4GNKB 3PFVA 1JFKA 1DJWA 2VAEA 4NDDA 2QRFA 3PM8A 2OS8C 2Q4UA 2OTEA 4OJ0A 2YDZA 3TUYB 1NIWA 1RJVA 1R6PA 3OB2B 4H3MA 1XFVO 1W7JB 1CDNA 2Y1MA 1PULA 2KFFA 1IQ3A 1NX1A 4HRHA 2WIQA 1DJGA 5AFPA 1S1EA 1QY3A 2ARLA 2K2FA 1V1FA 5JJGA 1OOJA 4P5OE 4AQIA 1RWYA 1UWOA 2KI6D 3FIAA 5HZUA 4HQ9A 4OCIA 4W6HA 3SVOA 2DUIA 4C0KA 4DIRA 2G16B 1MOVA 5KTYA 2H5PA 1PVAA 1Z1PA 1QYQA 4GAOA 1ZUXA 3VRRA 1F70A 4PHMA 4PALA 3I5HB 3W1DA 1NYAA 1M45A 1J55A 1CTRA 1KQVA 4D1EA 5DTXA 1Q4AA 2LUXA 1CDPA 1DVIA 1JC2A 4M2PA 3LSAA 5FVFA 4GPLB 2EC6C 4LW5A 4KF5C 1C4FA 4MZKA 1LXFC 4ZCUA 2M49B 4NDCA 2JULA 1NP8A 1QVIY 3JVTC 2NCPA 3LK0A 2GGZA 1MWNA 4XL5A 1CFPA 4W6LA 1KFXS 4Q04A 2VRGA 1ZFSA 1XFXO 3CB9A 4ZCVA 1WRKA 4OHSA 3NT3A 4TZAA 2FJUB 3SG3A 4YBHB 1PSBA 1QX5B 2H61C 5CSIA 2OTBA 4OVNF 1YRTB 2K0JA 4JFGA 4EULA 1NCZA 4R6BA 4PHNA 1XQMA 5DQMA 4CFRA 1QYFA 5DKNA 4W6IA 2BCXA 1F09A 3P8UA 2Z6ZA 3E5VA 1KQMB 2G2BA 2ZO7A 3SVDA 1NPQA 2Q57A 2BL0C 1HCJA 2DUHA 2VVJA 2AH8A 3K21A 3D0YA 4PDZA 1S26D 2L5XB 3WCKA 3AI5A 1H4UA 2EMDA 4OV2A 3KPXA 2QZ0A 2YE0A 3AKAA 2BCAA 1CKKA 5BPJA 1MF8B 5HKZA 1J7QA 4HE4A 1W7SA 3VICA 1KWOB 3O78A 4NQGA 3TUYC 3U8PA 4XOWA 4GOBA 4W6KA 5DRFA 4ZF4A 5ER5A 2MRDA 2H5QA 1C7VA 3AAKA 5BTTB 2KYFA 1K90D 1Q4CA 3ST3A 4GBAA 1TRFA 1BF5A 2Z6XA 2A48A 1W7IB 3QRXA 2L4IA 1F0BA 5HGEA 4MLWA 3O6BA 1BR4B 4KF4A 1TOPA 2AWKA 5DTLA 3EVUA 1OXDA 3DQ8A 2G9BA 4KF5A 1QXPA 3SSHA 3I5HC 2ZRSA 5CSNA 4YRUA 3BX9A 1DGVA 5KTGA 1K96A 1RROA 4UTSA 3SVUA 3OP0A 1S6IA 4W76A 2HQKA 2EGDA 2I94A 4MN0A 4HQ8A 5KSZA 1QLSA 3DQ5A 1JF0A 1SPYA 4XOVA 1SMGA 4L12A 1FPWA 5DKRA 2M8UA 1IJ6A 4RYWA 2H61A 1CNPA 4ORBB 4QJ3B 3GEXA 4H48A 4Q7UA 2Y4QA 1PRWA 1F54A 1QX2A 5BQLA 3IQQA 2QLGB 3C1VA 3CWGA 4IK8A 1K94A 2JTTA 3CGAA 2L4HA 1ZACA 2FCEA
chains in the Genus database with same CATH superfamily
1BMOA 3NSIA 1J1DA 1AVSA 1QWVA 3SIBA 2QLHA 1M63B 5EXBA 2O60A 3CABA 1YFPA 3H1RA 3M22A 2M1KB 1UISA 4INXA 2G5ZB 4YGCB 3SVSA 1C07A 3RM1A 2JADA 4NWSA 1KQMC 1SYMA 3PJBA 1YRUB 1DGUA 2KSPA 3V3DA 2AHAA 5DTZA 1CDLA 3EK7A 2WISA 3IP2A 1XSSA 2B3QA 1YHHA 4JD9A 2KHNA 3UG0A 2LMTA 1TCFA 3BXBA 1GM0A 5I2QA 4GGFA 3DQJA 3SVBA 4DXOA 2I18A 4E68A 4IZNA 2I7AA 2PRUA 2P4MA 1RFJA 3QMEA 1LA0A 2PQLA 3LVAA 2HFCA 3VRPA 1XFYO 5AEQA 1EMFA 1GFLA 1SY9A 4FQOA 4Z4KA 2BCBA 1M46A 5EB7A 1KWOC 1ZOTB 2M7LA 2WURA 2G6YA 3CZTX 3NEZA 4PE0A 2LAPA 2DOQA 2Q6PA 2VADA 2LC5A 3SSYA 3OX6A 4MRXA 3BUMB 3WLCA 1BLQA 1WRZA 2NCOA 2KGRA 5AQBB 3TMTA 2SCPA 1B7TY 2QDIA 3IF7A 3UFZA 2VVIA 2LLUA 4N5XA 1KP5A 1DJXA 4JGEA 1SRAA 2F33A 1V1GA 4GUKA 1C7WA 3WHTB 2F2PA 1YX7A 2R2IA 3H1OA 2K60A 3TDZA 1YTZC 4DKNA 1QVIZ 2LVKA 3SG4A 5CSFA 4MEWA 5KU1A 5HLOA 3S0DA 1A75A 2RGIA 4QJ4B 1PVBA 4AR7A 2LUCA 5DTYA 2ZMWA 2BBNA 1OOIX 3O4XA 2JQ6A 3MGFA 4LJDC 3WHUB 4W6PA 1CM4A 2JTZA 4W69A 1DEKA 3DF0B 4EDOA 1EMGA 4PPLA 1P28A 2HPWA 4R6DA 3CZ2A 4IK1A 3F45A 3ZUJA 2QEOA 1N0YA 4W6FA 3O2PA 2JRFA 3O77A 1S5GZ 2KBMA 1MR8A 2LHLA 4GFTA 4TNCA 4OKHA 1GGXA 3A4UB 2O24A 1QXTA 1TUZA 1QIVA 4W74A 3Q8IA 3TS5B 3LVCA 3RLZA 4GF6B 3KEVA 2H9WA 1UHNA 2IE2A 3ST2A 1GGWA 4EMQA 4PCWA 4B5YA 3SVCA 4DS7A 2KAVA 3ZNIA 1UHIA 2ZKMX 1KFXL 3FS7A 2H5RA 3I5IB 4IL1A 4OR9B 1ODBA 3LVDA 3PIBA 1OQPA 1F4OA 2LLTA 3GOFA 3DXLA 2SASA 3O4YA 3LL8B 4B30B 1LS8A 2FJYA 1MYWA 2PXSA 1H8BA 1A29A 2A54B 5DPIA 4ZF5A 3TZ1A 2KYCA 2AMIA 3SS5A 3PATA 4U2VA 1JBZA 4EN1A 1DJHA 5D3OA 4W73A 1PALA 4Q9WA 5BTTA 1LVCD 1KK7Y 1YVLA 1OMRA 3OSRA 1ALVA 1CMGA 3DD4A 3CLNA 4H3NA 3ZTFA 1JUOA 2G6EA 3S0AA 1EMLA 2QT2A 3SVEA 2DUEA 3AKBA 3SVRA 1IH0A 1JFJA 2JPOA 2LHIA 2M0RA 1Y0VH 1YUTA 1OXFA 3ST0A 1B9AA 2HPSA 1EMCA 3DQ9A 4JEOA 1CMFA 1FI5A 2BKHB 1W9ZA 1MHOA 3EG5B 4KGFA 2WC8A 2HJOA 3FWBA 4LJDA 1G4YR 3P28A 2ZN8A 3ZUFA 4JRBA 4ZB1A 1K9PA 2H6VA 2LMUA 2LV7A 2GX2A 4BY5A 1U5IB 3BXCA 3GJ1A 3DVJA 3SJSA 2KOTA 2HRSA 2BECA 4AS8A 1SW8A 2L98A 4AOMA 2KAYA 3RZSA 3IQOA 4L1IA 2QLGA 2TN4A 4CIDA 4IK3A 2V4EC 1NX3A 4OY4A 2C9IA 4A4CA 2IS9A 2HF5A 1UHHA 4DXMA 4W7DA 3OB1B 2I2RE 1KYRA 3U0MA 1TNQA 3RWTA 3B6XA 3TDIA 3SRYA 1J7OA 3VHTB 4W7AA 2LVVA 1C3YA 2JC2A 5PALA 3S0EA 2BNXA 3TS5C 4JWQA 4I2YA 4W6RA 1DJYA 2WNDA 1WRLA 1EMAA 4IK9A 3OBVA 4I5NB 1XFWO 4WQ2A 1ZGOA 5EJUA 4I5JA 2YGUA 4XVPA 1IJ5A 1QX7A 1AHRA 1S5GY 2FOTA 1DF0B 4IK4A 2YE1A 1YJFA 1EG3A 3DQUA 3DQ7A 3KF9A 3ST4A 2KI4B 5DPJA 1NX2A 5DQBA 3DQ1A 3DY9A 2NXQA 1TNXA 1LA3A 3I5IC 2HGDA 5EBJA 2HETA 1FBVA 1MXLC 1SL8A 2LVJA 2A46A 2JNXA 3WXAA 4DXPA 5LTRA 2MLEC 1Q4DA 2LP2A 3KHEA 3H4SE 1EH2A 1XA9A 4J88A 1LINA 5HZOA 1B7TZ 4I5KA 3E5WA 1UHKA 3CR5X 3OSQA 1J7RA 1OOHA 1S3PA 2PYQA 5ER4X 3D10A 2HQ8A 4ZBLA 1OZSA 1YR5A 2HQWA 3PJIA 5EXCI 1QLKA 3CFFA 1MXEA 2KQYA 4YGAA 3OHMB 5D7FA 4Q9XA 4TZGA 1EMBA 1XAEA 1OSAA 2WCKA 3WLDA 3DQKA 2PVBA 3CD1A 2EMOA 2DUFA 1HUYA 3R1VA 2PSRA 2JT8A 2QLIA 4HREE 2CNPA 1QATA 2Y5IA 2MJWB 3KO0A 2Z6YA 1KYPA 3R1OA 4PHKA 3PJ7A 2M29A 3TMRA 1CM1A 3SG5A 4Q7TA 3DF0A 3SS0A 4PT1A 1YURA 2M1UA 3CYZA 4PE1A 5D69A 4PFEA 2V4EA 5F9GA 4M2QA 4Z4MA 3B87A 3U8AA 1BT6A 3BQ3A 4W6SA 4JC2A 3E5TA 1RTP1 4F0ZB 1QV0A 4ZINA 1K9UA 5T3IA 3SSKA 1A4PA 3SV5A 5HBDA 3TDUA 1CFDA 2KLEA 3BUXB 2ZNEA 1SCVA 2OJKA 3SSVA 4F7FA 1F8HA 1DJZA 2E30A 2L2CA 1DT7B 2RH7A 2LANA 2K61A 3OX5A 4KGEA 2ZMUA 2KGBC 2WORA 2A50B 1SR6B 1BOCA 2H2KA 4LJCA 1Q4BA 2WOSA 2LE9B 2L51A 1JF2A 2MA2A 3K1KA 2KPHA 2LNKA 2F8PA 4W6BA 2ZN9A 3RWAA 1IG5A 1XFZO 2KI4C 3DQIA 5FI6A 1KK7Z 4DCKA 5H88A 1BU3A 1SL9A 3GL4A 1HQVA 4W7XA 5TNCA 5HYDA 1F55A 2JU0A 2M9GA 2DD7A 3W1CA 1XK4C 3AI4A 3GK4X 4KYNA 3AAJA 2ICRA 1TUJA 1DTLA 1SNLA 2GX0A 3SS3A 1BODA 1F4QA 4AQJA 1TWOA 3DQEA 3U0LA 1X02A 4PE4A 2WSOA 4ZF3A 4N1FA 3BUNB 1TN4A 1YZWA 1YJ2A 1B8RA 1SK6D 1D1OA 1Y1AA 4GGNA 4NDBA 2DD9A 2GW3A 2G3DB 1AJ4A 2GV5A 2K2AA 3DQLA 2QPTA 4Q7RA 3S0GA 1AP4A 3DQNA 4XJKB 2YFPA 4KW8A 1U5IA 4W77A 2IB6A 1QS7A 5J3XA 3B86A 4LQUA 4ANJA 5DU0A 1WDCB 1C3ZA 2HGYA 4W7RA 2FWQA 1DMOA 1JBYA 4I5LB 1L2OB 4KW9A 3CDNA 3VB1A 4P76A 1H6RA 1CDMA 4FTGA 2MLFC 1KFUS 3DQ4A 5HKWA 1XYDA 1SCMB 1S36A 1CV7A 3VHTA 5LTPA 1NWDA 1YUSA 2C9JA 4DKMA 4CFQA 1PK0D 2A53B 4HQCA 4BDUA 3JVTB 3NSOA 1NX0A 2LP3A 2WCEA 1DF0A 1RMMA 3BXKA 1SBJA 3CZ1A 4OQWA 1XFUO 3HX4A 3LS3A 2LLSA 2EMNA 2ZFDA 1SR6C 1KCYA 1GL4A 2PXWA 2ZO6A 1KK8B 2DDDA 2WHTA 1A2XA 4YGEB 1AK8A 5FVGA 1OMDA 4INWA 1J7PA 1XO5A 1ZGQA 1KSMA 2D8NA 3M24A 1XK4A 5FI7A 2HQZA 1SKTA 2O5GA 5H89A 4DXNA 4J89A 3ZWHA 4ORAB 2G6XA 1Z1QA 3NXAA 3I5GB 3S0BA 3SIAA 3CD9A 1B1GA 2QLEA 2QACA 4L9MA 1B9CA 1K9KA 5DKQA 2A52B 4ORCB 1FI6A 4JQ0D 4PE7A 3BUOB 1A03A 2LM5A 3DQOA 1EMEA 1OE9B 2HCGA 1JC0A 4MRYA 2B1UA 2M3WA 3R72A 5LTQA 3FE9A 2AUCA 2QEHA 2OGRA 4RTCA 1IRJA 1YX8A 3DQAA 2IB5A 4YI8A 3NGVA 3CBEA 2JNFA 5K89A 3I5FB 2A47A 4IJ7A 2BAPA 1LKJA 5CSJA 4MBEA 4W6MA 1XVJA 4W6NA 2VVHA 3NSKA 3M0WA 2WCHA 4CLNA 4P1QA 3BFBA 1WLMA 3ADFA 5DPGA 3UO9A 3BOWB 1EMMA 3U8CA 4OGSA 4R1EA 5EXUA 2H5OA 4DUQA 1CLBA 3BXAA 1TTXA 1WDCC 2K7BA 5F6TA 3EVVA 2KNEA 1JSAA 2KBIA 1UP5A 3PLFB 4C0LA 1L2OC 1ZUZA 2CBLA 5AERA 1BR1B 5I2OA 5DPHA 1M39A 2JXLA 4DRWA 2OPOA 2KFHA 1MOUA 1GQMA 2H8QA 4W7EA 1OOGA 1SCMC 2E6WA 3DQHA 2AWJA 3A8SA 2IOVA 1A75B 1YHGA 1MQ1A 2CXJA 1EJ3A 3DQ2A 3BYAA 5EHUA 3NHTA 1JC1A 1JWDA 2P70A 3A8RA 1W7TA 2BKIB 2P6BB 1RECA 3DQMA 2WHUA 3SVNA 1Q4EA 3D74A 1ZMZA 4PPJA 1Y1XA 5LK4A 2KI6C 4HVFA 3LK1A 1H4BA 3LLEA 2BE6A 3EK4A 3GJ2A 3SG7A 1FF1A 5I2LA 1KK8C 4PPKA 1EG4A 2MBXA 1K2HA 1HT9A 3OGOA 1E8AA 2WCFA 3PALA 5JOLA 3BJHA 3D77A 2O29A 3D73A 1DELA 1NCXA 2DUGA 3ZULA 4KEXA 4W6DA 3JTDB 4W6JA 2L50A 2FZUA 3DQ3A 1OXEA 3NHIA 1L7ZA 1QJTA 3VROA 3EKHA 3HCMA 3DZTA 1B4CA 2H8VA 5FHVA 2F3ZA 3I5GC 4CPVA 3BFAA 3EK8A 5HLVA 4HRGA 4ORNA 1XA5A 3ED8A 5EL2A 1WY9A 1G7KA 2ERBA 2EHBA 4OZDA 5DICA 4MVFA 4YI9A 3GK1A 2VZXA 2KFGA 4USLA 2JPTA 1AUIB 3PSRA 1GJYA 1N65A 3DYEA 5CPVA 3DPWA 1YVHA 4W6GA 4XJKA 3SSPA 5IBWA 2L0PA 2F3YA 2KQ6A 2JOJA 4GGFC 1FW4A 3LF3A 1KSOA 4MZJA 3I5FC 1EMKA 3SS4A 3D78A 2Y0GA 2AWLA 5FYXA 2WCBA 5HZTA 1BJFA 5AANA 3LA1A 2K7OA 2K8MB 5H87A 3VRQA 3PN7B 1TNWA 5B8IB 2K7DA 3G9AA 2G3OA 4W7FA 3PJ5A 4GESB 3LCPC 4WRIA 3SG2A 4LQTA 2GW4B 2OKYA 3U0NA 1JBAA 1K95A 1Y6WA 4ICBA 2MHHA 4YGDB 2MAZA 2GGMA 2B3PA 4W72A 2KLDA 2WSNA 3PM2A 1EXRA 2KDHA 5AXIA 1W7UA 2QEBA 2AAOA 4IK5A 3NF0A 5BT0A 1QASA 3DQCA 1IKUA 1R2UA 4HSZA 2V53A 5I8NA 1OMVA 3V2LA 1B8CA 4H3LA 3ICBA 3S05A 4U8DA 2FCDA 1G33A 2WCMA 5HW9A 1AJ5A 5DY6A 2PALA 2A4JA 3BUWB 4EDSA 3IR8A 2ZNDA 3MSEB 4KW4A 4ETOA 1KFUL 1MUXA 1IGVA 5J2OA 4B30A 4PHJA 4C0JA 4W7CA 3VRNA 3EVRA 3CR4X 1OW4A 3EKJA 2LVIA 1K8UA 1DJIA 2LMVA 1B47A 2ISDA 3VK1A 2A56B 3I19A 1IIOA 2L5YA 4ZFSA 3JTDC 1UURA 3CFAA 2OTGB 3CTNA 1RMPA 3NSLA 1ALWA 4DXQA 4P2YB 4JPZB 1XFRA 1WLZA 2AWMA 2BE4A 4XYNA 2O2BA 1ZGPA 1XMZA 4MSPA 3NT9A 2OS8B 3S0FA 4XGYA 4QJ5B 2PMYA 4J8AA 3SSTA 3FWCA 3GB3A 3CZ0A 3D0YB 4W6TA 1PSRA 4YGBB 2GTEA 1NUBA 3CR2A 1CLMA 4A4BA 1TCOB 4RYSA 1CB1A 1S6JA 2JZIA 5GQQC 4BY4A 2COLB 5G08A 3BOWA 3AKOA 1RMOA 1Y1UA 4W6CA 2L2EA 3FE6A 1UUSA 1SSEB 4L13A 2M97A 1VRKA 3DQFA 4KA9A 3DQDA 2F2OA 1RRXA 3DPXA 2K7CA 4W6OA 2OKWA 1CFFA 5DRGA 2NZ0A 2NLNA 3PN7C 1S6ZA 2M7NA 2Z1OA 4W6UA 2Y1NA 4W75A 1NCYA 1TNPA 3NEDA 2DDCA 4WQ3A 1QIWA 1YUUA 1B8LA 3DVKA 2ZRTA 1EL4A 4DXIA 1IQ5A 2EC6B 3WNXB 3DPZA 1G8IA 2LCPA 2PASA 2JT0A 1NSHA 1YHIA 4JF9A 3U0KA 2V4EB 4MZLA 1QYOA 3DVMA 3KCTA 5EB6A 5HZSA 1QTXA 3SG6A 3SSLA 1GGZA 1OZOA 4N3DA 1Z2CB 1Q73A 1ORGA 3GK2A 4N1GA 3VGOA 1RK9A 2CT9A 1Q80A 1BFPA 1J1EA 3CGLA 2QU1A 3R1PA 2BBMA 4ZIOA 1M31A 2KAXA 1K93D 3DQ6A 5HKYA 2JWWA 3CS1A 1F71A 1BG1A 4KAGA 2POXA 3E3RA 5FVIA 2CCMA 2JXCA 2BL0B 1CFCA 2FL1A 2OTGC 2WHSA 1SL7A 1TIZA 1KYSA 1UHJA 1QV1A 4UPGA 2CTNA 1IWQA 1CLLA 1RM9A 2JT3A 2BTJA 4M2OA 4KPIA 4H47A 1N2DA 2Q91A 3KCSA 3EVPA 4LJBA 4W6AA 1S6CA 3LF4B 3DVEA 2G2SB 3CFHA 4GNKB 3PFVA 1JFKA 1DJWA 2VAEA 4NDDA 2QRFA 3PM8A 2OS8C 2Q4UA 1Z4HA 2OTEA 4OJ0A 2YDZA 3TUYB 1NIWA 3FE8A 1RJVA 1R6PA 3OB2B 4H3MA 1XFVO 1W7JB 1CDNA 2Y1MA 1PULA 2KFFA 1IQ3A 1NX1A 3OGNA 4HRHA 2WIQA 1DJGA 5AFPA 1S1EA 1QY3A 2ARLA 2K2FA 1V1FA 5JJGA 2WCLA 1OOJA 4P5OE 4AQIA 3D75A 1RWYA 1UWOA 2KI6D 3FIAA 5HZUA 4HQ9A 4OCIA 4W6HA 3SVOA 2DUIA 4C0KA 4DIRA 2G16B 1MOVA 5KTYA 2H5PA 1PVAA 1Z1PA 1QYQA 4GAOA 1ZUXA 3VRRA 1F70A 4PHMA 4PALA 3I5HB 3W1DA 1NYAA 1DQEA 1M45A 1J55A 2WC6A 1CTRA 1KQVA 5HL1A 4D1EA 5DTXA 1Q4AA 2LUXA 1CDPA 1DVIA 5I94A 1JC2A 4M2PA 3LSAA 5FVFA 3L4LA 4GPLB 2EC6C 4LW5A 4KF5C 1C4FA 4MZKA 1LXFC 4ZCUA 2M49B 3D76A 4NDCA 2JULA 4FQTA 1NP8A 1QVIY 3JVTC 2NCPA 3LK0A 2GGZA 1MWNA 4XL5A 1CFPA 4W6LA 1KFXS 4Q04A 2VRGA 1ZFSA 1XFXO 3CB9A 4ZCVA 1WRKA 4OHSA 3NT3A 3K1EA 4TZAA 2FJUB 3SG3A 4YBHB 1PSBA 1QX5B 2H61C 5CSIA 2OTBA 4OVNF 1YRTB 2K0JA 4JFGA 4EULA 1NCZA 4R6BA 4PHNA 1XQMA 5DQMA 4CFRA 1QYFA 5DKNA 4W6IA 2BCXA 1F09A 3P8UA 2Z6ZA 3E5VA 1KQMB 2G2BA 2ZO7A 3SVDA 1NPQA 2Q57A 2BL0C 1HCJA 2DUHA 2VVJA 2AH8A 3K21A 3L4AA 3D0YA 4PDZA 1S26D 1T14A 2L5XB 3WCKA 3AI5A 1H4UA 2EMDA 4OV2A 3KPXA 4JKTA 2QZ0A 2YE0A 3AKAA 2BCAA 2WC5A 1CKKA 5BPJA 3B7AA 2P71A 1MF8B 5HKZA 1J7QA 3L47A 4HE4A 1W7SA 3VICA 1KWOB 3O78A 1OOFA 4NQGA 3TUYC 3U8PA 4XOWA 4GOBA 4W6KA 5DRFA 4ZF4A 5ER5A 2MRDA 2H5QA 3B88A 1C7VA 3AAKA 3IVTA 3BFHA 5BTTB 2KYFA 1K90D 1Q4CA 2QEVA 3ST3A 4GBAA 1TRFA 1BF5A 2Z6XA 2A48A 3N7HA 1W7IB 3QRXA 2L4IA 1F0BA 5HGEA 4MLWA 3O6BA 1BR4B 4KF4A 1TOPA 2AWKA 5DTLA 3EVUA 1OXDA 3DQ8A 2G9BA 4KF5A 1QXPA 3SSHA 3I5HC 2ZRSA 5CSNA 4YRUA 3BX9A 1DGVA 5KTGA 1K96A 1RROA 4UTSA 3SVUA 3OP0A 1S6IA 4W76A 2HQKA 2EGDA 2I94A 4MN0A 4HQ8A 5KSZA 2WCJA 1QLSA 3DQ5A 1JF0A 1SPYA 4XOVA 3UNWA 1SMGA 4L12A 1FPWA 5DKRA 2M8UA 1IJ6A 4RYWA 2H61A 1CNPA 4ORBB 4QJ3B 3GEXA 4H48A 4Q7UA 2Y4QA 1PRWA 1F54A 1QX2A 5BQLA 3IQQA 2QLGB 3C1VA 1DC1A 3CWGA 4IK8A 1K94A 2JTTA 5FI2A 3CGAA 2L4HA 1ZACA 2FCEA
chains in the Genus database with same CATH topology
1BMOA 3NSIA 1J1DA 1AVSA 3SIBA 2QLHA 1M63B 5EXBA 2O60A 1YFPA 3H1RA 3M22A 2M1KB 1UISA 2G5ZB 4YGCB 3SVSA 1C07A 3RM1A 2JADA 4NWSA 1KQMC 1SYMA 3PJBA 1YRUB 1DGUA 2KSPA 3V3DA 2AHAA 5DTZA 1CDLA 3EK7A 2WISA 3IP2A 1XSSA 2B3QA 1YHHA 2KHNA 3UG0A 2LMTA 1TCFA 3BXBA 5I2QA 4GGFA 3DQJA 3SVBA 4DXOA 2I18A 4E68A 4IZNA 2I7AA 2PRUA 2P4MA 1RFJA 1LA0A 3LVAA 2HFCA 3VRPA 1XFYO 5AEQA 1EMFA 1GFLA 1SY9A 4FQOA 4Z4KA 2BCBA 1M46A 5EB7A 1KWOC 1ZOTB 2M7LA 2WURA 2G6YA 3CZTX 3NEZA 4PE0A 2LAPA 2DOQA 2Q6PA 2VADA 2LC5A 3SSYA 3OX6A 4MRXA 3BUMB 3WLCA 1BLQA 1WRZA 2NCOA 2KGRA 5AQBB 3TMTA 2SCPA 1B7TY 3IF7A 3UFZA 2VVIA 2LLUA 4N5XA 1KP5A 1DJXA 4JGEA 1SRAA 2F33A 1V1GA 4GUKA 1C7WA 3WHTB 2F2PA 1YX7A 2R2IA 3H1OA 3TDZA 1YTZC 4DKNA 1QVIZ 2LVKA 3SG4A 5CSFA 4MEWA 5KU1A 5HLOA 1A75A 2RGIA 4QJ4B 1PVBA 4AR7A 2LUCA 5DTYA 2ZMWA 2BBNA 2JQ6A 3MGFA 4LJDC 3WHUB 4W6PA 1CM4A 2JTZA 4W69A 3DF0B 4EDOA 1EMGA 4PPLA 2HPWA 4R6DA 4IK1A 3F45A 3ZUJA 1N0YA 4W6FA 3O2PA 2JRFA 3O77A 1S5GZ 2KBMA 1MR8A 2LHLA 4GFTA 4TNCA 4OKHA 1GGXA 3A4UB 2O24A 1QXTA 1QIVA 4W74A 3TS5B 3LVCA 3RLZA 4GF6B 3KEVA 2H9WA 1UHNA 2IE2A 3ST2A 1GGWA 4EMQA 4PCWA 4B5YA 3SVCA 4DS7A 2KAVA 3ZNIA 1UHIA 2ZKMX 1KFXL 3FS7A 2H5RA 3I5IB 4IL1A 4OR9B 1ODBA 3LVDA 3PIBA 1OQPA 1F4OA 2LLTA 3GOFA 2SASA 3O4YA 3LL8B 4B30B 1MYWA 2PXSA 1H8BA 1A29A 2A54B 5DPIA 4ZF5A 3TZ1A 2KYCA 2AMIA 3PATA 4U2VA 1JBZA 4EN1A 1DJHA 4W73A 1PALA 4Q9WA 5BTTA 1LVCD 1KK7Y 1YVLA 1OMRA 3OSRA 1ALVA 1CMGA 3DD4A 3CLNA 4H3NA 3ZTFA 1JUOA 2G6EA 1EMLA 2QT2A 3SVEA 2DUEA 3AKBA 3SVRA 1IH0A 1JFJA 2LHIA 2M0RA 1Y0VH 1YUTA 1OXFA 3ST0A 1B9AA 2HPSA 1EMCA 3DQ9A 4JEOA 1CMFA 1FI5A 2BKHB 1MHOA 4KGFA 2WC8A 2HJOA 3FWBA 4LJDA 1G4YR 3P28A 2ZN8A 3ZUFA 4JRBA 4ZB1A 1K9PA 2H6VA 2LMUA 2LV7A 2GX2A 4BY5A 1U5IB 3BXCA 3GJ1A 3DVJA 3SJSA 2KOTA 2HRSA 2BECA 4AS8A 1SW8A 2L98A 4AOMA 2KAYA 3IQOA 4L1IA 2QLGA 2TN4A 4CIDA 4IK3A 2V4EC 1NX3A 4OY4A 2C9IA 4A4CA 2IS9A 2HF5A 1UHHA 4DXMA 4W7DA 3OB1B 2I2RE 1KYRA 3U0MA 1TNQA 3RWTA 3TDIA 3SRYA 1J7OA 3VHTB 4W7AA 2LVVA 2JC2A 5PALA 3TS5C 4JWQA 4I2YA 4W6RA 1DJYA 2WNDA 1WRLA 1EMAA 4IK9A 4I5NB 1XFWO 4WQ2A 1ZGOA 5EJUA 4I5JA 4XVPA 1IJ5A 1QX7A 1AHRA 1S5GY 2FOTA 1DF0B 4IK4A 2YE1A 1YJFA 1EG3A 3DQUA 3DQ7A 3KF9A 3ST4A 2KI4B 5DPJA 1NX2A 5DQBA 3DQ1A 2NXQA 1TNXA 1LA3A 3I5IC 2HGDA 5EBJA 2HETA 1FBVA 1MXLC 1SL8A 2LVJA 2A46A 2JNXA 3WXAA 4DXPA 5LTRA 2MLEC 1Q4DA 2LP2A 3KHEA 3H4SE 1EH2A 1XA9A 4J88A 1LINA 5HZOA 1B7TZ 4I5KA 3E5WA 1UHKA 3CR5X 3OSQA 1J7RA 1S3PA 5ER4X 3D10A 2HQ8A 4ZBLA 1OZSA 1YR5A 2HQWA 5EXCI 1QLKA 3CFFA 1MXEA 2KQYA 4YGAA 3OHMB 5D7FA 4Q9XA 4TZGA 1EMBA 1XAEA 1OSAA 3WLDA 3DQKA 2PVBA 3CD1A 2EMOA 2DUFA 1HUYA 2PSRA 2JT8A 2QLIA 4HREE 2CNPA 1QATA 2Y5IA 2MJWB 3KO0A 2Z6YA 1KYPA 4PHKA 3PJ7A 2M29A 3TMRA 1CM1A 3SG5A 4Q7TA 3DF0A 3SS0A 1YURA 2M1UA 4PE1A 5D69A 4PFEA 2V4EA 5F9GA 4M2QA 4Z4MA 3U8AA 1BT6A 3BQ3A 4W6SA 4JC2A 3E5TA 1RTP1 4F0ZB 1QV0A 4ZINA 1K9UA 5T3IA 3SSKA 1A4PA 3SV5A 5HBDA 3TDUA 1CFDA 3BUXB 2ZNEA 1SCVA 2OJKA 3SSVA 1F8HA 1DJZA 2E30A 1DT7B 2RH7A 2LANA 2K61A 3OX5A 4KGEA 2ZMUA 2KGBC 2WORA 2A50B 1SR6B 1BOCA 2H2KA 4LJCA 1Q4BA 2WOSA 2LE9B 2L51A 1JF2A 2MA2A 3K1KA 2LNKA 2F8PA 4W6BA 2ZN9A 3RWAA 1IG5A 1XFZO 2KI4C 3DQIA 1KK7Z 4DCKA 5H88A 1BU3A 1SL9A 3GL4A 1HQVA 4W7XA 5TNCA 5HYDA 1F55A 2JU0A 2M9GA 2DD7A 3W1CA 1XK4C 3AI4A 3GK4X 3AAJA 2ICRA 1DTLA 1SNLA 2GX0A 1BODA 1F4QA 4AQJA 3DQEA 3U0LA 1X02A 4PE4A 2WSOA 4ZF3A 4N1FA 3BUNB 1TN4A 1YZWA 1YJ2A 1B8RA 1SK6D 1D1OA 1Y1AA 4GGNA 4NDBA 2DD9A 2GW3A 2G3DB 1AJ4A 2GV5A 2K2AA 3DQLA 2QPTA 4Q7RA 1AP4A 3DQNA 4XJKB 2YFPA 4KW8A 1U5IA 4W77A 2IB6A 1QS7A 5J3XA 4LQUA 4ANJA 5DU0A 1WDCB 2HGYA 4W7RA 2FWQA 1DMOA 1JBYA 4I5LB 1L2OB 4KW9A 4P76A 1H6RA 1CDMA 4FTGA 2MLFC 1KFUS 3DQ4A 5HKWA 1XYDA 1SCMB 1S36A 1CV7A 3VHTA 5LTPA 1NWDA 1YUSA 2C9JA 4DKMA 4CFQA 1PK0D 2A53B 4HQCA 4BDUA 3JVTB 3NSOA 1NX0A 2LP3A 2WCEA 1DF0A 1RMMA 3BXKA 1SBJA 4OQWA 1XFUO 3HX4A 3LS3A 2LLSA 2EMNA 2ZFDA 1SR6C 1KCYA 1GL4A 2PXWA 2ZO6A 1KK8B 2DDDA 2WHTA 1A2XA 4YGEB 1AK8A 5FVGA 1OMDA 1J7PA 1XO5A 1ZGQA 1KSMA 2D8NA 3M24A 1XK4A 2HQZA 1SKTA 2O5GA 5H89A 4DXNA 4J89A 3ZWHA 4ORAB 2G6XA 1Z1QA 3NXAA 3I5GB 3SIAA 3CD9A 1B1GA 2QLEA 2QACA 4L9MA 1B9CA 1K9KA 5DKQA 2A52B 4ORCB 1FI6A 4JQ0D 4PE7A 3BUOB 1A03A 2LM5A 3DQOA 1EMEA 1OE9B 2HCGA 1JC0A 4MRYA 2B1UA 2M3WA 5LTQA 2AUCA 2OGRA 4RTCA 1IRJA 1YX8A 3DQAA 2IB5A 4YI8A 3CBEA 2JNFA 5K89A 3I5FB 2A47A 1LKJA 5CSJA 4MBEA 4W6MA 1XVJA 4W6NA 2VVHA 3NSKA 3M0WA 4CLNA 4P1QA 3ADFA 1WLMA 5DPGA 3BOWB 1EMMA 3U8CA 4OGSA 4R1EA 5EXUA 2H5OA 4DUQA 1CLBA 3BXAA 1TTXA 1WDCC 2K7BA 5F6TA 3EVVA 2KNEA 1JSAA 2KBIA 1UP5A 3PLFB 4C0LA 1L2OC 1ZUZA 2CBLA 5AERA 1BR1B 5I2OA 5DPHA 1M39A 2JXLA 4DRWA 2OPOA 2KFHA 1MOUA 1GQMA 2H8QA 4W7EA 1SCMC 2E6WA 3DQHA 2AWJA 3A8SA 2IOVA 1A75B 1YHGA 1MQ1A 2CXJA 1EJ3A 3DQ2A 3BYAA 5EHUA 1JC1A 1JWDA 3A8RA 1W7TA 2BKIB 2P6BB 1RECA 3DQMA 2WHUA 3SVNA 1Q4EA 1ZMZA 4PPJA 1Y1XA 5LK4A 2KI6C 4HVFA 3LK1A 1H4BA 3LLEA 2BE6A 3EK4A 3GJ2A 3SG7A 1FF1A 5I2LA 1KK8C 4PPKA 1EG4A 2MBXA 1K2HA 1HT9A 3OGOA 1E8AA 2WCFA 3PALA 5JOLA 2O29A 1NCXA 2DUGA 3ZULA 4KEXA 4W6DA 3JTDB 4W6JA 2L50A 2FZUA 3DQ3A 1OXEA 1L7ZA 1QJTA 3VROA 3EKHA 3HCMA 1B4CA 5FHVA 2F3ZA 3I5GC 4CPVA 3EK8A 5HLVA 4HRGA 4ORNA 1XA5A 3ED8A 1WY9A 1G7KA 2EHBA 4MVFA 4YI9A 3GK1A 2VZXA 2KFGA 4USLA 2JPTA 1AUIB 3PSRA 1GJYA 1N65A 5CPVA 3DPWA 1YVHA 4W6GA 4XJKA 3SSPA 5IBWA 2L0PA 2F3YA 2KQ6A 2JOJA 4GGFC 1FW4A 3LF3A 1KSOA 4MZJA 3I5FC 1EMKA 2Y0GA 2AWLA 5FYXA 2WCBA 5HZTA 1BJFA 5AANA 3LA1A 2K7OA 2K8MB 5H87A 3VRQA 3PN7B 1TNWA 5B8IB 2K7DA 3G9AA 2G3OA 4W7FA 3PJ5A 4GESB 3LCPC 4WRIA 3SG2A 4LQTA 2GW4B 2OKYA 3U0NA 1JBAA 1K95A 1Y6WA 4ICBA 2MHHA 4YGDB 2MAZA 2GGMA 2B3PA 4W72A 2WSNA 1EXRA 2KDHA 5AXIA 1W7UA 2AAOA 4IK5A 3NF0A 5BT0A 1QASA 3DQCA 1IKUA 1R2UA 4HSZA 2V53A 5I8NA 1OMVA 1B8CA 4H3LA 3ICBA 3S05A 4U8DA 2FCDA 1G33A 5HW9A 1AJ5A 5DY6A 2PALA 2A4JA 3BUWB 4EDSA 3IR8A 2ZNDA 3MSEB 4KW4A 4ETOA 1KFUL 1MUXA 1IGVA 5J2OA 4B30A 4PHJA 4C0JA 4W7CA 3VRNA 3EVRA 3CR4X 3EKJA 2LVIA 1K8UA 1DJIA 2LMVA 1B47A 2ISDA 3VK1A 2A56B 3I19A 4ZFSA 3JTDC 1UURA 3CFAA 2OTGB 3CTNA 1RMPA 3NSLA 1ALWA 4DXQA 4P2YB 4JPZB 1WLZA 2AWMA 2BE4A 4XYNA 2O2BA 1ZGPA 1XMZA 4MSPA 3NT9A 2OS8B 4XGYA 4QJ5B 2PMYA 4J8AA 3SSTA 3FWCA 3GB3A 3D0YB 4W6TA 1PSRA 4YGBB 1NUBA 3CR2A 1CLMA 4A4BA 1TCOB 4RYSA 1CB1A 1S6JA 2JZIA 5GQQC 4BY4A 2COLB 5G08A 3BOWA 3AKOA 1RMOA 1Y1UA 4W6CA 2L2EA 1UUSA 4L13A 2M97A 1VRKA 3DQFA 4KA9A 3DQDA 2F2OA 1RRXA 3DPXA 2K7CA 4W6OA 2OKWA 1CFFA 5DRGA 2NZ0A 2NLNA 3PN7C 1S6ZA 2M7NA 2Z1OA 4W6UA 2Y1NA 4W75A 1NCYA 1TNPA 3NEDA 2DDCA 4WQ3A 1QIWA 1YUUA 1B8LA 3DVKA 2ZRTA 1EL4A 4DXIA 1IQ5A 2EC6B 3WNXB 3DPZA 1G8IA 2LCPA 2PASA 2JT0A 1NSHA 1YHIA 4JF9A 3U0KA 2V4EB 4MZLA 1QYOA 3DVMA 3KCTA 5EB6A 5HZSA 1QTXA 3SG6A 3SSLA 1GGZA 1OZOA 4N3DA 1Q73A 3GK2A 4N1GA 3VGOA 1RK9A 2CT9A 1Q80A 1BFPA 1J1EA 3CGLA 2QU1A 2BBMA 4ZIOA 1M31A 2KAXA 1K93D 3DQ6A 5HKYA 2JWWA 3CS1A 1F71A 1BG1A 4KAGA 2POXA 3E3RA 5FVIA 2CCMA 2JXCA 2BL0B 1CFCA 2FL1A 2OTGC 2WHSA 1SL7A 1TIZA 1KYSA 1UHJA 1QV1A 4UPGA 2CTNA 1IWQA 1CLLA 1RM9A 2JT3A 2BTJA 4M2OA 4KPIA 4H47A 1N2DA 2Q91A 3KCSA 3EVPA 4LJBA 4W6AA 1S6CA 3LF4B 3DVEA 2G2SB 3CFHA 4GNKB 3PFVA 1JFKA 1DJWA 2VAEA 4NDDA 2QRFA 3PM8A 2OS8C 2Q4UA 2OTEA 4OJ0A 2YDZA 3TUYB 1NIWA 1RJVA 1R6PA 3OB2B 4H3MA 1XFVO 1W7JB 1CDNA 2Y1MA 1PULA 2KFFA 1IQ3A 1NX1A 4HRHA 2WIQA 1DJGA 5AFPA 1S1EA 1QY3A 2ARLA 2K2FA 1V1FA 5JJGA 1OOJA 4P5OE 4AQIA 1RWYA 1UWOA 2KI6D 3FIAA 5HZUA 4HQ9A 4OCIA 4W6HA 3SVOA 2DUIA 4C0KA 4DIRA 2G16B 1MOVA 5KTYA 2H5PA 1PVAA 1Z1PA 1QYQA 4GAOA 1ZUXA 3VRRA 1F70A 4PHMA 4PALA 3I5HB 3W1DA 1NYAA 1M45A 1J55A 1CTRA 1KQVA 4D1EA 5DTXA 1Q4AA 2LUXA 1CDPA 1DVIA 1JC2A 4M2PA 3LSAA 5FVFA 4GPLB 2EC6C 4LW5A 4KF5C 1C4FA 4MZKA 1LXFC 4ZCUA 2M49B 4NDCA 2JULA 1NP8A 1QVIY 3JVTC 2NCPA 3LK0A 2GGZA 1MWNA 4XL5A 1CFPA 4W6LA 1KFXS 4Q04A 2VRGA 1ZFSA 1XFXO 3CB9A 4ZCVA 1WRKA 4OHSA 3NT3A 4TZAA 2FJUB 3SG3A 4YBHB 1PSBA 1QX5B 2H61C 5CSIA 2OTBA 4OVNF 1YRTB 2K0JA 4JFGA 4EULA 1NCZA 4R6BA 4PHNA 1XQMA 5DQMA 4CFRA 1QYFA 5DKNA 4W6IA 2BCXA 1F09A 3P8UA 2Z6ZA 3E5VA 1KQMB 2G2BA 2ZO7A 3SVDA 1NPQA 2Q57A 2BL0C 1HCJA 2DUHA 2VVJA 2AH8A 3K21A 3D0YA 4PDZA 1S26D 2L5XB 3WCKA 3AI5A 1H4UA 2EMDA 4OV2A 3KPXA 2QZ0A 2YE0A 3AKAA 2BCAA 1CKKA 5BPJA 1MF8B 5HKZA 1J7QA 4HE4A 1W7SA 3VICA 1KWOB 3O78A 4NQGA 3TUYC 3U8PA 4XOWA 4GOBA 4W6KA 5DRFA 4ZF4A 5ER5A 2MRDA 2H5QA 1C7VA 3AAKA 5BTTB 2KYFA 1K90D 1Q4CA 3ST3A 4GBAA 1TRFA 1BF5A 2Z6XA 2A48A 1W7IB 3QRXA 2L4IA 1F0BA 5HGEA 4MLWA 3O6BA 1BR4B 4KF4A 1TOPA 2AWKA 5DTLA 3EVUA 1OXDA 3DQ8A 2G9BA 4KF5A 1QXPA 3SSHA 3I5HC 2ZRSA 5CSNA 4YRUA 3BX9A 1DGVA 5KTGA 1K96A 1RROA 4UTSA 3SVUA 3OP0A 1S6IA 4W76A 2HQKA 2EGDA 2I94A 4MN0A 4HQ8A 5KSZA 1QLSA 3DQ5A 1JF0A 1SPYA 4XOVA 1SMGA 4L12A 1FPWA 5DKRA 2M8UA 1IJ6A 4RYWA 2H61A 1CNPA 4ORBB 4QJ3B 3GEXA 4H48A 4Q7UA 2Y4QA 1PRWA 1F54A 1QX2A 5BQLA 3IQQA 2QLGB 3C1VA 3CWGA 4IK8A 1K94A 2JTTA 3CGAA 2L4HA 1ZACA 2FCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BMO A;  3NSI A;  1J1D A;  1AVS A;  3SIB A;  2QLH A;  1M63 B;  5EXB A;  2O60 A;  1YFP A;  3H1R A;  3M22 A;  2M1K B;  1UIS A;  2G5Z B;  4YGC B;  3SVS A;  1C07 A;  3RM1 A;  2JAD A;  4NWS A;  1KQM C;  1SYM A;  3PJB A;  1YRU B;  1DGU A;  2KSP A;  3V3D A;  2AHA A;  5DTZ A;  1CDL A;  3EK7 A;  2WIS A;  3IP2 A;  1XSS A;  2B3Q A;  1YHH A;  2KHN A;  3UG0 A;  2LMT A;  1TCF A;  3BXB A;  5I2Q A;  4GGF A;  3DQJ A;  3SVB A;  4DXO A;  2I18 A;  4E68 A;  4IZN A;  2I7A A;  2PRU A;  2P4M A;  1RFJ A;  1LA0 A;  3LVA A;  2HFC A;  3VRP A;  1XFY O;  5AEQ A;  1EMF A;  1GFL A;  1SY9 A;  4FQO A;  4Z4K A;  2BCB A;  1M46 A;  5EB7 A;  1KWO C;  1ZOT B;  2M7L A;  2WUR A;  2G6Y A;  3CZT X;  3NEZ A;  4PE0 A;  2LAP A;  2DOQ A;  2Q6P A;  2VAD A;  2LC5 A;  3SSY A;  3OX6 A;  4MRX A;  3BUM B;  3WLC A;  1BLQ A;  1WRZ A;  2NCO A;  2KGR A;  5AQB B;  3TMT A;  2SCP A;  1B7T Y;  3IF7 A;  3UFZ A;  2VVI A;  2LLU A;  4N5X A;  1KP5 A;  1DJX A;  4JGE A;  1SRA A;  2F33 A;  1V1G A;  4GUK A;  1C7W A;  3WHT B;  2F2P A;  1YX7 A;  2R2I A;  3H1O A;  3TDZ A;  1YTZ C;  4DKN A;  1QVI Z;  2LVK A;  3SG4 A;  5CSF A;  4MEW A;  5KU1 A;  5HLO A;  1A75 A;  2RGI A;  4QJ4 B;  1PVB A;  4AR7 A;  2LUC A;  5DTY A;  2ZMW A;  2BBN A;  2JQ6 A;  3MGF A;  4LJD C;  3WHU B;  4W6P A;  1CM4 A;  2JTZ A;  4W69 A;  3DF0 B;  4EDO A;  1EMG A;  4PPL A;  2HPW A;  4R6D A;  4IK1 A;  3F45 A;  3ZUJ A;  1N0Y A;  4W6F A;  3O2P A;  2JRF A;  3O77 A;  1S5G Z;  2KBM A;  1MR8 A;  2LHL A;  4GFT A;  4TNC A;  4OKH A;  1GGX A;  3A4U B;  2O24 A;  1QXT A;  1QIV A;  4W74 A;  3TS5 B;  3LVC A;  3RLZ A;  4GF6 B;  3KEV A;  2H9W A;  1UHN A;  2IE2 A;  3ST2 A;  1GGW A;  4EMQ A;  4PCW A;  4B5Y A;  3SVC A;  4DS7 A;  2KAV A;  3ZNI A;  1UHI A;  2ZKM X;  1KFX L;  3FS7 A;  2H5R A;  3I5I B;  4IL1 A;  4OR9 B;  1ODB A;  3LVD A;  3PIB A;  1OQP A;  1F4O A;  2LLT A;  3GOF A;  2SAS A;  3O4Y A;  3LL8 B;  4B30 B;  1MYW A;  2PXS A;  1H8B A;  1A29 A;  2A54 B;  5DPI A;  4ZF5 A;  3TZ1 A;  2KYC A;  2AMI A;  3PAT A;  4U2V A;  1JBZ A;  4EN1 A;  1DJH A;  4W73 A;  1PAL A;  4Q9W A;  5BTT A;  1LVC D;  1KK7 Y;  1YVL A;  1OMR A;  3OSR A;  1ALV A;  1CMG A;  3DD4 A;  3CLN A;  4H3N A;  3ZTF A;  1JUO A;  2G6E A;  1EML A;  2QT2 A;  3SVE A;  2DUE A;  3AKB A;  3SVR A;  1IH0 A;  1JFJ A;  2LHI A;  2M0R A;  1Y0V H;  1YUT A;  1OXF A;  3ST0 A;  1B9A A;  2HPS A;  1EMC A;  3DQ9 A;  4JEO A;  1CMF A;  1FI5 A;  2BKH B;  1MHO A;  4KGF A;  2WC8 A;  2HJO A;  3FWB A;  4LJD A;  1G4Y R;  3P28 A;  2ZN8 A;  3ZUF A;  4JRB A;  4ZB1 A;  1K9P A;  2H6V A;  2LMU A;  2LV7 A;  2GX2 A;  4BY5 A;  1U5I B;  3BXC A;  3GJ1 A;  3DVJ A;  3SJS A;  2KOT A;  2HRS A;  2BEC A;  4AS8 A;  1SW8 A;  2L98 A;  4AOM A;  2KAY A;  3IQO A;  4L1I A;  2QLG A;  2TN4 A;  4CID A;  4IK3 A;  2V4E C;  1NX3 A;  4OY4 A;  2C9I A;  4A4C A;  2IS9 A;  2HF5 A;  1UHH A;  4DXM A;  4W7D A;  3OB1 B;  2I2R E;  1KYR A;  3U0M A;  1TNQ A;  3RWT A;  3TDI A;  3SRY A;  1J7O A;  3VHT B;  4W7A A;  2LVV A;  2JC2 A;  5PAL A;  3TS5 C;  4JWQ A;  4I2Y A;  4W6R A;  1DJY A;  2WND A;  1WRL A;  1EMA A;  4IK9 A;  4I5N B;  1XFW O;  4WQ2 A;  1ZGO A;  5EJU A;  4I5J A;  4XVP A;  1IJ5 A;  1QX7 A;  1AHR A;  1S5G Y;  2FOT A;  1DF0 B;  4IK4 A;  2YE1 A;  1YJF A;  1EG3 A;  3DQU A;  3DQ7 A;  3KF9 A;  3ST4 A;  2KI4 B;  5DPJ A;  1NX2 A;  5DQB A;  3DQ1 A;  2NXQ A;  1TNX A;  1LA3 A;  3I5I C;  2HGD A;  5EBJ A;  2HET A;  1FBV A;  1MXL C;  1SL8 A;  2LVJ A;  2A46 A;  2JNX A;  3WXA A;  4DXP A;  5LTR A;  2MLE C;  1Q4D A;  2LP2 A;  3KHE A;  3H4S E;  1EH2 A;  1XA9 A;  4J88 A;  1LIN A;  5HZO A;  1B7T Z;  4I5K A;  3E5W A;  1UHK A;  3CR5 X;  3OSQ A;  1J7R A;  1S3P A;  5ER4 X;  3D10 A;  2HQ8 A;  4ZBL A;  1OZS A;  1YR5 A;  2HQW A;  5EXC I;  1QLK A;  3CFF A;  1MXE A;  2KQY A;  4YGA A;  3OHM B;  5D7F A;  4Q9X A;  4TZG A;  1EMB A;  1XAE A;  1OSA A;  3WLD A;  3DQK A;  2PVB A;  3CD1 A;  2EMO A;  2DUF A;  1HUY A;  2PSR A;  2JT8 A;  2QLI A;  4HRE E;  2CNP A;  1QAT A;  2Y5I A;  2MJW B;  3KO0 A;  2Z6Y A;  1KYP A;  4PHK A;  3PJ7 A;  2M29 A;  3TMR A;  1CM1 A;  3SG5 A;  4Q7T A;  3DF0 A;  3SS0 A;  1YUR A;  2M1U A;  4PE1 A;  5D69 A;  4PFE A;  2V4E A;  5F9G A;  4M2Q A;  4Z4M A;  3U8A A;  1BT6 A;  3BQ3 A;  4W6S A;  4JC2 A;  3E5T A;  1RTP 1;  4F0Z B;  1QV0 A;  4ZIN A;  1K9U A;  5T3I A;  3SSK A;  1A4P A;  3SV5 A;  5HBD A;  3TDU A;  1CFD A;  3BUX B;  2ZNE A;  1SCV A;  2OJK A;  3SSV A;  1F8H A;  1DJZ A;  2E30 A;  1DT7 B;  2RH7 A;  2LAN A;  2K61 A;  3OX5 A;  4KGE A;  2ZMU A;  2KGB C;  2WOR A;  2A50 B;  1SR6 B;  1BOC A;  2H2K A;  4LJC A;  1Q4B A;  2WOS A;  2LE9 B;  2L51 A;  1JF2 A;  2MA2 A;  3K1K A;  2LNK A;  2F8P A;  4W6B A;  2ZN9 A;  3RWA A;  1IG5 A;  1XFZ O;  2KI4 C;  3DQI A;  1KK7 Z;  4DCK A;  5H88 A;  1BU3 A;  1SL9 A;  3GL4 A;  1HQV A;  4W7X A;  5TNC A;  5HYD A;  1F55 A;  2JU0 A;  2M9G A;  2DD7 A;  3W1C A;  1XK4 C;  3AI4 A;  3GK4 X;  3AAJ A;  2ICR A;  1DTL A;  1SNL A;  2GX0 A;  1BOD A;  1F4Q A;  4AQJ A;  3DQE A;  3U0L A;  1X02 A;  4PE4 A;  2WSO A;  4ZF3 A;  4N1F A;  3BUN B;  1TN4 A;  1YZW A;  1YJ2 A;  1B8R A;  1SK6 D;  1D1O A;  1Y1A A;  4GGN A;  4NDB A;  2DD9 A;  2GW3 A;  2G3D B;  1AJ4 A;  2GV5 A;  2K2A A;  3DQL A;  2QPT A;  4Q7R A;  1AP4 A;  3DQN A;  4XJK B;  2YFP A;  4KW8 A;  1U5I A;  4W77 A;  2IB6 A;  1QS7 A;  5J3X A;  4LQU A;  4ANJ A;  5DU0 A;  1WDC B;  2HGY A;  4W7R A;  2FWQ A;  1DMO A;  1JBY A;  4I5L B;  1L2O B;  4KW9 A;  4P76 A;  1H6R A;  1CDM A;  4FTG A;  2MLF C;  1KFU S;  3DQ4 A;  5HKW A;  1XYD A;  1SCM B;  1S36 A;  1CV7 A;  3VHT A;  5LTP A;  1NWD A;  1YUS A;  2C9J A;  4DKM A;  4CFQ A;  1PK0 D;  2A53 B;  4HQC A;  4BDU A;  3JVT B;  3NSO A;  1NX0 A;  2LP3 A;  2WCE A;  1DF0 A;  1RMM A;  3BXK A;  1SBJ A;  4OQW A;  1XFU O;  3HX4 A;  3LS3 A;  2LLS A;  2EMN A;  2ZFD A;  1SR6 C;  1KCY A;  1GL4 A;  2PXW A;  2ZO6 A;  1KK8 B;  2DDD A;  2WHT A;  1A2X A;  4YGE B;  1AK8 A;  5FVG A;  1OMD A;  1J7P A;  1XO5 A;  1ZGQ A;  1KSM A;  2D8N A;  3M24 A;  1XK4 A;  2HQZ A;  1SKT A;  2O5G A;  5H89 A;  4DXN A;  4J89 A;  3ZWH A;  4ORA B;  2G6X A;  1Z1Q A;  3NXA A;  3I5G B;  3SIA A;  3CD9 A;  1B1G A;  2QLE A;  2QAC A;  4L9M A;  1B9C A;  1K9K A;  5DKQ A;  2A52 B;  4ORC B;  1FI6 A;  4JQ0 D;  4PE7 A;  3BUO B;  1A03 A;  2LM5 A;  3DQO A;  1EME A;  1OE9 B;  2HCG A;  1JC0 A;  4MRY A;  2B1U A;  2M3W A;  5LTQ A;  2AUC A;  2OGR A;  4RTC A;  1IRJ A;  1YX8 A;  3DQA A;  2IB5 A;  4YI8 A;  3CBE A;  2JNF A;  5K89 A;  3I5F B;  2A47 A;  1LKJ A;  5CSJ A;  4MBE A;  4W6M A;  1XVJ A;  4W6N A;  2VVH A;  3NSK A;  3M0W A;  4CLN A;  4P1Q A;  3ADF A;  1WLM A;  5DPG A;  3BOW B;  1EMM A;  3U8C A;  4OGS A;  4R1E A;  5EXU A;  2H5O A;  4DUQ A;  1CLB A;  3BXA A;  1TTX A;  1WDC C;  2K7B A;  5F6T A;  3EVV A;  2KNE A;  1JSA A;  2KBI A;  1UP5 A;  3PLF B;  4C0L A;  1L2O C;  1ZUZ A;  2CBL A;  5AER A;  1BR1 B;  5I2O A;  5DPH A;  1M39 A;  2JXL A;  4DRW A;  2OPO A;  2KFH A;  1MOU A;  1GQM A;  2H8Q A;  4W7E A;  1SCM C;  2E6W A;  3DQH A;  2AWJ A;  3A8S A;  2IOV A;  1A75 B;  1YHG A;  1MQ1 A;  2CXJ A;  1EJ3 A;  3DQ2 A;  3BYA A;  5EHU A;  1JC1 A;  1JWD A;  3A8R A;  1W7T A;  2BKI B;  2P6B B;  1REC A;  3DQM A;  2WHU A;  3SVN A;  1Q4E A;  1ZMZ A;  4PPJ A;  1Y1X A;  5LK4 A;  2KI6 C;  4HVF A;  3LK1 A;  1H4B A;  3LLE A;  2BE6 A;  3EK4 A;  3GJ2 A;  3SG7 A;  1FF1 A;  5I2L A;  1KK8 C;  4PPK A;  1EG4 A;  2MBX A;  1K2H A;  1HT9 A;  3OGO A;  1E8A A;  2WCF A;  3PAL A;  5JOL A;  2O29 A;  1NCX A;  2DUG A;  3ZUL A;  4KEX A;  4W6D A;  3JTD B;  4W6J A;  2L50 A;  2FZU A;  3DQ3 A;  1OXE A;  1L7Z A;  1QJT A;  3VRO A;  3EKH A;  3HCM A;  1B4C A;  5FHV A;  2F3Z A;  3I5G C;  4CPV A;  3EK8 A;  5HLV A;  4HRG A;  4ORN A;  1XA5 A;  3ED8 A;  1WY9 A;  1G7K A;  2EHB A;  4MVF A;  4YI9 A;  3GK1 A;  2VZX A;  2KFG A;  4USL A;  2JPT A;  1AUI B;  3PSR A;  1GJY A;  1N65 A;  5CPV A;  3DPW A;  1YVH A;  4W6G A;  4XJK A;  3SSP A;  5IBW A;  2L0P A;  2F3Y A;  2KQ6 A;  2JOJ A;  4GGF C;  1FW4 A;  3LF3 A;  1KSO A;  4MZJ A;  3I5F C;  1EMK A;  2Y0G A;  2AWL A;  5FYX A;  2WCB A;  5HZT A;  1BJF A;  5AAN A;  3LA1 A;  2K7O A;  2K8M B;  5H87 A;  3VRQ A;  3PN7 B;  1TNW A;  5B8I B;  2K7D A;  3G9A A;  2G3O A;  4W7F A;  3PJ5 A;  4GES B;  3LCP C;  4WRI A;  3SG2 A;  4LQT A;  2GW4 B;  2OKY A;  3U0N A;  1JBA A;  1K95 A;  1Y6W A;  4ICB A;  2MHH A;  4YGD B;  2MAZ A;  2GGM A;  2B3P A;  4W72 A;  2WSN A;  1EXR A;  2KDH A;  5AXI A;  1W7U A;  2AAO A;  4IK5 A;  3NF0 A;  5BT0 A;  1QAS A;  3DQC A;  1IKU A;  1R2U A;  4HSZ A;  2V53 A;  5I8N A;  1OMV A;  1B8C A;  4H3L A;  3ICB A;  3S05 A;  4U8D A;  2FCD A;  1G33 A;  5HW9 A;  1AJ5 A;  5DY6 A;  2PAL A;  2A4J A;  3BUW B;  4EDS A;  3IR8 A;  2ZND A;  3MSE B;  4KW4 A;  4ETO A;  1KFU L;  1MUX A;  1IGV A;  5J2O A;  4B30 A;  4PHJ A;  4C0J A;  4W7C A;  3VRN A;  3EVR A;  3CR4 X;  3EKJ A;  2LVI A;  1K8U A;  1DJI A;  2LMV A;  1B47 A;  2ISD A;  3VK1 A;  2A56 B;  3I19 A;  4ZFS A;  3JTD C;  1UUR A;  3CFA A;  2OTG B;  3CTN A;  1RMP A;  3NSL A;  1ALW A;  4DXQ A;  4P2Y B;  4JPZ B;  1WLZ A;  2AWM A;  2BE4 A;  4XYN A;  2O2B A;  1ZGP A;  1XMZ A;  4MSP A;  3NT9 A;  2OS8 B;  4XGY A;  4QJ5 B;  2PMY A;  4J8A A;  3SST A;  3FWC A;  3GB3 A;  3D0Y B;  4W6T A;  1PSR A;  4YGB B;  1NUB A;  3CR2 A;  1CLM A;  4A4B A;  1TCO B;  4RYS A;  1CB1 A;  1S6J A;  2JZI A;  5GQQ C;  4BY4 A;  2COL B;  5G08 A;  3BOW A;  3AKO A;  1RMO A;  1Y1U A;  4W6C A;  2L2E A;  1UUS A;  4L13 A;  2M97 A;  1VRK A;  3DQF A;  4KA9 A;  3DQD A;  2F2O A;  1RRX A;  3DPX A;  2K7C A;  4W6O A;  2OKW A;  1CFF A;  5DRG A;  2NZ0 A;  2NLN A;  3PN7 C;  1S6Z A;  2M7N A;  2Z1O A;  4W6U A;  2Y1N A;  4W75 A;  1NCY A;  1TNP A;  3NED A;  2DDC A;  4WQ3 A;  1QIW A;  1YUU A;  1B8L A;  3DVK A;  2ZRT A;  1EL4 A;  4DXI A;  1IQ5 A;  2EC6 B;  3WNX B;  3DPZ A;  1G8I A;  2LCP A;  2PAS A;  2JT0 A;  1NSH A;  1YHI A;  4JF9 A;  3U0K A;  2V4E B;  4MZL A;  1QYO A;  3DVM A;  3KCT A;  5EB6 A;  5HZS A;  1QTX A;  3SG6 A;  3SSL A;  1GGZ A;  1OZO A;  4N3D A;  1Q73 A;  3GK2 A;  4N1G A;  3VGO A;  1RK9 A;  2CT9 A;  1Q80 A;  1BFP A;  1J1E A;  3CGL A;  2QU1 A;  2BBM A;  4ZIO A;  1M31 A;  2KAX A;  1K93 D;  3DQ6 A;  5HKY A;  2JWW A;  3CS1 A;  1F71 A;  1BG1 A;  4KAG A;  2POX A;  3E3R A;  5FVI A;  2CCM A;  2JXC A;  2BL0 B;  1CFC A;  2FL1 A;  2OTG C;  2WHS A;  1SL7 A;  1TIZ A;  1KYS A;  1UHJ A;  1QV1 A;  4UPG A;  2CTN A;  1IWQ A;  1CLL A;  1RM9 A;  2JT3 A;  2BTJ A;  4M2O A;  4KPI A;  4H47 A;  1N2D A;  2Q91 A;  3KCS A;  3EVP A;  4LJB A;  4W6A A;  1S6C A;  3LF4 B;  3DVE A;  2G2S B;  3CFH A;  4GNK B;  3PFV A;  1JFK A;  1DJW A;  2VAE A;  4NDD A;  2QRF A;  3PM8 A;  2OS8 C;  2Q4U A;  2OTE A;  4OJ0 A;  2YDZ A;  3TUY B;  1NIW A;  1RJV A;  1R6P A;  3OB2 B;  4H3M A;  1XFV O;  1W7J B;  1CDN A;  2Y1M A;  1PUL A;  2KFF A;  1IQ3 A;  1NX1 A;  4HRH A;  2WIQ A;  1DJG A;  5AFP A;  1S1E A;  1QY3 A;  2ARL A;  2K2F A;  1V1F A;  5JJG A;  1OOJ A;  4P5O E;  4AQI A;  1RWY A;  1UWO A;  2KI6 D;  3FIA A;  5HZU A;  4HQ9 A;  4OCI A;  4W6H A;  3SVO A;  2DUI A;  4C0K A;  4DIR A;  2G16 B;  1MOV A;  5KTY A;  2H5P A;  1PVA A;  1Z1P A;  1QYQ A;  4GAO A;  1ZUX A;  3VRR A;  1F70 A;  4PHM A;  4PAL A;  3I5H B;  3W1D A;  1NYA A;  1M45 A;  1J55 A;  1CTR A;  1KQV A;  4D1E A;  5DTX A;  1Q4A A;  2LUX A;  1CDP A;  1DVI A;  1JC2 A;  4M2P A;  3LSA A;  5FVF A;  4GPL B;  2EC6 C;  4LW5 A;  4KF5 C;  1C4F A;  4MZK A;  1LXF C;  4ZCU A;  2M49 B;  4NDC A;  2JUL A;  1NP8 A;  1QVI Y;  3JVT C;  2NCP A;  3LK0 A;  2GGZ A;  1MWN A;  4XL5 A;  1CFP A;  4W6L A;  1KFX S;  4Q04 A;  2VRG A;  1ZFS A;  1XFX O;  3CB9 A;  4ZCV A;  1WRK A;  4OHS A;  3NT3 A;  4TZA A;  2FJU B;  3SG3 A;  4YBH B;  1PSB A;  1QX5 B;  2H61 C;  5CSI A;  2OTB A;  4OVN F;  1YRT B;  2K0J A;  4JFG A;  4EUL A;  1NCZ A;  4R6B A;  4PHN A;  1XQM A;  5DQM A;  4CFR A;  1QYF A;  5DKN A;  4W6I A;  2BCX A;  1F09 A;  3P8U A;  2Z6Z A;  3E5V A;  1KQM B;  2G2B A;  2ZO7 A;  3SVD A;  1NPQ A;  2Q57 A;  2BL0 C;  1HCJ A;  2DUH A;  2VVJ A;  2AH8 A;  3K21 A;  3D0Y A;  4PDZ A;  1S26 D;  2L5X B;  3WCK A;  3AI5 A;  1H4U A;  2EMD A;  4OV2 A;  3KPX A;  2QZ0 A;  2YE0 A;  3AKA A;  2BCA A;  1CKK A;  5BPJ A;  1MF8 B;  5HKZ A;  1J7Q A;  4HE4 A;  1W7S A;  3VIC A;  1KWO B;  3O78 A;  4NQG A;  3TUY C;  3U8P A;  4XOW A;  4GOB A;  4W6K A;  5DRF A;  4ZF4 A;  5ER5 A;  2MRD A;  2H5Q A;  1C7V A;  3AAK A;  5BTT B;  2KYF A;  1K90 D;  1Q4C A;  3ST3 A;  4GBA A;  1TRF A;  1BF5 A;  2Z6X A;  2A48 A;  1W7I B;  3QRX A;  2L4I A;  1F0B A;  5HGE A;  4MLW A;  3O6B A;  1BR4 B;  4KF4 A;  1TOP A;  2AWK A;  5DTL A;  3EVU A;  1OXD A;  3DQ8 A;  2G9B A;  4KF5 A;  1QXP A;  3SSH A;  3I5H C;  2ZRS A;  5CSN A;  4YRU A;  3BX9 A;  1DGV A;  5KTG A;  1K96 A;  1RRO A;  4UTS A;  3SVU A;  3OP0 A;  1S6I A;  4W76 A;  2HQK A;  2EGD A;  2I94 A;  4MN0 A;  4HQ8 A;  5KSZ A;  1QLS A;  3DQ5 A;  1JF0 A;  1SPY A;  4XOV A;  1SMG A;  4L12 A;  1FPW A;  5DKR A;  2M8U A;  1IJ6 A;  4RYW A;  2H61 A;  1CNP A;  4ORB B;  4QJ3 B;  3GEX A;  4H48 A;  4Q7U A;  2Y4Q A;  1PRW A;  1F54 A;  1QX2 A;  5BQL A;  3IQQ A;  2QLG B;  3C1V A;  3CWG A;  4IK8 A;  1K94 A;  2JTT A;  3CGA A;  2L4H A;  1ZAC A;  2FCE A; 
#chains in the Genus database with same CATH topology
 1BMO A;  3NSI A;  1J1D A;  1AVS A;  1QWV A;  3SIB A;  2QLH A;  1M63 B;  5EXB A;  2O60 A;  3CAB A;  1YFP A;  3H1R A;  3M22 A;  2M1K B;  1UIS A;  4INX A;  2G5Z B;  4YGC B;  3SVS A;  1C07 A;  3RM1 A;  2JAD A;  4NWS A;  1KQM C;  1SYM A;  3PJB A;  1YRU B;  1DGU A;  2KSP A;  3V3D A;  2AHA A;  5DTZ A;  1CDL A;  3EK7 A;  2WIS A;  3IP2 A;  1XSS A;  2B3Q A;  1YHH A;  4JD9 A;  2KHN A;  3UG0 A;  2LMT A;  1TCF A;  3BXB A;  1GM0 A;  5I2Q A;  4GGF A;  3DQJ A;  3SVB A;  4DXO A;  2I18 A;  4E68 A;  4IZN A;  2I7A A;  2PRU A;  2P4M A;  1RFJ A;  3QME A;  1LA0 A;  2PQL A;  3LVA A;  2HFC A;  3VRP A;  1XFY O;  5AEQ A;  1EMF A;  1GFL A;  1SY9 A;  4FQO A;  4Z4K A;  2BCB A;  1M46 A;  5EB7 A;  1KWO C;  1ZOT B;  2M7L A;  2WUR A;  2G6Y A;  3CZT X;  3NEZ A;  4PE0 A;  2LAP A;  2DOQ A;  2Q6P A;  2VAD A;  2LC5 A;  3SSY A;  3OX6 A;  4MRX A;  3BUM B;  3WLC A;  1BLQ A;  1WRZ A;  2NCO A;  2KGR A;  5AQB B;  3TMT A;  2SCP A;  1B7T Y;  2QDI A;  3IF7 A;  3UFZ A;  2VVI A;  2LLU A;  4N5X A;  1KP5 A;  1DJX A;  4JGE A;  1SRA A;  2F33 A;  1V1G A;  4GUK A;  1C7W A;  3WHT B;  2F2P A;  1YX7 A;  2R2I A;  3H1O A;  2K60 A;  3TDZ A;  1YTZ C;  4DKN A;  1QVI Z;  2LVK A;  3SG4 A;  5CSF A;  4MEW A;  5KU1 A;  5HLO A;  3S0D A;  1A75 A;  2RGI A;  4QJ4 B;  1PVB A;  4AR7 A;  2LUC A;  5DTY A;  2ZMW A;  2BBN A;  1OOI X;  3O4X A;  2JQ6 A;  3MGF A;  4LJD C;  3WHU B;  4W6P A;  1CM4 A;  2JTZ A;  4W69 A;  1DEK A;  3DF0 B;  4EDO A;  1EMG A;  4PPL A;  1P28 A;  2HPW A;  4R6D A;  3CZ2 A;  4IK1 A;  3F45 A;  3ZUJ A;  2QEO A;  1N0Y A;  4W6F A;  3O2P A;  2JRF A;  3O77 A;  1S5G Z;  2KBM A;  1MR8 A;  2LHL A;  4GFT A;  4TNC A;  4OKH A;  1GGX A;  3A4U B;  2O24 A;  1QXT A;  1TUZ A;  1QIV A;  4W74 A;  3Q8I A;  3TS5 B;  3LVC A;  3RLZ A;  4GF6 B;  3KEV A;  2H9W A;  1UHN A;  2IE2 A;  3ST2 A;  1GGW A;  4EMQ A;  4PCW A;  4B5Y A;  3SVC A;  4DS7 A;  2KAV A;  3ZNI A;  1UHI A;  2ZKM X;  1KFX L;  3FS7 A;  2H5R A;  3I5I B;  4IL1 A;  4OR9 B;  1ODB A;  3LVD A;  3PIB A;  1OQP A;  1F4O A;  2LLT A;  3GOF A;  3DXL A;  2SAS A;  3O4Y A;  3LL8 B;  4B30 B;  1LS8 A;  2FJY A;  1MYW A;  2PXS A;  1H8B A;  1A29 A;  2A54 B;  5DPI A;  4ZF5 A;  3TZ1 A;  2KYC A;  2AMI A;  3SS5 A;  3PAT A;  4U2V A;  1JBZ A;  4EN1 A;  1DJH A;  5D3O A;  4W73 A;  1PAL A;  4Q9W A;  5BTT A;  1LVC D;  1KK7 Y;  1YVL A;  1OMR A;  3OSR A;  1ALV A;  1CMG A;  3DD4 A;  3CLN A;  4H3N A;  3ZTF A;  1JUO A;  2G6E A;  3S0A A;  1EML A;  2QT2 A;  3SVE A;  2DUE A;  3AKB A;  3SVR A;  1IH0 A;  1JFJ A;  2JPO A;  2LHI A;  2M0R A;  1Y0V H;  1YUT A;  1OXF A;  3ST0 A;  1B9A A;  2HPS A;  1EMC A;  3DQ9 A;  4JEO A;  1CMF A;  1FI5 A;  2BKH B;  1W9Z A;  1MHO A;  3EG5 B;  4KGF A;  2WC8 A;  2HJO A;  3FWB A;  4LJD A;  1G4Y R;  3P28 A;  2ZN8 A;  3ZUF A;  4JRB A;  4ZB1 A;  1K9P A;  2H6V A;  2LMU A;  2LV7 A;  2GX2 A;  4BY5 A;  1U5I B;  3BXC A;  3GJ1 A;  3DVJ A;  3SJS A;  2KOT A;  2HRS A;  2BEC A;  4AS8 A;  1SW8 A;  2L98 A;  4AOM A;  2KAY A;  3RZS A;  3IQO A;  4L1I A;  2QLG A;  2TN4 A;  4CID A;  4IK3 A;  2V4E C;  1NX3 A;  4OY4 A;  2C9I A;  4A4C A;  2IS9 A;  2HF5 A;  1UHH A;  4DXM A;  4W7D A;  3OB1 B;  2I2R E;  1KYR A;  3U0M A;  1TNQ A;  3RWT A;  3B6X A;  3TDI A;  3SRY A;  1J7O A;  3VHT B;  4W7A A;  2LVV A;  1C3Y A;  2JC2 A;  5PAL A;  3S0E A;  2BNX A;  3TS5 C;  4JWQ A;  4I2Y A;  4W6R A;  1DJY A;  2WND A;  1WRL A;  1EMA A;  4IK9 A;  3OBV A;  4I5N B;  1XFW O;  4WQ2 A;  1ZGO A;  5EJU A;  4I5J A;  2YGU A;  4XVP A;  1IJ5 A;  1QX7 A;  1AHR A;  1S5G Y;  2FOT A;  1DF0 B;  4IK4 A;  2YE1 A;  1YJF A;  1EG3 A;  3DQU A;  3DQ7 A;  3KF9 A;  3ST4 A;  2KI4 B;  5DPJ A;  1NX2 A;  5DQB A;  3DQ1 A;  3DY9 A;  2NXQ A;  1TNX A;  1LA3 A;  3I5I C;  2HGD A;  5EBJ A;  2HET A;  1FBV A;  1MXL C;  1SL8 A;  2LVJ A;  2A46 A;  2JNX A;  3WXA A;  4DXP A;  5LTR A;  2MLE C;  1Q4D A;  2LP2 A;  3KHE A;  3H4S E;  1EH2 A;  1XA9 A;  4J88 A;  1LIN A;  5HZO A;  1B7T Z;  4I5K A;  3E5W A;  1UHK A;  3CR5 X;  3OSQ A;  1J7R A;  1OOH A;  1S3P A;  2PYQ A;  5ER4 X;  3D10 A;  2HQ8 A;  4ZBL A;  1OZS A;  1YR5 A;  2HQW A;  3PJI A;  5EXC I;  1QLK A;  3CFF A;  1MXE A;  2KQY A;  4YGA A;  3OHM B;  5D7F A;  4Q9X A;  4TZG A;  1EMB A;  1XAE A;  1OSA A;  2WCK A;  3WLD A;  3DQK A;  2PVB A;  3CD1 A;  2EMO A;  2DUF A;  1HUY A;  3R1V A;  2PSR A;  2JT8 A;  2QLI A;  4HRE E;  2CNP A;  1QAT A;  2Y5I A;  2MJW B;  3KO0 A;  2Z6Y A;  1KYP A;  3R1O A;  4PHK A;  3PJ7 A;  2M29 A;  3TMR A;  1CM1 A;  3SG5 A;  4Q7T A;  3DF0 A;  3SS0 A;  4PT1 A;  1YUR A;  2M1U A;  3CYZ A;  4PE1 A;  5D69 A;  4PFE A;  2V4E A;  5F9G A;  4M2Q A;  4Z4M A;  3B87 A;  3U8A A;  1BT6 A;  3BQ3 A;  4W6S A;  4JC2 A;  3E5T A;  1RTP 1;  4F0Z B;  1QV0 A;  4ZIN A;  1K9U A;  5T3I A;  3SSK A;  1A4P A;  3SV5 A;  5HBD A;  3TDU A;  1CFD A;  2KLE A;  3BUX B;  2ZNE A;  1SCV A;  2OJK A;  3SSV A;  4F7F A;  1F8H A;  1DJZ A;  2E30 A;  2L2C A;  1DT7 B;  2RH7 A;  2LAN A;  2K61 A;  3OX5 A;  4KGE A;  2ZMU A;  2KGB C;  2WOR A;  2A50 B;  1SR6 B;  1BOC A;  2H2K A;  4LJC A;  1Q4B A;  2WOS A;  2LE9 B;  2L51 A;  1JF2 A;  2MA2 A;  3K1K A;  2KPH A;  2LNK A;  2F8P A;  4W6B A;  2ZN9 A;  3RWA A;  1IG5 A;  1XFZ O;  2KI4 C;  3DQI A;  5FI6 A;  1KK7 Z;  4DCK A;  5H88 A;  1BU3 A;  1SL9 A;  3GL4 A;  1HQV A;  4W7X A;  5TNC A;  5HYD A;  1F55 A;  2JU0 A;  2M9G A;  2DD7 A;  3W1C A;  1XK4 C;  3AI4 A;  3GK4 X;  4KYN A;  3AAJ A;  2ICR A;  1TUJ A;  1DTL A;  1SNL A;  2GX0 A;  3SS3 A;  1BOD A;  1F4Q A;  4AQJ A;  1TWO A;  3DQE A;  3U0L A;  1X02 A;  4PE4 A;  2WSO A;  4ZF3 A;  4N1F A;  3BUN B;  1TN4 A;  1YZW A;  1YJ2 A;  1B8R A;  1SK6 D;  1D1O A;  1Y1A A;  4GGN A;  4NDB A;  2DD9 A;  2GW3 A;  2G3D B;  1AJ4 A;  2GV5 A;  2K2A A;  3DQL A;  2QPT A;  4Q7R A;  3S0G A;  1AP4 A;  3DQN A;  4XJK B;  2YFP A;  4KW8 A;  1U5I A;  4W77 A;  2IB6 A;  1QS7 A;  5J3X A;  3B86 A;  4LQU A;  4ANJ A;  5DU0 A;  1WDC B;  1C3Z A;  2HGY A;  4W7R A;  2FWQ A;  1DMO A;  1JBY A;  4I5L B;  1L2O B;  4KW9 A;  3CDN A;  3VB1 A;  4P76 A;  1H6R A;  1CDM A;  4FTG A;  2MLF C;  1KFU S;  3DQ4 A;  5HKW A;  1XYD A;  1SCM B;  1S36 A;  1CV7 A;  3VHT A;  5LTP A;  1NWD A;  1YUS A;  2C9J A;  4DKM A;  4CFQ A;  1PK0 D;  2A53 B;  4HQC A;  4BDU A;  3JVT B;  3NSO A;  1NX0 A;  2LP3 A;  2WCE A;  1DF0 A;  1RMM A;  3BXK A;  1SBJ A;  3CZ1 A;  4OQW A;  1XFU O;  3HX4 A;  3LS3 A;  2LLS A;  2EMN A;  2ZFD A;  1SR6 C;  1KCY A;  1GL4 A;  2PXW A;  2ZO6 A;  1KK8 B;  2DDD A;  2WHT A;  1A2X A;  4YGE B;  1AK8 A;  5FVG A;  1OMD A;  4INW A;  1J7P A;  1XO5 A;  1ZGQ A;  1KSM A;  2D8N A;  3M24 A;  1XK4 A;  5FI7 A;  2HQZ A;  1SKT A;  2O5G A;  5H89 A;  4DXN A;  4J89 A;  3ZWH A;  4ORA B;  2G6X A;  1Z1Q A;  3NXA A;  3I5G B;  3S0B A;  3SIA A;  3CD9 A;  1B1G A;  2QLE A;  2QAC A;  4L9M A;  1B9C A;  1K9K A;  5DKQ A;  2A52 B;  4ORC B;  1FI6 A;  4JQ0 D;  4PE7 A;  3BUO B;  1A03 A;  2LM5 A;  3DQO A;  1EME A;  1OE9 B;  2HCG A;  1JC0 A;  4MRY A;  2B1U A;  2M3W A;  3R72 A;  5LTQ A;  3FE9 A;  2AUC A;  2QEH A;  2OGR A;  4RTC A;  1IRJ A;  1YX8 A;  3DQA A;  2IB5 A;  4YI8 A;  3NGV A;  3CBE A;  2JNF A;  5K89 A;  3I5F B;  2A47 A;  4IJ7 A;  2BAP A;  1LKJ A;  5CSJ A;  4MBE A;  4W6M A;  1XVJ A;  4W6N A;  2VVH A;  3NSK A;  3M0W A;  2WCH A;  4CLN A;  4P1Q A;  3BFB A;  1WLM A;  3ADF A;  5DPG A;  3UO9 A;  3BOW B;  1EMM A;  3U8C A;  4OGS A;  4R1E A;  5EXU A;  2H5O A;  4DUQ A;  1CLB A;  3BXA A;  1TTX A;  1WDC C;  2K7B A;  5F6T A;  3EVV A;  2KNE A;  1JSA A;  2KBI A;  1UP5 A;  3PLF B;  4C0L A;  1L2O C;  1ZUZ A;  2CBL A;  5AER A;  1BR1 B;  5I2O A;  5DPH A;  1M39 A;  2JXL A;  4DRW A;  2OPO A;  2KFH A;  1MOU A;  1GQM A;  2H8Q A;  4W7E A;  1OOG A;  1SCM C;  2E6W A;  3DQH A;  2AWJ A;  3A8S A;  2IOV A;  1A75 B;  1YHG A;  1MQ1 A;  2CXJ A;  1EJ3 A;  3DQ2 A;  3BYA A;  5EHU A;  3NHT A;  1JC1 A;  1JWD A;  2P70 A;  3A8R A;  1W7T A;  2BKI B;  2P6B B;  1REC A;  3DQM A;  2WHU A;  3SVN A;  1Q4E A;  3D74 A;  1ZMZ A;  4PPJ A;  1Y1X A;  5LK4 A;  2KI6 C;  4HVF A;  3LK1 A;  1H4B A;  3LLE A;  2BE6 A;  3EK4 A;  3GJ2 A;  3SG7 A;  1FF1 A;  5I2L A;  1KK8 C;  4PPK A;  1EG4 A;  2MBX A;  1K2H A;  1HT9 A;  3OGO A;  1E8A A;  2WCF A;  3PAL A;  5JOL A;  3BJH A;  3D77 A;  2O29 A;  3D73 A;  1DEL A;  1NCX A;  2DUG A;  3ZUL A;  4KEX A;  4W6D A;  3JTD B;  4W6J A;  2L50 A;  2FZU A;  3DQ3 A;  1OXE A;  3NHI A;  1L7Z A;  1QJT A;  3VRO A;  3EKH A;  3HCM A;  3DZT A;  1B4C A;  2H8V A;  5FHV A;  2F3Z A;  3I5G C;  4CPV A;  3BFA A;  3EK8 A;  5HLV A;  4HRG A;  4ORN A;  1XA5 A;  3ED8 A;  5EL2 A;  1WY9 A;  1G7K A;  2ERB A;  2EHB A;  4OZD A;  5DIC A;  4MVF A;  4YI9 A;  3GK1 A;  2VZX A;  2KFG A;  4USL A;  2JPT A;  1AUI B;  3PSR A;  1GJY A;  1N65 A;  3DYE A;  5CPV A;  3DPW A;  1YVH A;  4W6G A;  4XJK A;  3SSP A;  5IBW A;  2L0P A;  2F3Y A;  2KQ6 A;  2JOJ A;  4GGF C;  1FW4 A;  3LF3 A;  1KSO A;  4MZJ A;  3I5F C;  1EMK A;  3SS4 A;  3D78 A;  2Y0G A;  2AWL A;  5FYX A;  2WCB A;  5HZT A;  1BJF A;  5AAN A;  3LA1 A;  2K7O A;  2K8M B;  5H87 A;  3VRQ A;  3PN7 B;  1TNW A;  5B8I B;  2K7D A;  3G9A A;  2G3O A;  4W7F A;  3PJ5 A;  4GES B;  3LCP C;  4WRI A;  3SG2 A;  4LQT A;  2GW4 B;  2OKY A;  3U0N A;  1JBA A;  1K95 A;  1Y6W A;  4ICB A;  2MHH A;  4YGD B;  2MAZ A;  2GGM A;  2B3P A;  4W72 A;  2KLD A;  2WSN A;  3PM2 A;  1EXR A;  2KDH A;  5AXI A;  1W7U A;  2QEB A;  2AAO A;  4IK5 A;  3NF0 A;  5BT0 A;  1QAS A;  3DQC A;  1IKU A;  1R2U A;  4HSZ A;  2V53 A;  5I8N A;  1OMV A;  3V2L A;  1B8C A;  4H3L A;  3ICB A;  3S05 A;  4U8D A;  2FCD A;  1G33 A;  2WCM A;  5HW9 A;  1AJ5 A;  5DY6 A;  2PAL A;  2A4J A;  3BUW B;  4EDS A;  3IR8 A;  2ZND A;  3MSE B;  4KW4 A;  4ETO A;  1KFU L;  1MUX A;  1IGV A;  5J2O A;  4B30 A;  4PHJ A;  4C0J A;  4W7C A;  3VRN A;  3EVR A;  3CR4 X;  1OW4 A;  3EKJ A;  2LVI A;  1K8U A;  1DJI A;  2LMV A;  1B47 A;  2ISD A;  3VK1 A;  2A56 B;  3I19 A;  1IIO A;  2L5Y A;  4ZFS A;  3JTD C;  1UUR A;  3CFA A;  2OTG B;  3CTN A;  1RMP A;  3NSL A;  1ALW A;  4DXQ A;  4P2Y B;  4JPZ B;  1XFR A;  1WLZ A;  2AWM A;  2BE4 A;  4XYN A;  2O2B A;  1ZGP A;  1XMZ A;  4MSP A;  3NT9 A;  2OS8 B;  3S0F A;  4XGY A;  4QJ5 B;  2PMY A;  4J8A A;  3SST A;  3FWC A;  3GB3 A;  3CZ0 A;  3D0Y B;  4W6T A;  1PSR A;  4YGB B;  2GTE A;  1NUB A;  3CR2 A;  1CLM A;  4A4B A;  1TCO B;  4RYS A;  1CB1 A;  1S6J A;  2JZI A;  5GQQ C;  4BY4 A;  2COL B;  5G08 A;  3BOW A;  3AKO A;  1RMO A;  1Y1U A;  4W6C A;  2L2E A;  3FE6 A;  1UUS A;  1SSE B;  4L13 A;  2M97 A;  1VRK A;  3DQF A;  4KA9 A;  3DQD A;  2F2O A;  1RRX A;  3DPX A;  2K7C A;  4W6O A;  2OKW A;  1CFF A;  5DRG A;  2NZ0 A;  2NLN A;  3PN7 C;  1S6Z A;  2M7N A;  2Z1O A;  4W6U A;  2Y1N A;  4W75 A;  1NCY A;  1TNP A;  3NED A;  2DDC A;  4WQ3 A;  1QIW A;  1YUU A;  1B8L A;  3DVK A;  2ZRT A;  1EL4 A;  4DXI A;  1IQ5 A;  2EC6 B;  3WNX B;  3DPZ A;  1G8I A;  2LCP A;  2PAS A;  2JT0 A;  1NSH A;  1YHI A;  4JF9 A;  3U0K A;  2V4E B;  4MZL A;  1QYO A;  3DVM A;  3KCT A;  5EB6 A;  5HZS A;  1QTX A;  3SG6 A;  3SSL A;  1GGZ A;  1OZO A;  4N3D A;  1Z2C B;  1Q73 A;  1ORG A;  3GK2 A;  4N1G A;  3VGO A;  1RK9 A;  2CT9 A;  1Q80 A;  1BFP A;  1J1E A;  3CGL A;  2QU1 A;  3R1P A;  2BBM A;  4ZIO A;  1M31 A;  2KAX A;  1K93 D;  3DQ6 A;  5HKY A;  2JWW A;  3CS1 A;  1F71 A;  1BG1 A;  4KAG A;  2POX A;  3E3R A;  5FVI A;  2CCM A;  2JXC A;  2BL0 B;  1CFC A;  2FL1 A;  2OTG C;  2WHS A;  1SL7 A;  1TIZ A;  1KYS A;  1UHJ A;  1QV1 A;  4UPG A;  2CTN A;  1IWQ A;  1CLL A;  1RM9 A;  2JT3 A;  2BTJ A;  4M2O A;  4KPI A;  4H47 A;  1N2D A;  2Q91 A;  3KCS A;  3EVP A;  4LJB A;  4W6A A;  1S6C A;  3LF4 B;  3DVE A;  2G2S B;  3CFH A;  4GNK B;  3PFV A;  1JFK A;  1DJW A;  2VAE A;  4NDD A;  2QRF A;  3PM8 A;  2OS8 C;  2Q4U A;  1Z4H A;  2OTE A;  4OJ0 A;  2YDZ A;  3TUY B;  1NIW A;  3FE8 A;  1RJV A;  1R6P A;  3OB2 B;  4H3M A;  1XFV O;  1W7J B;  1CDN A;  2Y1M A;  1PUL A;  2KFF A;  1IQ3 A;  1NX1 A;  3OGN A;  4HRH A;  2WIQ A;  1DJG A;  5AFP A;  1S1E A;  1QY3 A;  2ARL A;  2K2F A;  1V1F A;  5JJG A;  2WCL A;  1OOJ A;  4P5O E;  4AQI A;  3D75 A;  1RWY A;  1UWO A;  2KI6 D;  3FIA A;  5HZU A;  4HQ9 A;  4OCI A;  4W6H A;  3SVO A;  2DUI A;  4C0K A;  4DIR A;  2G16 B;  1MOV A;  5KTY A;  2H5P A;  1PVA A;  1Z1P A;  1QYQ A;  4GAO A;  1ZUX A;  3VRR A;  1F70 A;  4PHM A;  4PAL A;  3I5H B;  3W1D A;  1NYA A;  1DQE A;  1M45 A;  1J55 A;  2WC6 A;  1CTR A;  1KQV A;  5HL1 A;  4D1E A;  5DTX A;  1Q4A A;  2LUX A;  1CDP A;  1DVI A;  5I94 A;  1JC2 A;  4M2P A;  3LSA A;  5FVF A;  3L4L A;  4GPL B;  2EC6 C;  4LW5 A;  4KF5 C;  1C4F A;  4MZK A;  1LXF C;  4ZCU A;  2M49 B;  3D76 A;  4NDC A;  2JUL A;  4FQT A;  1NP8 A;  1QVI Y;  3JVT C;  2NCP A;  3LK0 A;  2GGZ A;  1MWN A;  4XL5 A;  1CFP A;  4W6L A;  1KFX S;  4Q04 A;  2VRG A;  1ZFS A;  1XFX O;  3CB9 A;  4ZCV A;  1WRK A;  4OHS A;  3NT3 A;  3K1E A;  4TZA A;  2FJU B;  3SG3 A;  4YBH B;  1PSB A;  1QX5 B;  2H61 C;  5CSI A;  2OTB A;  4OVN F;  1YRT B;  2K0J A;  4JFG A;  4EUL A;  1NCZ A;  4R6B A;  4PHN A;  1XQM A;  5DQM A;  4CFR A;  1QYF A;  5DKN A;  4W6I A;  2BCX A;  1F09 A;  3P8U A;  2Z6Z A;  3E5V A;  1KQM B;  2G2B A;  2ZO7 A;  3SVD A;  1NPQ A;  2Q57 A;  2BL0 C;  1HCJ A;  2DUH A;  2VVJ A;  2AH8 A;  3K21 A;  3L4A A;  3D0Y A;  4PDZ A;  1S26 D;  1T14 A;  2L5X B;  3WCK A;  3AI5 A;  1H4U A;  2EMD A;  4OV2 A;  3KPX A;  4JKT A;  2QZ0 A;  2YE0 A;  3AKA A;  2BCA A;  2WC5 A;  1CKK A;  5BPJ A;  3B7A A;  2P71 A;  1MF8 B;  5HKZ A;  1J7Q A;  3L47 A;  4HE4 A;  1W7S A;  3VIC A;  1KWO B;  3O78 A;  1OOF A;  4NQG A;  3TUY C;  3U8P A;  4XOW A;  4GOB A;  4W6K A;  5DRF A;  4ZF4 A;  5ER5 A;  2MRD A;  2H5Q A;  3B88 A;  1C7V A;  3AAK A;  3IVT A;  3BFH A;  5BTT B;  2KYF A;  1K90 D;  1Q4C A;  2QEV A;  3ST3 A;  4GBA A;  1TRF A;  1BF5 A;  2Z6X A;  2A48 A;  3N7H A;  1W7I B;  3QRX A;  2L4I A;  1F0B A;  5HGE A;  4MLW A;  3O6B A;  1BR4 B;  4KF4 A;  1TOP A;  2AWK A;  5DTL A;  3EVU A;  1OXD A;  3DQ8 A;  2G9B A;  4KF5 A;  1QXP A;  3SSH A;  3I5H C;  2ZRS A;  5CSN A;  4YRU A;  3BX9 A;  1DGV A;  5KTG A;  1K96 A;  1RRO A;  4UTS A;  3SVU A;  3OP0 A;  1S6I A;  4W76 A;  2HQK A;  2EGD A;  2I94 A;  4MN0 A;  4HQ8 A;  5KSZ A;  2WCJ A;  1QLS A;  3DQ5 A;  1JF0 A;  1SPY A;  4XOV A;  3UNW A;  1SMG A;  4L12 A;  1FPW A;  5DKR A;  2M8U A;  1IJ6 A;  4RYW A;  2H61 A;  1CNP A;  4ORB B;  4QJ3 B;  3GEX A;  4H48 A;  4Q7U A;  2Y4Q A;  1PRW A;  1F54 A;  1QX2 A;  5BQL A;  3IQQ A;  2QLG B;  3C1V A;  1DC1 A;  3CWG A;  4IK8 A;  1K94 A;  2JTT A;  5FI2 A;  3CGA A;  2L4H A;  1ZAC A;  2FCE A; 
#chains in the Genus database with same CATH homology
 1BMO A;  3NSI A;  1J1D A;  1AVS A;  3SIB A;  2QLH A;  1M63 B;  5EXB A;  2O60 A;  1YFP A;  3H1R A;  3M22 A;  2M1K B;  1UIS A;  2G5Z B;  4YGC B;  3SVS A;  1C07 A;  3RM1 A;  2JAD A;  4NWS A;  1KQM C;  1SYM A;  3PJB A;  1YRU B;  1DGU A;  2KSP A;  3V3D A;  2AHA A;  5DTZ A;  1CDL A;  3EK7 A;  2WIS A;  3IP2 A;  1XSS A;  2B3Q A;  1YHH A;  2KHN A;  3UG0 A;  2LMT A;  1TCF A;  3BXB A;  5I2Q A;  4GGF A;  3DQJ A;  3SVB A;  4DXO A;  2I18 A;  4E68 A;  4IZN A;  2I7A A;  2PRU A;  2P4M A;  1RFJ A;  1LA0 A;  3LVA A;  2HFC A;  3VRP A;  1XFY O;  5AEQ A;  1EMF A;  1GFL A;  1SY9 A;  4FQO A;  4Z4K A;  2BCB A;  1M46 A;  5EB7 A;  1KWO C;  1ZOT B;  2M7L A;  2WUR A;  2G6Y A;  3CZT X;  3NEZ A;  4PE0 A;  2LAP A;  2DOQ A;  2Q6P A;  2VAD A;  2LC5 A;  3SSY A;  3OX6 A;  4MRX A;  3BUM B;  3WLC A;  1BLQ A;  1WRZ A;  2NCO A;  2KGR A;  5AQB B;  3TMT A;  2SCP A;  1B7T Y;  3IF7 A;  3UFZ A;  2VVI A;  2LLU A;  4N5X A;  1KP5 A;  1DJX A;  4JGE A;  1SRA A;  2F33 A;  1V1G A;  4GUK A;  1C7W A;  3WHT B;  2F2P A;  1YX7 A;  2R2I A;  3H1O A;  3TDZ A;  1YTZ C;  4DKN A;  1QVI Z;  2LVK A;  3SG4 A;  5CSF A;  4MEW A;  5KU1 A;  5HLO A;  1A75 A;  2RGI A;  4QJ4 B;  1PVB A;  4AR7 A;  2LUC A;  5DTY A;  2ZMW A;  2BBN A;  2JQ6 A;  3MGF A;  4LJD C;  3WHU B;  4W6P A;  1CM4 A;  2JTZ A;  4W69 A;  3DF0 B;  4EDO A;  1EMG A;  4PPL A;  2HPW A;  4R6D A;  4IK1 A;  3F45 A;  3ZUJ A;  1N0Y A;  4W6F A;  3O2P A;  2JRF A;  3O77 A;  1S5G Z;  2KBM A;  1MR8 A;  2LHL A;  4GFT A;  4TNC A;  4OKH A;  1GGX A;  3A4U B;  2O24 A;  1QXT A;  1QIV A;  4W74 A;  3TS5 B;  3LVC A;  3RLZ A;  4GF6 B;  3KEV A;  2H9W A;  1UHN A;  2IE2 A;  3ST2 A;  1GGW A;  4EMQ A;  4PCW A;  4B5Y A;  3SVC A;  4DS7 A;  2KAV A;  3ZNI A;  1UHI A;  2ZKM X;  1KFX L;  3FS7 A;  2H5R A;  3I5I B;  4IL1 A;  4OR9 B;  1ODB A;  3LVD A;  3PIB A;  1OQP A;  1F4O A;  2LLT A;  3GOF A;  2SAS A;  3O4Y A;  3LL8 B;  4B30 B;  1MYW A;  2PXS A;  1H8B A;  1A29 A;  2A54 B;  5DPI A;  4ZF5 A;  3TZ1 A;  2KYC A;  2AMI A;  3PAT A;  4U2V A;  1JBZ A;  4EN1 A;  1DJH A;  4W73 A;  1PAL A;  4Q9W A;  5BTT A;  1LVC D;  1KK7 Y;  1YVL A;  1OMR A;  3OSR A;  1ALV A;  1CMG A;  3DD4 A;  3CLN A;  4H3N A;  3ZTF A;  1JUO A;  2G6E A;  1EML A;  2QT2 A;  3SVE A;  2DUE A;  3AKB A;  3SVR A;  1IH0 A;  1JFJ A;  2LHI A;  2M0R A;  1Y0V H;  1YUT A;  1OXF A;  3ST0 A;  1B9A A;  2HPS A;  1EMC A;  3DQ9 A;  4JEO A;  1CMF A;  1FI5 A;  2BKH B;  1MHO A;  4KGF A;  2WC8 A;  2HJO A;  3FWB A;  4LJD A;  1G4Y R;  3P28 A;  2ZN8 A;  3ZUF A;  4JRB A;  4ZB1 A;  1K9P A;  2H6V A;  2LMU A;  2LV7 A;  2GX2 A;  4BY5 A;  1U5I B;  3BXC A;  3GJ1 A;  3DVJ A;  3SJS A;  2KOT A;  2HRS A;  2BEC A;  4AS8 A;  1SW8 A;  2L98 A;  4AOM A;  2KAY A;  3IQO A;  4L1I A;  2QLG A;  2TN4 A;  4CID A;  4IK3 A;  2V4E C;  1NX3 A;  4OY4 A;  2C9I A;  4A4C A;  2IS9 A;  2HF5 A;  1UHH A;  4DXM A;  4W7D A;  3OB1 B;  2I2R E;  1KYR A;  3U0M A;  1TNQ A;  3RWT A;  3TDI A;  3SRY A;  1J7O A;  3VHT B;  4W7A A;  2LVV A;  2JC2 A;  5PAL A;  3TS5 C;  4JWQ A;  4I2Y A;  4W6R A;  1DJY A;  2WND A;  1WRL A;  1EMA A;  4IK9 A;  4I5N B;  1XFW O;  4WQ2 A;  1ZGO A;  5EJU A;  4I5J A;  4XVP A;  1IJ5 A;  1QX7 A;  1AHR A;  1S5G Y;  2FOT A;  1DF0 B;  4IK4 A;  2YE1 A;  1YJF A;  1EG3 A;  3DQU A;  3DQ7 A;  3KF9 A;  3ST4 A;  2KI4 B;  5DPJ A;  1NX2 A;  5DQB A;  3DQ1 A;  2NXQ A;  1TNX A;  1LA3 A;  3I5I C;  2HGD A;  5EBJ A;  2HET A;  1FBV A;  1MXL C;  1SL8 A;  2LVJ A;  2A46 A;  2JNX A;  3WXA A;  4DXP A;  5LTR A;  2MLE C;  1Q4D A;  2LP2 A;  3KHE A;  3H4S E;  1EH2 A;  1XA9 A;  4J88 A;  1LIN A;  5HZO A;  1B7T Z;  4I5K A;  3E5W A;  1UHK A;  3CR5 X;  3OSQ A;  1J7R A;  1S3P A;  5ER4 X;  3D10 A;  2HQ8 A;  4ZBL A;  1OZS A;  1YR5 A;  2HQW A;  5EXC I;  1QLK A;  3CFF A;  1MXE A;  2KQY A;  4YGA A;  3OHM B;  5D7F A;  4Q9X A;  4TZG A;  1EMB A;  1XAE A;  1OSA A;  3WLD A;  3DQK A;  2PVB A;  3CD1 A;  2EMO A;  2DUF A;  1HUY A;  2PSR A;  2JT8 A;  2QLI A;  4HRE E;  2CNP A;  1QAT A;  2Y5I A;  2MJW B;  3KO0 A;  2Z6Y A;  1KYP A;  4PHK A;  3PJ7 A;  2M29 A;  3TMR A;  1CM1 A;  3SG5 A;  4Q7T A;  3DF0 A;  3SS0 A;  1YUR A;  2M1U A;  4PE1 A;  5D69 A;  4PFE A;  2V4E A;  5F9G A;  4M2Q A;  4Z4M A;  3U8A A;  1BT6 A;  3BQ3 A;  4W6S A;  4JC2 A;  3E5T A;  1RTP 1;  4F0Z B;  1QV0 A;  4ZIN A;  1K9U A;  5T3I A;  3SSK A;  1A4P A;  3SV5 A;  5HBD A;  3TDU A;  1CFD A;  3BUX B;  2ZNE A;  1SCV A;  2OJK A;  3SSV A;  1F8H A;  1DJZ A;  2E30 A;  1DT7 B;  2RH7 A;  2LAN A;  2K61 A;  3OX5 A;  4KGE A;  2ZMU A;  2KGB C;  2WOR A;  2A50 B;  1SR6 B;  1BOC A;  2H2K A;  4LJC A;  1Q4B A;  2WOS A;  2LE9 B;  2L51 A;  1JF2 A;  2MA2 A;  3K1K A;  2LNK A;  2F8P A;  4W6B A;  2ZN9 A;  3RWA A;  1IG5 A;  1XFZ O;  2KI4 C;  3DQI A;  1KK7 Z;  4DCK A;  5H88 A;  1BU3 A;  1SL9 A;  3GL4 A;  1HQV A;  4W7X A;  5TNC A;  5HYD A;  1F55 A;  2JU0 A;  2M9G A;  2DD7 A;  3W1C A;  1XK4 C;  3AI4 A;  3GK4 X;  3AAJ A;  2ICR A;  1DTL A;  1SNL A;  2GX0 A;  1BOD A;  1F4Q A;  4AQJ A;  3DQE A;  3U0L A;  1X02 A;  4PE4 A;  2WSO A;  4ZF3 A;  4N1F A;  3BUN B;  1TN4 A;  1YZW A;  1YJ2 A;  1B8R A;  1SK6 D;  1D1O A;  1Y1A A;  4GGN A;  4NDB A;  2DD9 A;  2GW3 A;  2G3D B;  1AJ4 A;  2GV5 A;  2K2A A;  3DQL A;  2QPT A;  4Q7R A;  1AP4 A;  3DQN A;  4XJK B;  2YFP A;  4KW8 A;  1U5I A;  4W77 A;  2IB6 A;  1QS7 A;  5J3X A;  4LQU A;  4ANJ A;  5DU0 A;  1WDC B;  2HGY A;  4W7R A;  2FWQ A;  1DMO A;  1JBY A;  4I5L B;  1L2O B;  4KW9 A;  4P76 A;  1H6R A;  1CDM A;  4FTG A;  2MLF C;  1KFU S;  3DQ4 A;  5HKW A;  1XYD A;  1SCM B;  1S36 A;  1CV7 A;  3VHT A;  5LTP A;  1NWD A;  1YUS A;  2C9J A;  4DKM A;  4CFQ A;  1PK0 D;  2A53 B;  4HQC A;  4BDU A;  3JVT B;  3NSO A;  1NX0 A;  2LP3 A;  2WCE A;  1DF0 A;  1RMM A;  3BXK A;  1SBJ A;  4OQW A;  1XFU O;  3HX4 A;  3LS3 A;  2LLS A;  2EMN A;  2ZFD A;  1SR6 C;  1KCY A;  1GL4 A;  2PXW A;  2ZO6 A;  1KK8 B;  2DDD A;  2WHT A;  1A2X A;  4YGE B;  1AK8 A;  5FVG A;  1OMD A;  1J7P A;  1XO5 A;  1ZGQ A;  1KSM A;  2D8N A;  3M24 A;  1XK4 A;  2HQZ A;  1SKT A;  2O5G A;  5H89 A;  4DXN A;  4J89 A;  3ZWH A;  4ORA B;  2G6X A;  1Z1Q A;  3NXA A;  3I5G B;  3SIA A;  3CD9 A;  1B1G A;  2QLE A;  2QAC A;  4L9M A;  1B9C A;  1K9K A;  5DKQ A;  2A52 B;  4ORC B;  1FI6 A;  4JQ0 D;  4PE7 A;  3BUO B;  1A03 A;  2LM5 A;  3DQO A;  1EME A;  1OE9 B;  2HCG A;  1JC0 A;  4MRY A;  2B1U A;  2M3W A;  5LTQ A;  2AUC A;  2OGR A;  4RTC A;  1IRJ A;  1YX8 A;  3DQA A;  2IB5 A;  4YI8 A;  3CBE A;  2JNF A;  5K89 A;  3I5F B;  2A47 A;  1LKJ A;  5CSJ A;  4MBE A;  4W6M A;  1XVJ A;  4W6N A;  2VVH A;  3NSK A;  3M0W A;  4CLN A;  4P1Q A;  3ADF A;  1WLM A;  5DPG A;  3BOW B;  1EMM A;  3U8C A;  4OGS A;  4R1E A;  5EXU A;  2H5O A;  4DUQ A;  1CLB A;  3BXA A;  1TTX A;  1WDC C;  2K7B A;  5F6T A;  3EVV A;  2KNE A;  1JSA A;  2KBI A;  1UP5 A;  3PLF B;  4C0L A;  1L2O C;  1ZUZ A;  2CBL A;  5AER A;  1BR1 B;  5I2O A;  5DPH A;  1M39 A;  2JXL A;  4DRW A;  2OPO A;  2KFH A;  1MOU A;  1GQM A;  2H8Q A;  4W7E A;  1SCM C;  2E6W A;  3DQH A;  2AWJ A;  3A8S A;  2IOV A;  1A75 B;  1YHG A;  1MQ1 A;  2CXJ A;  1EJ3 A;  3DQ2 A;  3BYA A;  5EHU A;  1JC1 A;  1JWD A;  3A8R A;  1W7T A;  2BKI B;  2P6B B;  1REC A;  3DQM A;  2WHU A;  3SVN A;  1Q4E A;  1ZMZ A;  4PPJ A;  1Y1X A;  5LK4 A;  2KI6 C;  4HVF A;  3LK1 A;  1H4B A;  3LLE A;  2BE6 A;  3EK4 A;  3GJ2 A;  3SG7 A;  1FF1 A;  5I2L A;  1KK8 C;  4PPK A;  1EG4 A;  2MBX A;  1K2H A;  1HT9 A;  3OGO A;  1E8A A;  2WCF A;  3PAL A;  5JOL A;  2O29 A;  1NCX A;  2DUG A;  3ZUL A;  4KEX A;  4W6D A;  3JTD B;  4W6J A;  2L50 A;  2FZU A;  3DQ3 A;  1OXE A;  1L7Z A;  1QJT A;  3VRO A;  3EKH A;  3HCM A;  1B4C A;  5FHV A;  2F3Z A;  3I5G C;  4CPV A;  3EK8 A;  5HLV A;  4HRG A;  4ORN A;  1XA5 A;  3ED8 A;  1WY9 A;  1G7K A;  2EHB A;  4MVF A;  4YI9 A;  3GK1 A;  2VZX A;  2KFG A;  4USL A;  2JPT A;  1AUI B;  3PSR A;  1GJY A;  1N65 A;  5CPV A;  3DPW A;  1YVH A;  4W6G A;  4XJK A;  3SSP A;  5IBW A;  2L0P A;  2F3Y A;  2KQ6 A;  2JOJ A;  4GGF C;  1FW4 A;  3LF3 A;  1KSO A;  4MZJ A;  3I5F C;  1EMK A;  2Y0G A;  2AWL A;  5FYX A;  2WCB A;  5HZT A;  1BJF A;  5AAN A;  3LA1 A;  2K7O A;  2K8M B;  5H87 A;  3VRQ A;  3PN7 B;  1TNW A;  5B8I B;  2K7D A;  3G9A A;  2G3O A;  4W7F A;  3PJ5 A;  4GES B;  3LCP C;  4WRI A;  3SG2 A;  4LQT A;  2GW4 B;  2OKY A;  3U0N A;  1JBA A;  1K95 A;  1Y6W A;  4ICB A;  2MHH A;  4YGD B;  2MAZ A;  2GGM A;  2B3P A;  4W72 A;  2WSN A;  1EXR A;  2KDH A;  5AXI A;  1W7U A;  2AAO A;  4IK5 A;  3NF0 A;  5BT0 A;  1QAS A;  3DQC A;  1IKU A;  1R2U A;  4HSZ A;  2V53 A;  5I8N A;  1OMV A;  1B8C A;  4H3L A;  3ICB A;  3S05 A;  4U8D A;  2FCD A;  1G33 A;  5HW9 A;  1AJ5 A;  5DY6 A;  2PAL A;  2A4J A;  3BUW B;  4EDS A;  3IR8 A;  2ZND A;  3MSE B;  4KW4 A;  4ETO A;  1KFU L;  1MUX A;  1IGV A;  5J2O A;  4B30 A;  4PHJ A;  4C0J A;  4W7C A;  3VRN A;  3EVR A;  3CR4 X;  3EKJ A;  2LVI A;  1K8U A;  1DJI A;  2LMV A;  1B47 A;  2ISD A;  3VK1 A;  2A56 B;  3I19 A;  4ZFS A;  3JTD C;  1UUR A;  3CFA A;  2OTG B;  3CTN A;  1RMP A;  3NSL A;  1ALW A;  4DXQ A;  4P2Y B;  4JPZ B;  1WLZ A;  2AWM A;  2BE4 A;  4XYN A;  2O2B A;  1ZGP A;  1XMZ A;  4MSP A;  3NT9 A;  2OS8 B;  4XGY A;  4QJ5 B;  2PMY A;  4J8A A;  3SST A;  3FWC A;  3GB3 A;  3D0Y B;  4W6T A;  1PSR A;  4YGB B;  1NUB A;  3CR2 A;  1CLM A;  4A4B A;  1TCO B;  4RYS A;  1CB1 A;  1S6J A;  2JZI A;  5GQQ C;  4BY4 A;  2COL B;  5G08 A;  3BOW A;  3AKO A;  1RMO A;  1Y1U A;  4W6C A;  2L2E A;  1UUS A;  4L13 A;  2M97 A;  1VRK A;  3DQF A;  4KA9 A;  3DQD A;  2F2O A;  1RRX A;  3DPX A;  2K7C A;  4W6O A;  2OKW A;  1CFF A;  5DRG A;  2NZ0 A;  2NLN A;  3PN7 C;  1S6Z A;  2M7N A;  2Z1O A;  4W6U A;  2Y1N A;  4W75 A;  1NCY A;  1TNP A;  3NED A;  2DDC A;  4WQ3 A;  1QIW A;  1YUU A;  1B8L A;  3DVK A;  2ZRT A;  1EL4 A;  4DXI A;  1IQ5 A;  2EC6 B;  3WNX B;  3DPZ A;  1G8I A;  2LCP A;  2PAS A;  2JT0 A;  1NSH A;  1YHI A;  4JF9 A;  3U0K A;  2V4E B;  4MZL A;  1QYO A;  3DVM A;  3KCT A;  5EB6 A;  5HZS A;  1QTX A;  3SG6 A;  3SSL A;  1GGZ A;  1OZO A;  4N3D A;  1Q73 A;  3GK2 A;  4N1G A;  3VGO A;  1RK9 A;  2CT9 A;  1Q80 A;  1BFP A;  1J1E A;  3CGL A;  2QU1 A;  2BBM A;  4ZIO A;  1M31 A;  2KAX A;  1K93 D;  3DQ6 A;  5HKY A;  2JWW A;  3CS1 A;  1F71 A;  1BG1 A;  4KAG A;  2POX A;  3E3R A;  5FVI A;  2CCM A;  2JXC A;  2BL0 B;  1CFC A;  2FL1 A;  2OTG C;  2WHS A;  1SL7 A;  1TIZ A;  1KYS A;  1UHJ A;  1QV1 A;  4UPG A;  2CTN A;  1IWQ A;  1CLL A;  1RM9 A;  2JT3 A;  2BTJ A;  4M2O A;  4KPI A;  4H47 A;  1N2D A;  2Q91 A;  3KCS A;  3EVP A;  4LJB A;  4W6A A;  1S6C A;  3LF4 B;  3DVE A;  2G2S B;  3CFH A;  4GNK B;  3PFV A;  1JFK A;  1DJW A;  2VAE A;  4NDD A;  2QRF A;  3PM8 A;  2OS8 C;  2Q4U A;  2OTE A;  4OJ0 A;  2YDZ A;  3TUY B;  1NIW A;  1RJV A;  1R6P A;  3OB2 B;  4H3M A;  1XFV O;  1W7J B;  1CDN A;  2Y1M A;  1PUL A;  2KFF A;  1IQ3 A;  1NX1 A;  4HRH A;  2WIQ A;  1DJG A;  5AFP A;  1S1E A;  1QY3 A;  2ARL A;  2K2F A;  1V1F A;  5JJG A;  1OOJ A;  4P5O E;  4AQI A;  1RWY A;  1UWO A;  2KI6 D;  3FIA A;  5HZU A;  4HQ9 A;  4OCI A;  4W6H A;  3SVO A;  2DUI A;  4C0K A;  4DIR A;  2G16 B;  1MOV A;  5KTY A;  2H5P A;  1PVA A;  1Z1P A;  1QYQ A;  4GAO A;  1ZUX A;  3VRR A;  1F70 A;  4PHM A;  4PAL A;  3I5H B;  3W1D A;  1NYA A;  1M45 A;  1J55 A;  1CTR A;  1KQV A;  4D1E A;  5DTX A;  1Q4A A;  2LUX A;  1CDP A;  1DVI A;  1JC2 A;  4M2P A;  3LSA A;  5FVF A;  4GPL B;  2EC6 C;  4LW5 A;  4KF5 C;  1C4F A;  4MZK A;  1LXF C;  4ZCU A;  2M49 B;  4NDC A;  2JUL A;  1NP8 A;  1QVI Y;  3JVT C;  2NCP A;  3LK0 A;  2GGZ A;  1MWN A;  4XL5 A;  1CFP A;  4W6L A;  1KFX S;  4Q04 A;  2VRG A;  1ZFS A;  1XFX O;  3CB9 A;  4ZCV A;  1WRK A;  4OHS A;  3NT3 A;  4TZA A;  2FJU B;  3SG3 A;  4YBH B;  1PSB A;  1QX5 B;  2H61 C;  5CSI A;  2OTB A;  4OVN F;  1YRT B;  2K0J A;  4JFG A;  4EUL A;  1NCZ A;  4R6B A;  4PHN A;  1XQM A;  5DQM A;  4CFR A;  1QYF A;  5DKN A;  4W6I A;  2BCX A;  1F09 A;  3P8U A;  2Z6Z A;  3E5V A;  1KQM B;  2G2B A;  2ZO7 A;  3SVD A;  1NPQ A;  2Q57 A;  2BL0 C;  1HCJ A;  2DUH A;  2VVJ A;  2AH8 A;  3K21 A;  3D0Y A;  4PDZ A;  1S26 D;  2L5X B;  3WCK A;  3AI5 A;  1H4U A;  2EMD A;  4OV2 A;  3KPX A;  2QZ0 A;  2YE0 A;  3AKA A;  2BCA A;  1CKK A;  5BPJ A;  1MF8 B;  5HKZ A;  1J7Q A;  4HE4 A;  1W7S A;  3VIC A;  1KWO B;  3O78 A;  4NQG A;  3TUY C;  3U8P A;  4XOW A;  4GOB A;  4W6K A;  5DRF A;  4ZF4 A;  5ER5 A;  2MRD A;  2H5Q A;  1C7V A;  3AAK A;  5BTT B;  2KYF A;  1K90 D;  1Q4C A;  3ST3 A;  4GBA A;  1TRF A;  1BF5 A;  2Z6X A;  2A48 A;  1W7I B;  3QRX A;  2L4I A;  1F0B A;  5HGE A;  4MLW A;  3O6B A;  1BR4 B;  4KF4 A;  1TOP A;  2AWK A;  5DTL A;  3EVU A;  1OXD A;  3DQ8 A;  2G9B A;  4KF5 A;  1QXP A;  3SSH A;  3I5H C;  2ZRS A;  5CSN A;  4YRU A;  3BX9 A;  1DGV A;  5KTG A;  1K96 A;  1RRO A;  4UTS A;  3SVU A;  3OP0 A;  1S6I A;  4W76 A;  2HQK A;  2EGD A;  2I94 A;  4MN0 A;  4HQ8 A;  5KSZ A;  1QLS A;  3DQ5 A;  1JF0 A;  1SPY A;  4XOV A;  1SMG A;  4L12 A;  1FPW A;  5DKR A;  2M8U A;  1IJ6 A;  4RYW A;  2H61 A;  1CNP A;  4ORB B;  4QJ3 B;  3GEX A;  4H48 A;  4Q7U A;  2Y4Q A;  1PRW A;  1F54 A;  1QX2 A;  5BQL A;  3IQQ A;  2QLG B;  3C1V A;  3CWG A;  4IK8 A;  1K94 A;  2JTT A;  3CGA A;  2L4H A;  1ZAC A;  2FCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...