3SG2A

Crystal structure of gcamp2-t116v,d381y
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
409
structure length
394
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKYTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 142
structure length 394
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg2A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg2A02
3SVUA 2KHNA 1VRKA 1PK0D 4KPIA 4W76A 1M63B 3SVNA 4ZF4A 4AQIA 3WLDA 1OXEA 1F8HA 2HF5A 4HSZA 1WLZA 3I5GC 1OXFA 4ICBA 1NWDA 1OMDA 4DRWA 1JFJA 3M22A 1Q4EA 1KK7Z 2GW3A 4KGFA 3G9AA 4Q9XA 1N0YA 1CFFA 2O60A 3I5IC 4ETOA 2Q4UA 1DGUA 4RYWA 3CZTX 3DPZA 1SCVA 2LANA 1S26D 2M29A 2G6EA 1A4PA 4YBHB 2SASA 1UP5A 1M46A 4PE4A 2WCEA 1M39A 2LHIA 2M7NA 3GK4X 2LLTA 3FWCA 3OX6A 4NQGA 1J1DA 2VVJA 1A75B 1A29A 3CTNA 1NUBA 4W7XA 2SCPA 1TTXA 2IOVA 5AEQA 3ZNIA 4W6MA 3M24A 1F0BA 3P8UA 2JTZA 3IQOA 2KFHA 3GK2A 3DQAA 5DRGA 4L13A 3PSRA 2YE0A 2KGBC 4Z4KA 1IGVA 1KK7Y 5H89A 4R6BA 1K93D 4EDOA 3GJ2A 4W6UA 4YRUA 5DTZA 1J7RA 4ZCUA 4MN0A 4AOMA 3BUNB 4GFTA 3NSLA 4R6DA 2KYFA 1SY9A 2FL1A 2Z6XA 2JWWA 1DJYA 3OSRA 4IK4A 4U2VA 1F70A 1YFPA 2IS9A 1KWOB 2WSOA 2FWQA 4YGCB 4W6SA 1C07A 1QIWA 4XVPA 2WHUA 4HREE 2Q57A 5DQMA 3O4YA 3DVKA 4ZINA 2VRGA 2WOSA 2KI6C 1MHOA 2KGRA 4W69A 3LVCA 3FIAA 4LQUA 1J7QA 3NF0A 3JTDB 5IBWA 2MJWB 2HFCA 2LP2A 4C0LA 1BLQA 1QIVA 5AFPA 1C7WA 3HCMA 4KW4A 1BR1B 1KQMB 2DUFA 3ZULA 1Z1PA 3O2PA 2HJOA 2WISA 4W6LA 1CLLA 3DF0B 1PRWA 2V4EC 3CFHA 4MRYA 1SMGA 3DD4A 3BUWB 1EMMA 3RWAA 1UHHA 4L9MA 3BYAA 1BMOA 2CTNA 2L4IA 1QYFA 1OSAA 2LLSA 3SSHA 5HLVA 1QATA 1ZFSA 4PHJA 1ZOTB 3I19A 2Z6YA 1UHIA 2GX0A 1S6IA 2QU1A 5DPIA 1SK6D 1XK4C 4LW5A 2F2PA 2VAEA 2VADA 4P5OE 1J1EA 1K8UA 1D1OA 4KW8A 2ZKMX 3SVEA 4CLNA 1U5IA 1KSOA 5DKRA 2PXSA 1U5IB 1KP5A 1M45A 3DQ6A 4L1IA 3PJ5A 1JF0A 2WSNA 3SIAA 3VRPA 1JF2A 3DQMA 3VGOA 1RK9A 4TNCA 1UURA 1J7PA 2OPOA 5T3IA 3V3DA 2K2AA 3E3RA 1CDPA 2A56B 4N1FA 3VROA 2G16B 1GFLA 4YGAA 4W7AA 3W1CA 1AUIB 1KWOC 3CB9A 4HQ9A 2WORA 1S6CA 4Q7RA 2OS8B 3H1OA 5DRFA 4DKNA 3U0NA 1RJVA 1DJXA 1OZSA 3UFZA 3P28A 4W6IA 3SSLA 4XL5A 4Q04A 3WXAA 3A4UB 1EMBA 1KFUL 4A4CA 3KHEA 1ODBA 1XFYO 4PHMA 2WCBA 2A46A 3CFFA 1NSHA 3PFVA 1CDLA 2HCGA 5FVGA 1MWNA 5BT0A 3DQLA 5I2OA 1CKKA 2K2FA 4XOVA 4W6FA 3GOFA 2JNFA 1TIZA 1J55A 2DUIA 2DUEA 2R2IA 2KQYA 1QX2A 1TNWA 5HKYA 1QXTA 1B8CA 1NYAA 4QJ5B 4W77A 2M1KB 1DGVA 2QLIA 4W6PA 1MUXA 4TZAA 1SYMA 3NSOA 2EC6B 1SR6C 3DQCA 3RWTA 1F09A 4B30A 4CFQA 4B30B 1IQ3A 4NDDA 1YHHA 1AJ5A 3BUOB 3CS1A 4OVNF 1W7UA 2LCPA 1FF1A 4C0JA 1CB1A 3LF4B 2AH8A 3I5GB 4JQ0D 1BFPA 1QS7A 4M2PA 4A4BA 1XAEA 2PALA 3I5IB 1XA9A 3A8SA 1B47A 1LA3A 4W6HA 1H4UA 3DQHA 1SL8A 5KSZA 4AR7A 3K1KA 2Z1OA 3PALA 1GJYA 5J2OA 2O2BA 4IL1A 3W1DA 1S6ZA 5HZUA 3DQKA 3HX4A 3SRYA 2OS8C 2E30A 2O29A 1JWDA 1S1EA 2K61A 1F54A 2M3WA 1XMZA 4HQCA 5PALA 2HPWA 2WHTA 1B4CA 3O78A 4GBAA 1SL7A 1ZGOA 3SSKA 2JTTA 3DQ5A 3RLZA 2KAVA 3A8RA 1N2DA 3D10A 1K2HA 2DD9A 4NDBA 4IK3A 3SVBA 3SVCA 4BY4A 4JEOA 2RH7A 1Q4AA 4WQ2A 4H3MA 4Q7UA 1WRZA 3BQ3A 1Y0VH 3RM1A 3GJ1A 5AQBB 2L2EA 2H61A 1MYWA 5JOLA 2H9WA 4MZKA 4KEXA 3PJ7A 2OKWA 3IF7A 1RTP1 3DQEA 1SBJA 2JADA 3ST0A 3NSKA 4DXQA 3SV5A 4CIDA 2L51A 1XSSA 2EC6C 4QJ4B 4KGEA 1TOPA 2G5ZB 4MEWA 2KI4C 2PASA 4PPKA 4CPVA 3AKBA 3BUMB 2K7DA 1SW8A 3SJSA 4DCKA 1RWYA 4MZLA 4W6JA 3TUYB 2KQ6A 2I7AA 4I2YA 2GV5A 1QX5B 1KFXS 3DQJA 5CSJA 1QJTA 2MLFC 2ZN8A 3ZUFA 5HBDA 1NCXA 1XYDA 2YE1A 3BXAA 1LXFC 1EG4A 2L4HA 3UG0A 5FHVA 2HQKA 2P6BB 1RECA 1DJGA 1KYSA 1RMPA 2PRUA 2V4EA 3DPXA 2BECA 2JC2A 2V4EB 2TN4A 2JULA 1CNPA 4W7DA 2ZFDA 1EMFA 2KAYA 3ADFA 2NCPA 5TNCA 1JFKA 2HQWA 2NZ0A 3TS5C 2POXA 3DQNA 3KCTA 1S6JA 1YVHA 1XVJA 2JXCA 3CBEA 5FVFA 1JC2A 4PPJA 2A4JA 4ZBLA 2QLGA 4CFRA 1FPWA 4QJ3B 2QLGB 1YR5A 2BBMA 3DQOA 1XK4A 1TNPA 2A52B 1W7IB 2AMIA 2CT9A 2M97A 3M0WA 1OMVA 2D8NA 4I5JA 3KCSA 4J89A 4H3LA 1YTZC 2M49B 1G7KA 5HW9A 1EMCA 2BKIB 1SRAA 3BX9A 4RYSA 4YI8A 4W7CA 4KW9A 2WNDA 3SVDA 1MQ1A 1LINA 5HKWA 4PPLA 2H61C 3EK7A 2COLB 1M31A 5K89A 5I8NA 3EKHA 1GGZA 1G4YR 5CSFA 1NCZA 3DQFA 1AVSA 4GUKA 2B1UA 1KYRA 1K9KA 4Q7TA 1DVIA 4KF5C 5HZSA 5JJGA 4OCIA 4B5YA 5AXIA 5EHUA 3ZWHA 3I5HC 1QVIZ 4HRGA 3DQ7A 4I5NB 3DQ9A 5EB7A 5EXBA 2LC5A 2BE4A 1KYPA 3TUYC 5F6TA 1QYOA 2L98A 1ZUZA 1NX0A 1YHIA 5DU0A 5LTPA 4IK5A 1UHNA 2BTJA 3CD1A 4MSPA 4OJ0A 2HQZA 2B3QA 4W6BA 2ZO6A 1L2OC 3GB3A 2O5GA 3BXKA 2L0PA 1GGXA 1R6PA 1NX1A 3SVRA 4GGFC 1HT9A 3K21A 1ZMZA 1CTRA 1DJZA 2BCBA 4W6CA 1YX8A 2VZXA 4P76A 3LCPC 1BOCA 4W6RA 1NP8A 3TDIA 2ZMWA 4JPZB 4MVFA 2LVJA 3SVOA 1SR6B 2QRFA 2JOJA 3LK1A 3U8CA 2FCEA 1XFVO 5D69A 3KEVA 1SPYA 2K8MB 5DY6A 1CV7A 2LVIA 4W6AA 2MHHA 5HZTA 1QVIY 2BKHB 1YJFA 3AAJA 1EMKA 1ZGQA 1IWQA 3LLEA 5FVIA 2G2BA 1WLMA 3FWBA 3VRRA 2DOQA 4XJKA 4I5KA 4PE0A 5KTYA 4W7EA 1RMOA 1Y1UA 5J3XA 1XO5A 1PVBA 1YRTB 4AQJA 1JC1A 3CR2A 1Q4DA 4GESB 1X02A 1RMMA 1QX7A 1QLSA 3GK1A 2MLEC 1XFXO 3TDZA 2DUGA 4YGDB 3O77A 2KBMA 1IRJA 1ZGPA 4MLWA 1PSBA 1TNXA 4OGSA 1F4QA 2PSRA 2L5XB 1HCJA 1BJFA 1FI6A 3DVMA 3AI5A 4EDSA 3SG4A 1UHJA 3AKOA 3PM8A 2ZNEA 2CNPA 2ZRSA 4W7RA 1H4BA 2DD7A 2MBXA 2MAZA 3ZUJA 4GNKB 3BOWA 5BTTA 3ED8A 3BOWB 4DIRA 5BTTB 5B8IB 3VHTA 3VHTB 1DJWA 1MF8B 1YURA 3EVVA 1QV1A 2Q91A 3CWGA 2QZ0A 1KFXL 4W6OA 3SG5A 1Q4BA 1RROA 1K9PA 2KYCA 1IH0A 4OHSA 3EVRA 2V53A 3U8PA 1W7TA 4M2OA 2HETA 2F3ZA 5CSIA 4NWSA 3SG6A 4ZIOA 2A50B 5DPJA 2FOTA 4HRHA 3AI4A 1Y1AA 1XFZO 1CFPA 2P4MA 4IK8A 3SSVA 1QLKA 4LJDC 4LJCA 2KI4B 1A2XA 1YX7A 1BU3A 2VVIA 1QTXA 3DQ2A 3OGOA 2K7CA 4DS7A 3CGAA 3OSQA 4MBEA 4ZCVA 1W7JB 3BUXB 2L50A 2IB6A 4GAOA 4J88A 4USLA 2EHBA 1UISA 3DQ3A 4GOBA 5LK4A 3QRXA 2IE2A 2BL0B 4W6NA 2NXQA 3NEDA 3VICA 4E68A 3WHUB 2M0RA 2DUHA 2LUCA 2YFPA 1KCYA 4ZF3A 2KBIA 2AWKA 3KO0A 1F71A 1F4OA 1CMFA 2HRSA 2AUCA 4DXOA 1YUTA 3IQQA 1KK8C 1SCMB 5AANA 5EJUA 3PN7B 2H5PA 3EKJA 3DPWA 2KOTA 3WNXB 2F33A 2O24A 1OE9B 4UPGA 2JU0A 2BCAA 2JT0A 1XQMA 3TS5B 3EK4A 1EH2A 4DXIA 4PCWA 1FW4A 5EBJA 4PHKA 3KF9A 5I2QA 3PATA 1DMOA 3TZ1A 2ARLA 1JBYA 4JF9A 3IP2A 1Y6WA 5HGEA 1BF5A 2EMOA 4J8AA 4YGBB 4BDUA 3DQ4A 3TDUA 2FZUA 1EMEA 3EVPA 2H5QA 1S36A 3NEZA 5GQQC 3DQ1A 1YVLA 4JFGA 3SG7A 5EXUA 5HZOA 2AWMA 2Y4QA 1EG3A 4KA9A 3LK0A 5KU1A 1QXPA 5HYDA 2A48A 4N5XA 3EVUA 2IB5A 4W72A 2NCOA 2M8UA 3DQUA 1K90D 4GF6B 4KF5A 5DTLA 1H8BA 1B8RA 2ISDA 2ZMUA 3D0YA 1XFWO 3I5HB 2OTBA 3TMRA 2KFFA 2MA2A 4ZFSA 2JT8A 5DTYA 1AK8A 4YI9A 3E5VA 3CLNA 1IG5A 3GL4A 4DXMA 2Y1MA 1WY9A 2LM5A 2BL0C 3LS3A 1AHRA 1L2OB 4EMQA 1A03A 3F45A 2BBNA 4W6GA 4ZF5A 1KFUS 2OTGB 1EJ3A 1PALA 4RTCA 4W74A 3I5FC 4OY4A 2EMNA 1WRLA 4DXPA 4GGFA 1SCMC 2JNXA 1L7ZA 3PN7C 4DXNA 1UWOA 3DQDA 3WCKA 4LJBA 2WHSA 2M7LA 2C9IA 1JBAA 4KAGA 1FBVA 2JT3A 1Q4CA 1UUSA 2PVBA 1XFUO 2K7OA 1A75A 4FTGA 1BG1A 1Q80A 4R1EA 4P2YB 1OOJA 2G3DB 4JWQA 2KFGA 4PHNA 4W6TA 2C9JA 2HGDA 5ER4X 2Q6PA 2GGZA 2F3YA 1YRUB 5H88A 1CLBA 1K94A 4I5LB 4HQ8A 2LVKA 1NPQA 1NX2A 2KAXA 2JRFA 2Y5IA 1W7SA 2JXLA 3MSEB 1YUSA 3WHTB 2CCMA 2LMUA 1QY3A 5AERA 2A53B 3CR4X 4M2QA 4IK9A 1GL4A 1KSMA 4W75A 1CM4A 4H3NA 3SG2A 4OR9B 5HLOA 2H6VA 2H5OA 3SSTA 2Y0GA 3MGFA 2YDZA 1PULA 1PVAA 1R2UA 1WRKA 4ORNA 4PALA 2I18A 1NIWA 1DF0A 1MOVA 1LKJA 1DF0B 2K0JA 1Z1QA 1N65A 4WRIA 1K95A 1E8AA 4XYNA 5G08A 4ORCB 2GGMA 3VRQA 1MXLC 3CR5X 2RGIA 1EMLA 1RM9A 3OHMB 2VVHA 2M1UA 2NLNA 2CBLA 2M9GA 3LSAA 2BE6A 2LHLA 4EULA 2Z6ZA 2E6WA 4C0KA 2OTGC 2F8PA 5CSNA 1QASA 2KNEA 2LUXA 3CFAA 1BR4B 4MRXA 1K96A 2G9BA 3PLFB 1Q73A 1QYQA 4IZNA 2QLEA 4JRBA 3DF0A 3AKAA 5ER5A 3LF3A 1WDCB 4LJDA 1ZUXA 2FJUB 2QACA 1SKTA 1EL4A 3VRNA 3OB1B 4JGEA 1RRXA 1IJ6A 3KPXA 4OQWA 1CM1A 1TCOB 1CLMA 3SS0A 4IK1A 2JZIA 2H2KA 2WCFA 2BCXA 3DVJA 2ZRTA 3JVTB 2A47A 2ZO7A 1JUOA 2HQ8A 1GGWA 2H5RA 3SVSA 2F2OA 3IR8A 4U8DA 4XJKB 1HUYA 5DTXA 1NX3A 5EXCI 2I94A 3ICBA 1YJ2A 1G33A 4WQ3A 2LVVA 5DQBA 3E5WA 3NXAA 4ORAB 1KK8B 4PFEA 4Z4MA 1OZOA 2LAPA 3LVDA 3ZTFA 1TRFA 5EB6A 2OKYA 4ORBB 1TNQA 2QT2A 1OQPA 3SIBA 5BQLA 4N3DA 2LMTA 5HKZA 2A54B 4EN1A 4GGNA 2G2SB 2EMDA 4W6KA 1F55A 3TMTA 2LLUA 3EK8A 1ZACA 4OKHA 4N1GA 4W6DA 2QPTA 3FS7A 4NDCA 3DQ8A 5DPHA 3U8AA 3VK1A 5CPVA 1C4FA 1RFJA 1MR8A 2ICRA 1BODA 5LTQA 3CGLA 1TCFA 1AP4A 1JBZA 3S05A 1CFCA 1KQVA 1IQ5A 2AWLA 1G8IA 1CDNA 5I2LA 3JTDC 2DDDA 1B7TZ 2I2RE 2H8QA 4AS8A 3NT3A 2WURA 4YGEB 4PE1A 3BXCA 3GEXA 2EGDA 3AAKA 1KQMC 4W73A 3LA1A 4DKMA 2KSPA 4Q9WA 2PXWA 1WDCC 1SNLA 4MZJA 1QV0A 1OXDA 1YHGA 1FI5A 1B9AA 4GPLB 1CMGA 2G6YA 3WLCA 1EMAA 2ZN9A 2DDCA 1UHKA 2OGRA 1IKUA 5LTRA 4H47A 1S5GZ 3JVTC 1XA5A 2G6XA 1J7OA 2LE9B 4OV2A 3ST2A 5FYXA 1DTLA 5DKNA 1YZWA 4ANJA 2LNKA 3SSYA 2JQ6A 2Y1NA 5KTGA 4PE7A 1MOUA 1SL9A 1JC0A 3OP0A 2AAOA 3U0MA 3DQIA 2ZNDA 4HVFA 3I5FB 1B7TY 2LMVA 4L12A 1DT7B 2OTEA 4F0ZB 3U0LA 3LL8B 1HQVA 4W7FA 1ALWA 3SG3A 1DJHA 2FCDA 1CFDA 3DVEA 3ST3A 1B8LA 5DKQA 1EMGA 4H48A 2OJKA 1K9UA 3CD9A 1OMRA 3OX5A 1LA0A 5F9GA 5DPGA 3OB2B 2WIQA 4ZB1A 3NT9A 1ALVA 1S5GY 1Y1XA 1V1FA 2GW4B 4TZGA 4KF4A 3BXBA 2HGYA 4XGYA 1CDMA 4D1EA 2LP3A 4JC2A 4P1QA 1H6RA 2QLHA 1C7VA 4UTSA 3H1RA 1S3PA 3NSIA 2AHAA 1GQMA 1IJ5A 2HPSA 4FQOA 3C1VA 2G3OA 3SSPA 2PMYA 1EXRA 1MXEA 3PJBA 4XOWA 2AWJA 1TN4A 2KDHA 3U0KA 2GX2A 4BY5A 3PIBA 2LV7A 2JPTA 4LQTA 2WC8A 4HE4A 3H4SE 1YUUA 1V1GA 3O6BA 1B1GA 2MRDA 2B3PA 1JSAA 3LVAA 4DUQA 3E5TA 1NCYA 1LVCD 3D0YB 2KI6D 5H87A 2CXJA 5BPJA 5D7FA 1AJ4A 3ST4A 2K7BA 1BT6A 1DJIA 1PSRA 1B9CA 4PDZA
chains in the Genus database with same CATH superfamily
3SVUA 2KHNA 1VRKA 1PK0D 4KPIA 4W76A 1M63B 3SVNA 4ZF4A 4AQIA 3WLDA 1OXEA 1F8HA 2HF5A 4HSZA 1WLZA 3I5GC 1OXFA 4ICBA 1NWDA 1OMDA 4DRWA 1JFJA 3M22A 1Q4EA 1KK7Z 2GW3A 4KGFA 3G9AA 4Q9XA 1N0YA 1CFFA 2O60A 3I5IC 4ETOA 2Q4UA 1DGUA 4RYWA 3CZTX 3DPZA 1SCVA 2LANA 3Q8IA 1S26D 2M29A 2G6EA 1A4PA 4YBHB 2SASA 1UP5A 1M46A 4PE4A 2WCEA 1M39A 2LHIA 2M7NA 3GK4X 2LLTA 3FWCA 3OX6A 4NQGA 1J1DA 2VVJA 3OGNA 1A75B 1A29A 3CTNA 1NUBA 4W7XA 2SCPA 1TTXA 2IOVA 5AEQA 3ZNIA 4W6MA 3M24A 1F0BA 3P8UA 2JTZA 3IQOA 2KFHA 3GK2A 3DQAA 5DRGA 4L13A 3PSRA 2YE0A 1ORGA 2KGBC 4Z4KA 1IGVA 1KK7Y 5H89A 4R6BA 1K93D 4EDOA 3GJ2A 4W6UA 4YRUA 5DTZA 1J7RA 4ZCUA 4MN0A 4AOMA 3BUNB 4GFTA 3NSLA 4R6DA 4INXA 1TWOA 2QDIA 2KYFA 1SY9A 2FL1A 2Z6XA 2JWWA 1DJYA 3OSRA 4IK4A 4U2VA 1F70A 1YFPA 2IS9A 2JPOA 5I94A 1KWOB 2WSOA 2FWQA 4YGCB 4W6SA 1C07A 1QIWA 4XVPA 2WCLA 2WHUA 4HREE 2Q57A 5DQMA 3O4YA 3DVKA 4ZINA 2VRGA 2WOSA 3D78A 2KI6C 1MHOA 2KGRA 4W69A 3LVCA 3FIAA 4LQUA 3N7HA 1J7QA 3NF0A 3JTDB 5IBWA 2MJWB 2HFCA 2LP2A 4C0LA 1BLQA 1QIVA 5AFPA 1C7WA 3HCMA 4KW4A 1BR1B 1KQMB 2ERBA 2DUFA 1Z1PA 3ZULA 3O2PA 2HJOA 2WISA 4W6LA 1CLLA 1T14A 3DF0B 1PRWA 2V4EC 3CFHA 3SS3A 4MRYA 1SMGA 3DD4A 3BUWB 1EMMA 3RWAA 1UHHA 4L9MA 3VB1A 3BYAA 1BMOA 2CTNA 2L4IA 1QYFA 1OSAA 2LLSA 3SSHA 5HLVA 1QATA 1ZFSA 4PHJA 1ZOTB 3I19A 2Z6YA 1UHIA 2GX0A 3R1OA 1S6IA 2QU1A 5DPIA 1SK6D 1XK4C 2FJYA 4LW5A 2F2PA 2VAEA 2VADA 4P5OE 1J1EA 1K8UA 1D1OA 4KW8A 3OBVA 2ZKMX 3SVEA 4CLNA 1U5IA 1KSOA 5DKRA 2PXSA 1U5IB 1KP5A 1M45A 3DQ6A 4L1IA 3PJ5A 1JF0A 2WSNA 3SIAA 3VRPA 1JF2A 3DQMA 3VGOA 1RK9A 4TNCA 1OOGA 1UURA 1J7PA 2OPOA 5T3IA 3V3DA 3B86A 2K2AA 3E3RA 1CDPA 2A56B 4N1FA 3VROA 2G16B 1GFLA 4YGAA 4W7AA 3W1CA 1AUIB 1KWOC 3CB9A 4HQ9A 2WORA 1S6CA 4Q7RA 2OS8B 3H1OA 5DRFA 4DKNA 3U0NA 1RJVA 1DJXA 1XFRA 1OZSA 3UFZA 3P28A 2QEHA 3DXLA 3CZ0A 4W6IA 3SSLA 4XL5A 4Q04A 3WXAA 3A4UB 3DYEA 1EMBA 1KFUL 4A4CA 3KHEA 1ODBA 1XFYO 4PHMA 2WCBA 2A46A 4PT1A 3CFFA 1NSHA 3PFVA 1CDLA 2HCGA 5FVGA 1MWNA 5BT0A 3DQLA 5I2OA 1CKKA 2K2FA 4XOVA 3GOFA 4W6FA 2JNFA 3IVTA 1TIZA 1J55A 2DUIA 2DUEA 2R2IA 2KQYA 1QX2A 1TNWA 5HKYA 1QXTA 1B8CA 1NYAA 4QJ5B 4W77A 2M1KB 1DGVA 1DELA 2QLIA 4W6PA 1MUXA 4TZAA 1SYMA 3NSOA 2EC6B 1SR6C 3DQCA 2WCMA 3RWTA 1F09A 4B30A 3UNWA 4CFQA 4B30B 1IQ3A 4NDDA 1YHHA 1AJ5A 3BUOB 3CS1A 3BFBA 4OVNF 1W7UA 2LCPA 1FF1A 4C0JA 1QWVA 1CB1A 3LF4B 2AH8A 3I5GB 4JQ0D 1BFPA 1QS7A 3V2LA 4M2PA 4A4BA 1XAEA 2PALA 3I5IB 1XA9A 5FI7A 3A8SA 1B47A 1LA3A 4W6HA 1H4UA 3DQHA 1SL8A 5KSZA 4AR7A 3K1KA 3CABA 2Z1OA 3PALA 1GJYA 5J2OA 2O2BA 2QEVA 4IL1A 3W1DA 2KLDA 1S6ZA 5HZUA 3DQKA 3HX4A 3SRYA 2OS8C 2E30A 2O29A 1JWDA 1S1EA 2K61A 3NHIA 2BNXA 1F54A 2M3WA 1XMZA 4HQCA 5PALA 2HPWA 2WHTA 3SS5A 1B4CA 3O78A 4GBAA 1OW4A 1SL7A 1ZGOA 3SSKA 2JTTA 3DQ5A 3RLZA 2KAVA 2P70A 3L4LA 3A8RA 1N2DA 3D10A 1K2HA 2DD9A 4NDBA 4IK3A 3SVBA 3SVCA 4BY4A 4JEOA 2RH7A 1Q4AA 4WQ2A 4H3MA 4Q7UA 1WRZA 3BQ3A 1Y0VH 3RM1A 3GJ1A 5AQBB 2L2EA 2H61A 1MYWA 5JOLA 2H9WA 4MZKA 4KEXA 3PJ7A 2OKWA 3IF7A 1RTP1 3CZ2A 1OOHA 2BAPA 3DQEA 1SBJA 2JADA 3ST0A 3BFHA 3NSKA 4DXQA 3SV5A 4CIDA 2L51A 1XSSA 2EC6C 4QJ4B 4KGEA 1TOPA 2G5ZB 4MEWA 3L47A 2KI4C 2PASA 4PPKA 4CPVA 3AKBA 3BUMB 2K7DA 1SW8A 3SJSA 4DCKA 1RWYA 4MZLA 3CYZA 4W6JA 3TUYB 2KQ6A 2I7AA 4I2YA 2GV5A 2WC6A 1QX5B 1KFXS 3DQJA 5CSJA 2KPHA 1QJTA 2MLFC 2ZN8A 3ZUFA 5HBDA 1NCXA 1XYDA 2YE1A 3S0FA 3BXAA 1LXFC 1EG4A 2L4HA 3UG0A 5FHVA 2HQKA 2P6BB 1RECA 1DJGA 1KYSA 1RMPA 2PRUA 5FI2A 2V4EA 3DPXA 2BECA 2JC2A 4FQTA 2V4EB 2TN4A 2JULA 1CNPA 4W7DA 2ZFDA 1EMFA 2KAYA 3ADFA 2PQLA 2NCPA 5TNCA 1JFKA 3FE8A 2HQWA 2NZ0A 3TS5C 2POXA 3DQNA 3KCTA 1S6JA 1YVHA 1XVJA 2JXCA 3CBEA 5FVFA 1JC2A 4PPJA 2A4JA 4ZBLA 2QLGA 4CFRA 1FPWA 4QJ3B 2QLGB 1YR5A 2BBMA 3DQOA 1XK4A 1TNPA 2A52B 1W7IB 2AMIA 2CT9A 2M97A 3M0WA 1OMVA 2D8NA 4I5JA 3KCSA 4J89A 4H3LA 1YTZC 2M49B 3RZSA 1G7KA 5HW9A 1EMCA 2BKIB 1SRAA 3BX9A 4RYSA 4YI8A 4W7CA 4KW9A 2WNDA 3SVDA 1MQ1A 1LINA 5HKWA 4PPLA 2H61C 3EK7A 2COLB 1M31A 5K89A 5I8NA 3EKHA 1GGZA 1G4YR 3BJHA 1NCZA 5CSFA 3DQFA 1AVSA 4GUKA 2B1UA 1KYRA 1K9KA 4Q7TA 1DVIA 4KF5C 5HZSA 5JJGA 4OCIA 4B5YA 5AXIA 5EHUA 3ZWHA 3I5HC 1QVIZ 4HRGA 3DQ7A 4I5NB 3DQ9A 5EB7A 5EXBA 2LC5A 2BE4A 1KYPA 3TUYC 5F6TA 1QYOA 2L98A 1ZUZA 1NX0A 1YHIA 1DQEA 5DU0A 5LTPA 4IK5A 1UHNA 2BTJA 3CD1A 4MSPA 4OJ0A 2WCHA 2HQZA 2B3QA 4W6BA 2ZO6A 1L2OC 3S0DA 3GB3A 2O5GA 3BXKA 2L0PA 1GGXA 3S0GA 1R6PA 1NX1A 3SVRA 4GGFC 1HT9A 3K21A 1ZMZA 1CTRA 1DJZA 2BCBA 4W6CA 1YX8A 2VZXA 4P76A 3LCPC 1BOCA 4W6RA 1NP8A 3TDIA 2ZMWA 4JPZB 4MVFA 2LVJA 3SVOA 1SR6B 2QRFA 2JOJA 3LK1A 1LS8A 3U8CA 2FCEA 1XFVO 5D69A 3KEVA 1SPYA 2K8MB 5DY6A 1CV7A 3CDNA 2LVIA 4W6AA 2MHHA 5HZTA 1QVIY 1TUZA 2BKHB 1YJFA 3AAJA 1EMKA 1ZGQA 1IWQA 3LLEA 5FVIA 2G2BA 1WLMA 3FWBA 3VRRA 2DOQA 4XJKA 4I5KA 4PE0A 5KTYA 4W7EA 1RMOA 1Y1UA 5J3XA 1XO5A 1PVBA 1YRTB 4AQJA 1JC1A 3CR2A 1Q4DA 4GESB 1X02A 1RMMA 5DICA 1QX7A 1QLSA 3GK1A 2MLEC 1XFXO 3TDZA 2DUGA 4YGDB 3O77A 3D74A 2KBMA 1IRJA 1ZGPA 4MLWA 1PSBA 1TNXA 4OGSA 1F4QA 2PSRA 2L5XB 1HCJA 1BJFA 1FI6A 3DVMA 3AI5A 4EDSA 3SG4A 1UHJA 3AKOA 3PM8A 2ZNEA 2CNPA 2ZRSA 4W7RA 1H4BA 2DD7A 2MBXA 2MAZA 3ZUJA 4GNKB 3BOWA 3B88A 5BTTA 3ED8A 3BOWB 4DIRA 5BTTB 5B8IB 3VHTA 3VHTB 1DJWA 1MF8B 1YURA 3EVVA 1QV1A 2Q91A 3CWGA 2QZ0A 1KFXL 4W6OA 3SG5A 1Q4BA 1RROA 1K9PA 2KYCA 1IH0A 4OHSA 3EVRA 2V53A 3U8PA 3R1VA 1W7TA 4M2OA 2HETA 2F3ZA 5CSIA 4NWSA 3SG6A 4ZIOA 2A50B 5DPJA 2FOTA 4HRHA 3AI4A 1Y1AA 1XFZO 1CFPA 2P4MA 4IK8A 3SSVA 1DEKA 1QLKA 4LJDC 4LJCA 2KI4B 1A2XA 1YX7A 1BU3A 2VVIA 1QTXA 3DQ2A 3OGOA 2K7CA 4DS7A 3CGAA 3OSQA 4MBEA 4ZCVA 1W7JB 3BUXB 2L50A 2IB6A 4GAOA 4J88A 4USLA 2EHBA 1UISA 3DQ3A 4GOBA 5LK4A 3QRXA 2IE2A 2BL0B 4W6NA 2NXQA 3NEDA 3VICA 4E68A 3WHUB 2M0RA 2DUHA 2LUCA 2YFPA 1KCYA 4ZF3A 2KBIA 2AWKA 3KO0A 1F71A 1F4OA 1CMFA 2HRSA 2AUCA 3S0BA 4DXOA 1YUTA 5HL1A 3IQQA 4INWA 1KK8C 1SCMB 4JKTA 5AANA 5EJUA 3PN7B 2H5PA 3EKJA 3DPWA 2KOTA 3WNXB 2F33A 2O24A 1OE9B 4UPGA 2JU0A 2YGUA 2BCAA 2JT0A 1XQMA 3TS5B 3EK4A 3BFAA 1EH2A 4DXIA 4PCWA 1FW4A 5EBJA 4PHKA 3KF9A 5I2QA 3PATA 1DMOA 3TZ1A 2ARLA 1JBYA 4JF9A 2WCKA 3IP2A 1Y6WA 5HGEA 1BF5A 2EMOA 4J8AA 4YGBB 4BDUA 3DQ4A 3TDUA 2FZUA 1EMEA 3EVPA 2P71A 2H5QA 1S36A 3NEZA 3B87A 5GQQC 3DQ1A 1YVLA 5EL2A 3SG7A 4JFGA 5EXUA 5HZOA 2AWMA 2Y4QA 1EG3A 4KA9A 3D73A 3LK0A 5KU1A 3QMEA 1QXPA 5HYDA 2A48A 4N5XA 3EVUA 2IB5A 4W72A 2NCOA 2M8UA 3S0EA 3DQUA 1K90D 4GF6B 4KF5A 5DTLA 1H8BA 1B8RA 2ISDA 2ZMUA 3D0YA 1XFWO 3I5HB 2OTBA 3TMRA 4KYNA 2KFFA 2MA2A 4ZFSA 2JT8A 5DTYA 1AK8A 4YI9A 1OOIX 3E5VA 3CLNA 1IG5A 3GL4A 4DXMA 2Y1MA 1WY9A 2LM5A 2BL0C 4OZDA 3LS3A 1AHRA 1L2OB 4EMQA 1A03A 3F45A 2BBNA 4W6GA 4ZF5A 1KFUS 2OTGB 1EJ3A 1PALA 4RTCA 4W74A 3I5FC 4OY4A 2EMNA 1WRLA 4DXPA 4GGFA 1SCMC 2JNXA 1L7ZA 3PN7C 4DXNA 2PYQA 1UWOA 3DQDA 3WCKA 4LJBA 2WHSA 2M7LA 2C9IA 1JBAA 4KAGA 1FBVA 2JT3A 1Q4CA 1UUSA 2PVBA 1XFUO 2K7OA 1A75A 4FTGA 1BG1A 1Q80A 4R1EA 4P2YB 1OOJA 2G3DB 4JWQA 2KFGA 4PHNA 4W6TA 2C9JA 2HGDA 5ER4X 2Q6PA 2GGZA 2KLEA 3EG5B 2F3YA 1YRUB 5H88A 1CLBA 1K94A 1SSEB 4I5LB 4HQ8A 2LVKA 1NPQA 1NX2A 1IIOA 2KAXA 2JRFA 2Y5IA 1W7SA 2JXLA 3MSEB 5FI6A 1YUSA 2WC5A 3WHTB 2CCMA 2LMUA 1QY3A 5AERA 2A53B 3CR4X 3L4AA 4M2QA 4IK9A 1GL4A 1KSMA 1CM4A 4W75A 4H3NA 3SG2A 4OR9B 5HLOA 2H6VA 2H5OA 3SSTA 3O4XA 2Y0GA 3MGFA 3DY9A 2YDZA 1PULA 1PVAA 1R2UA 1WRKA 4ORNA 4PALA 2I18A 1NIWA 1DF0A 1MOVA 1LKJA 1DF0B 2K0JA 1Z1QA 1N65A 4WRIA 3NHTA 1K95A 1E8AA 4XYNA 5G08A 4ORCB 2GGMA 3VRQA 1MXLC 3CR5X 2RGIA 1EMLA 1RM9A 3OHMB 2VVHA 2M1UA 2NLNA 2QEOA 3NGVA 2CBLA 2M9GA 3LSAA 2BE6A 2LHLA 4EULA 2Z6ZA 2E6WA 4C0KA 2OTGC 2F8PA 5CSNA 1QASA 2KNEA 2LUXA 3CFAA 1BR4B 2WCJA 5D3OA 1C3ZA 4MRXA 1K96A 2G9BA 3PLFB 1Q73A 1QYQA 4IZNA 2QLEA 4JRBA 3DF0A 3AKAA 5ER5A 3LF3A 1WDCB 3D75A 4LJDA 1ZUXA 2FJUB 2QACA 1SKTA 1EL4A 3VRNA 3OB1B 4JGEA 1RRXA 3K1EA 1IJ6A 3KPXA 4OQWA 1CM1A 1TCOB 1CLMA 3SS0A 4IK1A 2JZIA 2H2KA 2WCFA 2BCXA 2QEBA 3DVJA 2ZRTA 3JVTB 2A47A 2ZO7A 1JUOA 2HQ8A 1GGWA 3S0AA 4IJ7A 2H5RA 3SVSA 2F2OA 3IR8A 4U8DA 4XJKB 1HUYA 5DTXA 1NX3A 5EXCI 2I94A 3ICBA 1TUJA 1YJ2A 1G33A 4WQ3A 2LVVA 5DQBA 3E5WA 3NXAA 4ORAB 1KK8B 4PFEA 4Z4MA 1OZOA 2LAPA 3LVDA 3ZTFA 1TRFA 5EB6A 2OKYA 4ORBB 1TNQA 2QT2A 1OQPA 3SIBA 5BQLA 4N3DA 2LMTA 5HKZA 2A54B 4EN1A 4GGNA 2G2SB 2EMDA 4W6KA 1F55A 3TMTA 2LLUA 3EK8A 1ZACA 4OKHA 4N1GA 4W6DA 2QPTA 3FS7A 4NDCA 3DQ8A 5DPHA 3U8AA 3VK1A 5CPVA 1GM0A 1C4FA 1RFJA 1MR8A 2ICRA 1BODA 3CZ1A 5LTQA 3PJIA 3CGLA 1TCFA 1AP4A 1JBZA 3S05A 1CFCA 1KQVA 1IQ5A 2AWLA 1G8IA 1CDNA 3D76A 5I2LA 3FE6A 3JTDC 2DDDA 1B7TZ 2I2RE 2H8QA 4AS8A 3NT3A 1C3YA 2WURA 4YGEB 4PE1A 3BXCA 3B7AA 3D77A 3GEXA 2EGDA 3AAKA 1KQMC 4W73A 3LA1A 4DKMA 2KSPA 4Q9WA 2PXWA 1WDCC 3DZTA 1SNLA 4MZJA 1QV0A 1OXDA 4JD9A 1YHGA 1FI5A 1B9AA 4GPLB 1CMGA 2G6YA 3WLCA 1EMAA 2ZN9A 2DDCA 1UHKA 2OGRA 1IKUA 5LTRA 4H47A 1S5GZ 3JVTC 1XA5A 2G6XA 1J7OA 2LE9B 4OV2A 3ST2A 5FYXA 1DTLA 1Z4HA 5DKNA 1YZWA 4ANJA 2LNKA 3SSYA 2JQ6A 2Y1NA 5KTGA 4PE7A 1MOUA 3SS4A 1SL9A 1JC0A 3OP0A 2AAOA 3U0MA 3DQIA 2ZNDA 4HVFA 3I5FB 1B7TY 2LMVA 4L12A 1DT7B 2OTEA 4F0ZB 3U0LA 3LL8B 1HQVA 4W7FA 1ALWA 3SG3A 1DJHA 2FCDA 1CFDA 3DVEA 3ST3A 1B8LA 2GTEA 5DKQA 4F7FA 1EMGA 4H48A 2OJKA 1K9UA 3CD9A 1OMRA 3OX5A 1LA0A 5F9GA 5DPGA 3OB2B 2WIQA 4ZB1A 2H8VA 3NT9A 3R1PA 1ALVA 1S5GY 1Y1XA 1V1FA 3UO9A 2GW4B 4TZGA 4KF4A 3BXBA 2HGYA 4XGYA 1CDMA 4D1EA 1W9ZA 2LP3A 4JC2A 4P1QA 2K60A 1H6RA 2QLHA 2L2CA 1C7VA 4UTSA 3H1RA 1OOFA 1S3PA 3NSIA 2AHAA 1GQMA 1IJ5A 2HPSA 4FQOA 3C1VA 2G3OA 3SSPA 3R72A 2PMYA 1DC1A 1EXRA 1MXEA 3PJBA 4XOWA 2AWJA 1TN4A 2KDHA 3U0KA 2GX2A 4BY5A 3PIBA 1P28A 2LV7A 2JPTA 4LQTA 2WC8A 4HE4A 3H4SE 1YUUA 1V1GA 3PM2A 3O6BA 1B1GA 2MRDA 2B3PA 1JSAA 3LVAA 4DUQA 3B6XA 3E5TA 3FE9A 1NCYA 1LVCD 3D0YB 2KI6D 5H87A 1Z2CB 2CXJA 5BPJA 5D7FA 1AJ4A 3ST4A 2K7BA 1BT6A 1DJIA 1PSRA 2L5YA 1B9CA 4PDZA
chains in the Genus database with same CATH topology
3SVUA 2KHNA 1VRKA 1PK0D 4KPIA 4W76A 1M63B 3SVNA 4ZF4A 4AQIA 3WLDA 1OXEA 1F8HA 2HF5A 4HSZA 1WLZA 3I5GC 1OXFA 4ICBA 1NWDA 1OMDA 4DRWA 1JFJA 3M22A 1Q4EA 1KK7Z 2GW3A 4KGFA 3G9AA 4Q9XA 1N0YA 1CFFA 2O60A 3I5IC 4ETOA 2Q4UA 1DGUA 4RYWA 3CZTX 3DPZA 1SCVA 2LANA 1S26D 2M29A 2G6EA 1A4PA 4YBHB 2SASA 1UP5A 1M46A 4PE4A 2WCEA 1M39A 2LHIA 2M7NA 3GK4X 2LLTA 3FWCA 3OX6A 4NQGA 1J1DA 2VVJA 1A75B 1A29A 3CTNA 1NUBA 4W7XA 2SCPA 1TTXA 2IOVA 5AEQA 3ZNIA 4W6MA 3M24A 1F0BA 3P8UA 2JTZA 3IQOA 2KFHA 3GK2A 3DQAA 5DRGA 4L13A 3PSRA 2YE0A 2KGBC 4Z4KA 1IGVA 1KK7Y 5H89A 4R6BA 1K93D 4EDOA 3GJ2A 4W6UA 4YRUA 5DTZA 1J7RA 4ZCUA 4MN0A 4AOMA 3BUNB 4GFTA 3NSLA 4R6DA 2KYFA 1SY9A 2FL1A 2Z6XA 2JWWA 1DJYA 3OSRA 4IK4A 4U2VA 1F70A 1YFPA 2IS9A 1KWOB 2WSOA 2FWQA 4YGCB 4W6SA 1C07A 1QIWA 4XVPA 2WHUA 4HREE 2Q57A 5DQMA 3O4YA 3DVKA 4ZINA 2VRGA 2WOSA 2KI6C 1MHOA 2KGRA 4W69A 3LVCA 3FIAA 4LQUA 1J7QA 3NF0A 3JTDB 5IBWA 2MJWB 2HFCA 2LP2A 4C0LA 1BLQA 1QIVA 5AFPA 1C7WA 3HCMA 4KW4A 1BR1B 1KQMB 2DUFA 3ZULA 1Z1PA 3O2PA 2HJOA 2WISA 4W6LA 1CLLA 3DF0B 1PRWA 2V4EC 3CFHA 4MRYA 1SMGA 3DD4A 3BUWB 1EMMA 3RWAA 1UHHA 4L9MA 3BYAA 1BMOA 2CTNA 2L4IA 1QYFA 1OSAA 2LLSA 3SSHA 5HLVA 1QATA 1ZFSA 4PHJA 1ZOTB 3I19A 2Z6YA 1UHIA 2GX0A 1S6IA 2QU1A 5DPIA 1SK6D 1XK4C 4LW5A 2F2PA 2VAEA 2VADA 4P5OE 1J1EA 1K8UA 1D1OA 4KW8A 2ZKMX 3SVEA 4CLNA 1U5IA 1KSOA 5DKRA 2PXSA 1U5IB 1KP5A 1M45A 3DQ6A 4L1IA 3PJ5A 1JF0A 2WSNA 3SIAA 3VRPA 1JF2A 3DQMA 3VGOA 1RK9A 4TNCA 1UURA 1J7PA 2OPOA 5T3IA 3V3DA 2K2AA 3E3RA 1CDPA 2A56B 4N1FA 3VROA 2G16B 1GFLA 4YGAA 4W7AA 3W1CA 1AUIB 1KWOC 3CB9A 4HQ9A 2WORA 1S6CA 4Q7RA 2OS8B 3H1OA 5DRFA 4DKNA 3U0NA 1RJVA 1DJXA 1OZSA 3UFZA 3P28A 4W6IA 3SSLA 4XL5A 4Q04A 3WXAA 3A4UB 1EMBA 1KFUL 4A4CA 3KHEA 1ODBA 1XFYO 4PHMA 2WCBA 2A46A 3CFFA 1NSHA 3PFVA 1CDLA 2HCGA 5FVGA 1MWNA 5BT0A 3DQLA 5I2OA 1CKKA 2K2FA 4XOVA 4W6FA 3GOFA 2JNFA 1TIZA 1J55A 2DUIA 2DUEA 2R2IA 2KQYA 1QX2A 1TNWA 5HKYA 1QXTA 1B8CA 1NYAA 4QJ5B 4W77A 2M1KB 1DGVA 2QLIA 4W6PA 1MUXA 4TZAA 1SYMA 3NSOA 2EC6B 1SR6C 3DQCA 3RWTA 1F09A 4B30A 4CFQA 4B30B 1IQ3A 4NDDA 1YHHA 1AJ5A 3BUOB 3CS1A 4OVNF 1W7UA 2LCPA 1FF1A 4C0JA 1CB1A 3LF4B 2AH8A 3I5GB 4JQ0D 1BFPA 1QS7A 4M2PA 4A4BA 1XAEA 2PALA 3I5IB 1XA9A 3A8SA 1B47A 1LA3A 4W6HA 1H4UA 3DQHA 1SL8A 5KSZA 4AR7A 3K1KA 2Z1OA 3PALA 1GJYA 5J2OA 2O2BA 4IL1A 3W1DA 1S6ZA 5HZUA 3DQKA 3HX4A 3SRYA 2OS8C 2E30A 2O29A 1JWDA 1S1EA 2K61A 1F54A 2M3WA 1XMZA 4HQCA 5PALA 2HPWA 2WHTA 1B4CA 3O78A 4GBAA 1SL7A 1ZGOA 3SSKA 2JTTA 3DQ5A 3RLZA 2KAVA 3A8RA 1N2DA 3D10A 1K2HA 2DD9A 4NDBA 4IK3A 3SVBA 3SVCA 4BY4A 4JEOA 2RH7A 1Q4AA 4WQ2A 4H3MA 4Q7UA 1WRZA 3BQ3A 1Y0VH 3RM1A 3GJ1A 5AQBB 2L2EA 2H61A 1MYWA 5JOLA 2H9WA 4MZKA 4KEXA 3PJ7A 2OKWA 3IF7A 1RTP1 3DQEA 1SBJA 2JADA 3ST0A 3NSKA 4DXQA 3SV5A 4CIDA 2L51A 1XSSA 2EC6C 4QJ4B 4KGEA 1TOPA 2G5ZB 4MEWA 2KI4C 2PASA 4PPKA 4CPVA 3AKBA 3BUMB 2K7DA 1SW8A 3SJSA 4DCKA 1RWYA 4MZLA 4W6JA 3TUYB 2KQ6A 2I7AA 4I2YA 2GV5A 1QX5B 1KFXS 3DQJA 5CSJA 1QJTA 2MLFC 2ZN8A 3ZUFA 5HBDA 1NCXA 1XYDA 2YE1A 3BXAA 1LXFC 1EG4A 2L4HA 3UG0A 5FHVA 2HQKA 2P6BB 1RECA 1DJGA 1KYSA 1RMPA 2PRUA 2V4EA 3DPXA 2BECA 2JC2A 2V4EB 2TN4A 2JULA 1CNPA 4W7DA 2ZFDA 1EMFA 2KAYA 3ADFA 2NCPA 5TNCA 1JFKA 2HQWA 2NZ0A 3TS5C 2POXA 3DQNA 3KCTA 1S6JA 1YVHA 1XVJA 2JXCA 3CBEA 5FVFA 1JC2A 4PPJA 2A4JA 4ZBLA 2QLGA 4CFRA 1FPWA 4QJ3B 2QLGB 1YR5A 2BBMA 3DQOA 1XK4A 1TNPA 2A52B 1W7IB 2AMIA 2CT9A 2M97A 3M0WA 1OMVA 2D8NA 4I5JA 3KCSA 4J89A 4H3LA 1YTZC 2M49B 1G7KA 5HW9A 1EMCA 2BKIB 1SRAA 3BX9A 4RYSA 4YI8A 4W7CA 4KW9A 2WNDA 3SVDA 1MQ1A 1LINA 5HKWA 4PPLA 2H61C 3EK7A 2COLB 1M31A 5K89A 5I8NA 3EKHA 1GGZA 1G4YR 5CSFA 1NCZA 3DQFA 1AVSA 4GUKA 2B1UA 1KYRA 1K9KA 4Q7TA 1DVIA 4KF5C 5HZSA 5JJGA 4OCIA 4B5YA 5AXIA 5EHUA 3ZWHA 3I5HC 1QVIZ 4HRGA 3DQ7A 4I5NB 3DQ9A 5EB7A 5EXBA 2LC5A 2BE4A 1KYPA 3TUYC 5F6TA 1QYOA 2L98A 1ZUZA 1NX0A 1YHIA 5DU0A 5LTPA 4IK5A 1UHNA 2BTJA 3CD1A 4MSPA 4OJ0A 2HQZA 2B3QA 4W6BA 2ZO6A 1L2OC 3GB3A 2O5GA 3BXKA 2L0PA 1GGXA 1R6PA 1NX1A 3SVRA 4GGFC 1HT9A 3K21A 1ZMZA 1CTRA 1DJZA 2BCBA 4W6CA 1YX8A 2VZXA 4P76A 3LCPC 1BOCA 4W6RA 1NP8A 3TDIA 2ZMWA 4JPZB 4MVFA 2LVJA 3SVOA 1SR6B 2QRFA 2JOJA 3LK1A 3U8CA 2FCEA 1XFVO 5D69A 3KEVA 1SPYA 2K8MB 5DY6A 1CV7A 2LVIA 4W6AA 2MHHA 5HZTA 1QVIY 2BKHB 1YJFA 3AAJA 1EMKA 1ZGQA 1IWQA 3LLEA 5FVIA 2G2BA 1WLMA 3FWBA 3VRRA 2DOQA 4XJKA 4I5KA 4PE0A 5KTYA 4W7EA 1RMOA 1Y1UA 5J3XA 1XO5A 1PVBA 1YRTB 4AQJA 1JC1A 3CR2A 1Q4DA 4GESB 1X02A 1RMMA 1QX7A 1QLSA 3GK1A 2MLEC 1XFXO 3TDZA 2DUGA 4YGDB 3O77A 2KBMA 1IRJA 1ZGPA 4MLWA 1PSBA 1TNXA 4OGSA 1F4QA 2PSRA 2L5XB 1HCJA 1BJFA 1FI6A 3DVMA 3AI5A 4EDSA 3SG4A 1UHJA 3AKOA 3PM8A 2ZNEA 2CNPA 2ZRSA 4W7RA 1H4BA 2DD7A 2MBXA 2MAZA 3ZUJA 4GNKB 3BOWA 5BTTA 3ED8A 3BOWB 4DIRA 5BTTB 5B8IB 3VHTA 3VHTB 1DJWA 1MF8B 1YURA 3EVVA 1QV1A 2Q91A 3CWGA 2QZ0A 1KFXL 4W6OA 3SG5A 1Q4BA 1RROA 1K9PA 2KYCA 1IH0A 4OHSA 3EVRA 2V53A 3U8PA 1W7TA 4M2OA 2HETA 2F3ZA 5CSIA 4NWSA 3SG6A 4ZIOA 2A50B 5DPJA 2FOTA 4HRHA 3AI4A 1Y1AA 1XFZO 1CFPA 2P4MA 4IK8A 3SSVA 1QLKA 4LJDC 4LJCA 2KI4B 1A2XA 1YX7A 1BU3A 2VVIA 1QTXA 3DQ2A 3OGOA 2K7CA 4DS7A 3CGAA 3OSQA 4MBEA 4ZCVA 1W7JB 3BUXB 2L50A 2IB6A 4GAOA 4J88A 4USLA 2EHBA 1UISA 3DQ3A 4GOBA 5LK4A 3QRXA 2IE2A 2BL0B 4W6NA 2NXQA 3NEDA 3VICA 4E68A 3WHUB 2M0RA 2DUHA 2LUCA 2YFPA 1KCYA 4ZF3A 2KBIA 2AWKA 3KO0A 1F71A 1F4OA 1CMFA 2HRSA 2AUCA 4DXOA 1YUTA 3IQQA 1KK8C 1SCMB 5AANA 5EJUA 3PN7B 2H5PA 3EKJA 3DPWA 2KOTA 3WNXB 2F33A 2O24A 1OE9B 4UPGA 2JU0A 2BCAA 2JT0A 1XQMA 3TS5B 3EK4A 1EH2A 4DXIA 4PCWA 1FW4A 5EBJA 4PHKA 3KF9A 5I2QA 3PATA 1DMOA 3TZ1A 2ARLA 1JBYA 4JF9A 3IP2A 1Y6WA 5HGEA 1BF5A 2EMOA 4J8AA 4YGBB 4BDUA 3DQ4A 3TDUA 2FZUA 1EMEA 3EVPA 2H5QA 1S36A 3NEZA 5GQQC 3DQ1A 1YVLA 4JFGA 3SG7A 5EXUA 5HZOA 2AWMA 2Y4QA 1EG3A 4KA9A 3LK0A 5KU1A 1QXPA 5HYDA 2A48A 4N5XA 3EVUA 2IB5A 4W72A 2NCOA 2M8UA 3DQUA 1K90D 4GF6B 4KF5A 5DTLA 1H8BA 1B8RA 2ISDA 2ZMUA 3D0YA 1XFWO 3I5HB 2OTBA 3TMRA 2KFFA 2MA2A 4ZFSA 2JT8A 5DTYA 1AK8A 4YI9A 3E5VA 3CLNA 1IG5A 3GL4A 4DXMA 2Y1MA 1WY9A 2LM5A 2BL0C 3LS3A 1AHRA 1L2OB 4EMQA 1A03A 3F45A 2BBNA 4W6GA 4ZF5A 1KFUS 2OTGB 1EJ3A 1PALA 4RTCA 4W74A 3I5FC 4OY4A 2EMNA 1WRLA 4DXPA 4GGFA 1SCMC 2JNXA 1L7ZA 3PN7C 4DXNA 1UWOA 3DQDA 3WCKA 4LJBA 2WHSA 2M7LA 2C9IA 1JBAA 4KAGA 1FBVA 2JT3A 1Q4CA 1UUSA 2PVBA 1XFUO 2K7OA 1A75A 4FTGA 1BG1A 1Q80A 4R1EA 4P2YB 1OOJA 2G3DB 4JWQA 2KFGA 4PHNA 4W6TA 2C9JA 2HGDA 5ER4X 2Q6PA 2GGZA 2F3YA 1YRUB 5H88A 1CLBA 1K94A 4I5LB 4HQ8A 2LVKA 1NPQA 1NX2A 2KAXA 2JRFA 2Y5IA 1W7SA 2JXLA 3MSEB 1YUSA 3WHTB 2CCMA 2LMUA 1QY3A 5AERA 2A53B 3CR4X 4M2QA 4IK9A 1GL4A 1KSMA 4W75A 1CM4A 4H3NA 3SG2A 4OR9B 5HLOA 2H6VA 2H5OA 3SSTA 2Y0GA 3MGFA 2YDZA 1PULA 1PVAA 1R2UA 1WRKA 4ORNA 4PALA 2I18A 1NIWA 1DF0A 1MOVA 1LKJA 1DF0B 2K0JA 1Z1QA 1N65A 4WRIA 1K95A 1E8AA 4XYNA 5G08A 4ORCB 2GGMA 3VRQA 1MXLC 3CR5X 2RGIA 1EMLA 1RM9A 3OHMB 2VVHA 2M1UA 2NLNA 2CBLA 2M9GA 3LSAA 2BE6A 2LHLA 4EULA 2Z6ZA 2E6WA 4C0KA 2OTGC 2F8PA 5CSNA 1QASA 2KNEA 2LUXA 3CFAA 1BR4B 4MRXA 1K96A 2G9BA 3PLFB 1Q73A 1QYQA 4IZNA 2QLEA 4JRBA 3DF0A 3AKAA 5ER5A 3LF3A 1WDCB 4LJDA 1ZUXA 2FJUB 2QACA 1SKTA 1EL4A 3VRNA 3OB1B 4JGEA 1RRXA 1IJ6A 3KPXA 4OQWA 1CM1A 1TCOB 1CLMA 3SS0A 4IK1A 2JZIA 2H2KA 2WCFA 2BCXA 3DVJA 2ZRTA 3JVTB 2A47A 2ZO7A 1JUOA 2HQ8A 1GGWA 2H5RA 3SVSA 2F2OA 3IR8A 4U8DA 4XJKB 1HUYA 5DTXA 1NX3A 5EXCI 2I94A 3ICBA 1YJ2A 1G33A 4WQ3A 2LVVA 5DQBA 3E5WA 3NXAA 4ORAB 1KK8B 4PFEA 4Z4MA 1OZOA 2LAPA 3LVDA 3ZTFA 1TRFA 5EB6A 2OKYA 4ORBB 1TNQA 2QT2A 1OQPA 3SIBA 5BQLA 4N3DA 2LMTA 5HKZA 2A54B 4EN1A 4GGNA 2G2SB 2EMDA 4W6KA 1F55A 3TMTA 2LLUA 3EK8A 1ZACA 4OKHA 4N1GA 4W6DA 2QPTA 3FS7A 4NDCA 3DQ8A 5DPHA 3U8AA 3VK1A 5CPVA 1C4FA 1RFJA 1MR8A 2ICRA 1BODA 5LTQA 3CGLA 1TCFA 1AP4A 1JBZA 3S05A 1CFCA 1KQVA 1IQ5A 2AWLA 1G8IA 1CDNA 5I2LA 3JTDC 2DDDA 1B7TZ 2I2RE 2H8QA 4AS8A 3NT3A 2WURA 4YGEB 4PE1A 3BXCA 3GEXA 2EGDA 3AAKA 1KQMC 4W73A 3LA1A 4DKMA 2KSPA 4Q9WA 2PXWA 1WDCC 1SNLA 4MZJA 1QV0A 1OXDA 1YHGA 1FI5A 1B9AA 4GPLB 1CMGA 2G6YA 3WLCA 1EMAA 2ZN9A 2DDCA 1UHKA 2OGRA 1IKUA 5LTRA 4H47A 1S5GZ 3JVTC 1XA5A 2G6XA 1J7OA 2LE9B 4OV2A 3ST2A 5FYXA 1DTLA 5DKNA 1YZWA 4ANJA 2LNKA 3SSYA 2JQ6A 2Y1NA 5KTGA 4PE7A 1MOUA 1SL9A 1JC0A 3OP0A 2AAOA 3U0MA 3DQIA 2ZNDA 4HVFA 3I5FB 1B7TY 2LMVA 4L12A 1DT7B 2OTEA 4F0ZB 3U0LA 3LL8B 1HQVA 4W7FA 1ALWA 3SG3A 1DJHA 2FCDA 1CFDA 3DVEA 3ST3A 1B8LA 5DKQA 1EMGA 4H48A 2OJKA 1K9UA 3CD9A 1OMRA 3OX5A 1LA0A 5F9GA 5DPGA 3OB2B 2WIQA 4ZB1A 3NT9A 1ALVA 1S5GY 1Y1XA 1V1FA 2GW4B 4TZGA 4KF4A 3BXBA 2HGYA 4XGYA 1CDMA 4D1EA 2LP3A 4JC2A 4P1QA 1H6RA 2QLHA 1C7VA 4UTSA 3H1RA 1S3PA 3NSIA 2AHAA 1GQMA 1IJ5A 2HPSA 4FQOA 3C1VA 2G3OA 3SSPA 2PMYA 1EXRA 1MXEA 3PJBA 4XOWA 2AWJA 1TN4A 2KDHA 3U0KA 2GX2A 4BY5A 3PIBA 2LV7A 2JPTA 4LQTA 2WC8A 4HE4A 3H4SE 1YUUA 1V1GA 3O6BA 1B1GA 2MRDA 2B3PA 1JSAA 3LVAA 4DUQA 3E5TA 1NCYA 1LVCD 3D0YB 2KI6D 5H87A 2CXJA 5BPJA 5D7FA 1AJ4A 3ST4A 2K7BA 1BT6A 1DJIA 1PSRA 1B9CA 4PDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SVU A;  2KHN A;  1VRK A;  1PK0 D;  4KPI A;  4W76 A;  1M63 B;  3SVN A;  4ZF4 A;  4AQI A;  3WLD A;  1OXE A;  1F8H A;  2HF5 A;  4HSZ A;  1WLZ A;  3I5G C;  1OXF A;  4ICB A;  1NWD A;  1OMD A;  4DRW A;  1JFJ A;  3M22 A;  1Q4E A;  1KK7 Z;  2GW3 A;  4KGF A;  3G9A A;  4Q9X A;  1N0Y A;  1CFF A;  2O60 A;  3I5I C;  4ETO A;  2Q4U A;  1DGU A;  4RYW A;  3CZT X;  3DPZ A;  1SCV A;  2LAN A;  1S26 D;  2M29 A;  2G6E A;  1A4P A;  4YBH B;  2SAS A;  1UP5 A;  1M46 A;  4PE4 A;  2WCE A;  1M39 A;  2LHI A;  2M7N A;  3GK4 X;  2LLT A;  3FWC A;  3OX6 A;  4NQG A;  1J1D A;  2VVJ A;  1A75 B;  1A29 A;  3CTN A;  1NUB A;  4W7X A;  2SCP A;  1TTX A;  2IOV A;  5AEQ A;  3ZNI A;  4W6M A;  3M24 A;  1F0B A;  3P8U A;  2JTZ A;  3IQO A;  2KFH A;  3GK2 A;  3DQA A;  5DRG A;  4L13 A;  3PSR A;  2YE0 A;  2KGB C;  4Z4K A;  1IGV A;  1KK7 Y;  5H89 A;  4R6B A;  1K93 D;  4EDO A;  3GJ2 A;  4W6U A;  4YRU A;  5DTZ A;  1J7R A;  4ZCU A;  4MN0 A;  4AOM A;  3BUN B;  4GFT A;  3NSL A;  4R6D A;  2KYF A;  1SY9 A;  2FL1 A;  2Z6X A;  2JWW A;  1DJY A;  3OSR A;  4IK4 A;  4U2V A;  1F70 A;  1YFP A;  2IS9 A;  1KWO B;  2WSO A;  2FWQ A;  4YGC B;  4W6S A;  1C07 A;  1QIW A;  4XVP A;  2WHU A;  4HRE E;  2Q57 A;  5DQM A;  3O4Y A;  3DVK A;  4ZIN A;  2VRG A;  2WOS A;  2KI6 C;  1MHO A;  2KGR A;  4W69 A;  3LVC A;  3FIA A;  4LQU A;  1J7Q A;  3NF0 A;  3JTD B;  5IBW A;  2MJW B;  2HFC A;  2LP2 A;  4C0L A;  1BLQ A;  1QIV A;  5AFP A;  1C7W A;  3HCM A;  4KW4 A;  1BR1 B;  1KQM B;  2DUF A;  3ZUL A;  1Z1P A;  3O2P A;  2HJO A;  2WIS A;  4W6L A;  1CLL A;  3DF0 B;  1PRW A;  2V4E C;  3CFH A;  4MRY A;  1SMG A;  3DD4 A;  3BUW B;  1EMM A;  3RWA A;  1UHH A;  4L9M A;  3BYA A;  1BMO A;  2CTN A;  2L4I A;  1QYF A;  1OSA A;  2LLS A;  3SSH A;  5HLV A;  1QAT A;  1ZFS A;  4PHJ A;  1ZOT B;  3I19 A;  2Z6Y A;  1UHI A;  2GX0 A;  1S6I A;  2QU1 A;  5DPI A;  1SK6 D;  1XK4 C;  4LW5 A;  2F2P A;  2VAE A;  2VAD A;  4P5O E;  1J1E A;  1K8U A;  1D1O A;  4KW8 A;  2ZKM X;  3SVE A;  4CLN A;  1U5I A;  1KSO A;  5DKR A;  2PXS A;  1U5I B;  1KP5 A;  1M45 A;  3DQ6 A;  4L1I A;  3PJ5 A;  1JF0 A;  2WSN A;  3SIA A;  3VRP A;  1JF2 A;  3DQM A;  3VGO A;  1RK9 A;  4TNC A;  1UUR A;  1J7P A;  2OPO A;  5T3I A;  3V3D A;  2K2A A;  3E3R A;  1CDP A;  2A56 B;  4N1F A;  3VRO A;  2G16 B;  1GFL A;  4YGA A;  4W7A A;  3W1C A;  1AUI B;  1KWO C;  3CB9 A;  4HQ9 A;  2WOR A;  1S6C A;  4Q7R A;  2OS8 B;  3H1O A;  5DRF A;  4DKN A;  3U0N A;  1RJV A;  1DJX A;  1OZS A;  3UFZ A;  3P28 A;  4W6I A;  3SSL A;  4XL5 A;  4Q04 A;  3WXA A;  3A4U B;  1EMB A;  1KFU L;  4A4C A;  3KHE A;  1ODB A;  1XFY O;  4PHM A;  2WCB A;  2A46 A;  3CFF A;  1NSH A;  3PFV A;  1CDL A;  2HCG A;  5FVG A;  1MWN A;  5BT0 A;  3DQL A;  5I2O A;  1CKK A;  2K2F A;  4XOV A;  4W6F A;  3GOF A;  2JNF A;  1TIZ A;  1J55 A;  2DUI A;  2DUE A;  2R2I A;  2KQY A;  1QX2 A;  1TNW A;  5HKY A;  1QXT A;  1B8C A;  1NYA A;  4QJ5 B;  4W77 A;  2M1K B;  1DGV A;  2QLI A;  4W6P A;  1MUX A;  4TZA A;  1SYM A;  3NSO A;  2EC6 B;  1SR6 C;  3DQC A;  3RWT A;  1F09 A;  4B30 A;  4CFQ A;  4B30 B;  1IQ3 A;  4NDD A;  1YHH A;  1AJ5 A;  3BUO B;  3CS1 A;  4OVN F;  1W7U A;  2LCP A;  1FF1 A;  4C0J A;  1CB1 A;  3LF4 B;  2AH8 A;  3I5G B;  4JQ0 D;  1BFP A;  1QS7 A;  4M2P A;  4A4B A;  1XAE A;  2PAL A;  3I5I B;  1XA9 A;  3A8S A;  1B47 A;  1LA3 A;  4W6H A;  1H4U A;  3DQH A;  1SL8 A;  5KSZ A;  4AR7 A;  3K1K A;  2Z1O A;  3PAL A;  1GJY A;  5J2O A;  2O2B A;  4IL1 A;  3W1D A;  1S6Z A;  5HZU A;  3DQK A;  3HX4 A;  3SRY A;  2OS8 C;  2E30 A;  2O29 A;  1JWD A;  1S1E A;  2K61 A;  1F54 A;  2M3W A;  1XMZ A;  4HQC A;  5PAL A;  2HPW A;  2WHT A;  1B4C A;  3O78 A;  4GBA A;  1SL7 A;  1ZGO A;  3SSK A;  2JTT A;  3DQ5 A;  3RLZ A;  2KAV A;  3A8R A;  1N2D A;  3D10 A;  1K2H A;  2DD9 A;  4NDB A;  4IK3 A;  3SVB A;  3SVC A;  4BY4 A;  4JEO A;  2RH7 A;  1Q4A A;  4WQ2 A;  4H3M A;  4Q7U A;  1WRZ A;  3BQ3 A;  1Y0V H;  3RM1 A;  3GJ1 A;  5AQB B;  2L2E A;  2H61 A;  1MYW A;  5JOL A;  2H9W A;  4MZK A;  4KEX A;  3PJ7 A;  2OKW A;  3IF7 A;  1RTP 1;  3DQE A;  1SBJ A;  2JAD A;  3ST0 A;  3NSK A;  4DXQ A;  3SV5 A;  4CID A;  2L51 A;  1XSS A;  2EC6 C;  4QJ4 B;  4KGE A;  1TOP A;  2G5Z B;  4MEW A;  2KI4 C;  2PAS A;  4PPK A;  4CPV A;  3AKB A;  3BUM B;  2K7D A;  1SW8 A;  3SJS A;  4DCK A;  1RWY A;  4MZL A;  4W6J A;  3TUY B;  2KQ6 A;  2I7A A;  4I2Y A;  2GV5 A;  1QX5 B;  1KFX S;  3DQJ A;  5CSJ A;  1QJT A;  2MLF C;  2ZN8 A;  3ZUF A;  5HBD A;  1NCX A;  1XYD A;  2YE1 A;  3BXA A;  1LXF C;  1EG4 A;  2L4H A;  3UG0 A;  5FHV A;  2HQK A;  2P6B B;  1REC A;  1DJG A;  1KYS A;  1RMP A;  2PRU A;  2V4E A;  3DPX A;  2BEC A;  2JC2 A;  2V4E B;  2TN4 A;  2JUL A;  1CNP A;  4W7D A;  2ZFD A;  1EMF A;  2KAY A;  3ADF A;  2NCP A;  5TNC A;  1JFK A;  2HQW A;  2NZ0 A;  3TS5 C;  2POX A;  3DQN A;  3KCT A;  1S6J A;  1YVH A;  1XVJ A;  2JXC A;  3CBE A;  5FVF A;  1JC2 A;  4PPJ A;  2A4J A;  4ZBL A;  2QLG A;  4CFR A;  1FPW A;  4QJ3 B;  2QLG B;  1YR5 A;  2BBM A;  3DQO A;  1XK4 A;  1TNP A;  2A52 B;  1W7I B;  2AMI A;  2CT9 A;  2M97 A;  3M0W A;  1OMV A;  2D8N A;  4I5J A;  3KCS A;  4J89 A;  4H3L A;  1YTZ C;  2M49 B;  1G7K A;  5HW9 A;  1EMC A;  2BKI B;  1SRA A;  3BX9 A;  4RYS A;  4YI8 A;  4W7C A;  4KW9 A;  2WND A;  3SVD A;  1MQ1 A;  1LIN A;  5HKW A;  4PPL A;  2H61 C;  3EK7 A;  2COL B;  1M31 A;  5K89 A;  5I8N A;  3EKH A;  1GGZ A;  1G4Y R;  5CSF A;  1NCZ A;  3DQF A;  1AVS A;  4GUK A;  2B1U A;  1KYR A;  1K9K A;  4Q7T A;  1DVI A;  4KF5 C;  5HZS A;  5JJG A;  4OCI A;  4B5Y A;  5AXI A;  5EHU A;  3ZWH A;  3I5H C;  1QVI Z;  4HRG A;  3DQ7 A;  4I5N B;  3DQ9 A;  5EB7 A;  5EXB A;  2LC5 A;  2BE4 A;  1KYP A;  3TUY C;  5F6T A;  1QYO A;  2L98 A;  1ZUZ A;  1NX0 A;  1YHI A;  5DU0 A;  5LTP A;  4IK5 A;  1UHN A;  2BTJ A;  3CD1 A;  4MSP A;  4OJ0 A;  2HQZ A;  2B3Q A;  4W6B A;  2ZO6 A;  1L2O C;  3GB3 A;  2O5G A;  3BXK A;  2L0P A;  1GGX A;  1R6P A;  1NX1 A;  3SVR A;  4GGF C;  1HT9 A;  3K21 A;  1ZMZ A;  1CTR A;  1DJZ A;  2BCB A;  4W6C A;  1YX8 A;  2VZX A;  4P76 A;  3LCP C;  1BOC A;  4W6R A;  1NP8 A;  3TDI A;  2ZMW A;  4JPZ B;  4MVF A;  2LVJ A;  3SVO A;  1SR6 B;  2QRF A;  2JOJ A;  3LK1 A;  3U8C A;  2FCE A;  1XFV O;  5D69 A;  3KEV A;  1SPY A;  2K8M B;  5DY6 A;  1CV7 A;  2LVI A;  4W6A A;  2MHH A;  5HZT A;  1QVI Y;  2BKH B;  1YJF A;  3AAJ A;  1EMK A;  1ZGQ A;  1IWQ A;  3LLE A;  5FVI A;  2G2B A;  1WLM A;  3FWB A;  3VRR A;  2DOQ A;  4XJK A;  4I5K A;  4PE0 A;  5KTY A;  4W7E A;  1RMO A;  1Y1U A;  5J3X A;  1XO5 A;  1PVB A;  1YRT B;  4AQJ A;  1JC1 A;  3CR2 A;  1Q4D A;  4GES B;  1X02 A;  1RMM A;  1QX7 A;  1QLS A;  3GK1 A;  2MLE C;  1XFX O;  3TDZ A;  2DUG A;  4YGD B;  3O77 A;  2KBM A;  1IRJ A;  1ZGP A;  4MLW A;  1PSB A;  1TNX A;  4OGS A;  1F4Q A;  2PSR A;  2L5X B;  1HCJ A;  1BJF A;  1FI6 A;  3DVM A;  3AI5 A;  4EDS A;  3SG4 A;  1UHJ A;  3AKO A;  3PM8 A;  2ZNE A;  2CNP A;  2ZRS A;  4W7R A;  1H4B A;  2DD7 A;  2MBX A;  2MAZ A;  3ZUJ A;  4GNK B;  3BOW A;  5BTT A;  3ED8 A;  3BOW B;  4DIR A;  5BTT B;  5B8I B;  3VHT A;  3VHT B;  1DJW A;  1MF8 B;  1YUR A;  3EVV A;  1QV1 A;  2Q91 A;  3CWG A;  2QZ0 A;  1KFX L;  4W6O A;  3SG5 A;  1Q4B A;  1RRO A;  1K9P A;  2KYC A;  1IH0 A;  4OHS A;  3EVR A;  2V53 A;  3U8P A;  1W7T A;  4M2O A;  2HET A;  2F3Z A;  5CSI A;  4NWS A;  3SG6 A;  4ZIO A;  2A50 B;  5DPJ A;  2FOT A;  4HRH A;  3AI4 A;  1Y1A A;  1XFZ O;  1CFP A;  2P4M A;  4IK8 A;  3SSV A;  1QLK A;  4LJD C;  4LJC A;  2KI4 B;  1A2X A;  1YX7 A;  1BU3 A;  2VVI A;  1QTX A;  3DQ2 A;  3OGO A;  2K7C A;  4DS7 A;  3CGA A;  3OSQ A;  4MBE A;  4ZCV A;  1W7J B;  3BUX B;  2L50 A;  2IB6 A;  4GAO A;  4J88 A;  4USL A;  2EHB A;  1UIS A;  3DQ3 A;  4GOB A;  5LK4 A;  3QRX A;  2IE2 A;  2BL0 B;  4W6N A;  2NXQ A;  3NED A;  3VIC A;  4E68 A;  3WHU B;  2M0R A;  2DUH A;  2LUC A;  2YFP A;  1KCY A;  4ZF3 A;  2KBI A;  2AWK A;  3KO0 A;  1F71 A;  1F4O A;  1CMF A;  2HRS A;  2AUC A;  4DXO A;  1YUT A;  3IQQ A;  1KK8 C;  1SCM B;  5AAN A;  5EJU A;  3PN7 B;  2H5P A;  3EKJ A;  3DPW A;  2KOT A;  3WNX B;  2F33 A;  2O24 A;  1OE9 B;  4UPG A;  2JU0 A;  2BCA A;  2JT0 A;  1XQM A;  3TS5 B;  3EK4 A;  1EH2 A;  4DXI A;  4PCW A;  1FW4 A;  5EBJ A;  4PHK A;  3KF9 A;  5I2Q A;  3PAT A;  1DMO A;  3TZ1 A;  2ARL A;  1JBY A;  4JF9 A;  3IP2 A;  1Y6W A;  5HGE A;  1BF5 A;  2EMO A;  4J8A A;  4YGB B;  4BDU A;  3DQ4 A;  3TDU A;  2FZU A;  1EME A;  3EVP A;  2H5Q A;  1S36 A;  3NEZ A;  5GQQ C;  3DQ1 A;  1YVL A;  4JFG A;  3SG7 A;  5EXU A;  5HZO A;  2AWM A;  2Y4Q A;  1EG3 A;  4KA9 A;  3LK0 A;  5KU1 A;  1QXP A;  5HYD A;  2A48 A;  4N5X A;  3EVU A;  2IB5 A;  4W72 A;  2NCO A;  2M8U A;  3DQU A;  1K90 D;  4GF6 B;  4KF5 A;  5DTL A;  1H8B A;  1B8R A;  2ISD A;  2ZMU A;  3D0Y A;  1XFW O;  3I5H B;  2OTB A;  3TMR A;  2KFF A;  2MA2 A;  4ZFS A;  2JT8 A;  5DTY A;  1AK8 A;  4YI9 A;  3E5V A;  3CLN A;  1IG5 A;  3GL4 A;  4DXM A;  2Y1M A;  1WY9 A;  2LM5 A;  2BL0 C;  3LS3 A;  1AHR A;  1L2O B;  4EMQ A;  1A03 A;  3F45 A;  2BBN A;  4W6G A;  4ZF5 A;  1KFU S;  2OTG B;  1EJ3 A;  1PAL A;  4RTC A;  4W74 A;  3I5F C;  4OY4 A;  2EMN A;  1WRL A;  4DXP A;  4GGF A;  1SCM C;  2JNX A;  1L7Z A;  3PN7 C;  4DXN A;  1UWO A;  3DQD A;  3WCK A;  4LJB A;  2WHS A;  2M7L A;  2C9I A;  1JBA A;  4KAG A;  1FBV A;  2JT3 A;  1Q4C A;  1UUS A;  2PVB A;  1XFU O;  2K7O A;  1A75 A;  4FTG A;  1BG1 A;  1Q80 A;  4R1E A;  4P2Y B;  1OOJ A;  2G3D B;  4JWQ A;  2KFG A;  4PHN A;  4W6T A;  2C9J A;  2HGD A;  5ER4 X;  2Q6P A;  2GGZ A;  2F3Y A;  1YRU B;  5H88 A;  1CLB A;  1K94 A;  4I5L B;  4HQ8 A;  2LVK A;  1NPQ A;  1NX2 A;  2KAX A;  2JRF A;  2Y5I A;  1W7S A;  2JXL A;  3MSE B;  1YUS A;  3WHT B;  2CCM A;  2LMU A;  1QY3 A;  5AER A;  2A53 B;  3CR4 X;  4M2Q A;  4IK9 A;  1GL4 A;  1KSM A;  4W75 A;  1CM4 A;  4H3N A;  3SG2 A;  4OR9 B;  5HLO A;  2H6V A;  2H5O A;  3SST A;  2Y0G A;  3MGF A;  2YDZ A;  1PUL A;  1PVA A;  1R2U A;  1WRK A;  4ORN A;  4PAL A;  2I18 A;  1NIW A;  1DF0 A;  1MOV A;  1LKJ A;  1DF0 B;  2K0J A;  1Z1Q A;  1N65 A;  4WRI A;  1K95 A;  1E8A A;  4XYN A;  5G08 A;  4ORC B;  2GGM A;  3VRQ A;  1MXL C;  3CR5 X;  2RGI A;  1EML A;  1RM9 A;  3OHM B;  2VVH A;  2M1U A;  2NLN A;  2CBL A;  2M9G A;  3LSA A;  2BE6 A;  2LHL A;  4EUL A;  2Z6Z A;  2E6W A;  4C0K A;  2OTG C;  2F8P A;  5CSN A;  1QAS A;  2KNE A;  2LUX A;  3CFA A;  1BR4 B;  4MRX A;  1K96 A;  2G9B A;  3PLF B;  1Q73 A;  1QYQ A;  4IZN A;  2QLE A;  4JRB A;  3DF0 A;  3AKA A;  5ER5 A;  3LF3 A;  1WDC B;  4LJD A;  1ZUX A;  2FJU B;  2QAC A;  1SKT A;  1EL4 A;  3VRN A;  3OB1 B;  4JGE A;  1RRX A;  1IJ6 A;  3KPX A;  4OQW A;  1CM1 A;  1TCO B;  1CLM A;  3SS0 A;  4IK1 A;  2JZI A;  2H2K A;  2WCF A;  2BCX A;  3DVJ A;  2ZRT A;  3JVT B;  2A47 A;  2ZO7 A;  1JUO A;  2HQ8 A;  1GGW A;  2H5R A;  3SVS A;  2F2O A;  3IR8 A;  4U8D A;  4XJK B;  1HUY A;  5DTX A;  1NX3 A;  5EXC I;  2I94 A;  3ICB A;  1YJ2 A;  1G33 A;  4WQ3 A;  2LVV A;  5DQB A;  3E5W A;  3NXA A;  4ORA B;  1KK8 B;  4PFE A;  4Z4M A;  1OZO A;  2LAP A;  3LVD A;  3ZTF A;  1TRF A;  5EB6 A;  2OKY A;  4ORB B;  1TNQ A;  2QT2 A;  1OQP A;  3SIB A;  5BQL A;  4N3D A;  2LMT A;  5HKZ A;  2A54 B;  4EN1 A;  4GGN A;  2G2S B;  2EMD A;  4W6K A;  1F55 A;  3TMT A;  2LLU A;  3EK8 A;  1ZAC A;  4OKH A;  4N1G A;  4W6D A;  2QPT A;  3FS7 A;  4NDC A;  3DQ8 A;  5DPH A;  3U8A A;  3VK1 A;  5CPV A;  1C4F A;  1RFJ A;  1MR8 A;  2ICR A;  1BOD A;  5LTQ A;  3CGL A;  1TCF A;  1AP4 A;  1JBZ A;  3S05 A;  1CFC A;  1KQV A;  1IQ5 A;  2AWL A;  1G8I A;  1CDN A;  5I2L A;  3JTD C;  2DDD A;  1B7T Z;  2I2R E;  2H8Q A;  4AS8 A;  3NT3 A;  2WUR A;  4YGE B;  4PE1 A;  3BXC A;  3GEX A;  2EGD A;  3AAK A;  1KQM C;  4W73 A;  3LA1 A;  4DKM A;  2KSP A;  4Q9W A;  2PXW A;  1WDC C;  1SNL A;  4MZJ A;  1QV0 A;  1OXD A;  1YHG A;  1FI5 A;  1B9A A;  4GPL B;  1CMG A;  2G6Y A;  3WLC A;  1EMA A;  2ZN9 A;  2DDC A;  1UHK A;  2OGR A;  1IKU A;  5LTR A;  4H47 A;  1S5G Z;  3JVT C;  1XA5 A;  2G6X A;  1J7O A;  2LE9 B;  4OV2 A;  3ST2 A;  5FYX A;  1DTL A;  5DKN A;  1YZW A;  4ANJ A;  2LNK A;  3SSY A;  2JQ6 A;  2Y1N A;  5KTG A;  4PE7 A;  1MOU A;  1SL9 A;  1JC0 A;  3OP0 A;  2AAO A;  3U0M A;  3DQI A;  2ZND A;  4HVF A;  3I5F B;  1B7T Y;  2LMV A;  4L12 A;  1DT7 B;  2OTE A;  4F0Z B;  3U0L A;  3LL8 B;  1HQV A;  4W7F A;  1ALW A;  3SG3 A;  1DJH A;  2FCD A;  1CFD A;  3DVE A;  3ST3 A;  1B8L A;  5DKQ A;  1EMG A;  4H48 A;  2OJK A;  1K9U A;  3CD9 A;  1OMR A;  3OX5 A;  1LA0 A;  5F9G A;  5DPG A;  3OB2 B;  2WIQ A;  4ZB1 A;  3NT9 A;  1ALV A;  1S5G Y;  1Y1X A;  1V1F A;  2GW4 B;  4TZG A;  4KF4 A;  3BXB A;  2HGY A;  4XGY A;  1CDM A;  4D1E A;  2LP3 A;  4JC2 A;  4P1Q A;  1H6R A;  2QLH A;  1C7V A;  4UTS A;  3H1R A;  1S3P A;  3NSI A;  2AHA A;  1GQM A;  1IJ5 A;  2HPS A;  4FQO A;  3C1V A;  2G3O A;  3SSP A;  2PMY A;  1EXR A;  1MXE A;  3PJB A;  4XOW A;  2AWJ A;  1TN4 A;  2KDH A;  3U0K A;  2GX2 A;  4BY5 A;  3PIB A;  2LV7 A;  2JPT A;  4LQT A;  2WC8 A;  4HE4 A;  3H4S E;  1YUU A;  1V1G A;  3O6B A;  1B1G A;  2MRD A;  2B3P A;  1JSA A;  3LVA A;  4DUQ A;  3E5T A;  1NCY A;  1LVC D;  3D0Y B;  2KI6 D;  5H87 A;  2CXJ A;  5BPJ A;  5D7F A;  1AJ4 A;  3ST4 A;  2K7B A;  1BT6 A;  1DJI A;  1PSR A;  1B9C A;  4PDZ A; 
#chains in the Genus database with same CATH topology
 3SVU A;  2KHN A;  1VRK A;  1PK0 D;  4KPI A;  4W76 A;  1M63 B;  3SVN A;  4ZF4 A;  4AQI A;  3WLD A;  1OXE A;  1F8H A;  2HF5 A;  4HSZ A;  1WLZ A;  3I5G C;  1OXF A;  4ICB A;  1NWD A;  1OMD A;  4DRW A;  1JFJ A;  3M22 A;  1Q4E A;  1KK7 Z;  2GW3 A;  4KGF A;  3G9A A;  4Q9X A;  1N0Y A;  1CFF A;  2O60 A;  3I5I C;  4ETO A;  2Q4U A;  1DGU A;  4RYW A;  3CZT X;  3DPZ A;  1SCV A;  2LAN A;  3Q8I A;  1S26 D;  2M29 A;  2G6E A;  1A4P A;  4YBH B;  2SAS A;  1UP5 A;  1M46 A;  4PE4 A;  2WCE A;  1M39 A;  2LHI A;  2M7N A;  3GK4 X;  2LLT A;  3FWC A;  3OX6 A;  4NQG A;  1J1D A;  2VVJ A;  3OGN A;  1A75 B;  1A29 A;  3CTN A;  1NUB A;  4W7X A;  2SCP A;  1TTX A;  2IOV A;  5AEQ A;  3ZNI A;  4W6M A;  3M24 A;  1F0B A;  3P8U A;  2JTZ A;  3IQO A;  2KFH A;  3GK2 A;  3DQA A;  5DRG A;  4L13 A;  3PSR A;  2YE0 A;  1ORG A;  2KGB C;  4Z4K A;  1IGV A;  1KK7 Y;  5H89 A;  4R6B A;  1K93 D;  4EDO A;  3GJ2 A;  4W6U A;  4YRU A;  5DTZ A;  1J7R A;  4ZCU A;  4MN0 A;  4AOM A;  3BUN B;  4GFT A;  3NSL A;  4R6D A;  4INX A;  1TWO A;  2QDI A;  2KYF A;  1SY9 A;  2FL1 A;  2Z6X A;  2JWW A;  1DJY A;  3OSR A;  4IK4 A;  4U2V A;  1F70 A;  1YFP A;  2IS9 A;  2JPO A;  5I94 A;  1KWO B;  2WSO A;  2FWQ A;  4YGC B;  4W6S A;  1C07 A;  1QIW A;  4XVP A;  2WCL A;  2WHU A;  4HRE E;  2Q57 A;  5DQM A;  3O4Y A;  3DVK A;  4ZIN A;  2VRG A;  2WOS A;  3D78 A;  2KI6 C;  1MHO A;  2KGR A;  4W69 A;  3LVC A;  3FIA A;  4LQU A;  3N7H A;  1J7Q A;  3NF0 A;  3JTD B;  5IBW A;  2MJW B;  2HFC A;  2LP2 A;  4C0L A;  1BLQ A;  1QIV A;  5AFP A;  1C7W A;  3HCM A;  4KW4 A;  1BR1 B;  1KQM B;  2ERB A;  2DUF A;  1Z1P A;  3ZUL A;  3O2P A;  2HJO A;  2WIS A;  4W6L A;  1CLL A;  1T14 A;  3DF0 B;  1PRW A;  2V4E C;  3CFH A;  3SS3 A;  4MRY A;  1SMG A;  3DD4 A;  3BUW B;  1EMM A;  3RWA A;  1UHH A;  4L9M A;  3VB1 A;  3BYA A;  1BMO A;  2CTN A;  2L4I A;  1QYF A;  1OSA A;  2LLS A;  3SSH A;  5HLV A;  1QAT A;  1ZFS A;  4PHJ A;  1ZOT B;  3I19 A;  2Z6Y A;  1UHI A;  2GX0 A;  3R1O A;  1S6I A;  2QU1 A;  5DPI A;  1SK6 D;  1XK4 C;  2FJY A;  4LW5 A;  2F2P A;  2VAE A;  2VAD A;  4P5O E;  1J1E A;  1K8U A;  1D1O A;  4KW8 A;  3OBV A;  2ZKM X;  3SVE A;  4CLN A;  1U5I A;  1KSO A;  5DKR A;  2PXS A;  1U5I B;  1KP5 A;  1M45 A;  3DQ6 A;  4L1I A;  3PJ5 A;  1JF0 A;  2WSN A;  3SIA A;  3VRP A;  1JF2 A;  3DQM A;  3VGO A;  1RK9 A;  4TNC A;  1OOG A;  1UUR A;  1J7P A;  2OPO A;  5T3I A;  3V3D A;  3B86 A;  2K2A A;  3E3R A;  1CDP A;  2A56 B;  4N1F A;  3VRO A;  2G16 B;  1GFL A;  4YGA A;  4W7A A;  3W1C A;  1AUI B;  1KWO C;  3CB9 A;  4HQ9 A;  2WOR A;  1S6C A;  4Q7R A;  2OS8 B;  3H1O A;  5DRF A;  4DKN A;  3U0N A;  1RJV A;  1DJX A;  1XFR A;  1OZS A;  3UFZ A;  3P28 A;  2QEH A;  3DXL A;  3CZ0 A;  4W6I A;  3SSL A;  4XL5 A;  4Q04 A;  3WXA A;  3A4U B;  3DYE A;  1EMB A;  1KFU L;  4A4C A;  3KHE A;  1ODB A;  1XFY O;  4PHM A;  2WCB A;  2A46 A;  4PT1 A;  3CFF A;  1NSH A;  3PFV A;  1CDL A;  2HCG A;  5FVG A;  1MWN A;  5BT0 A;  3DQL A;  5I2O A;  1CKK A;  2K2F A;  4XOV A;  3GOF A;  4W6F A;  2JNF A;  3IVT A;  1TIZ A;  1J55 A;  2DUI A;  2DUE A;  2R2I A;  2KQY A;  1QX2 A;  1TNW A;  5HKY A;  1QXT A;  1B8C A;  1NYA A;  4QJ5 B;  4W77 A;  2M1K B;  1DGV A;  1DEL A;  2QLI A;  4W6P A;  1MUX A;  4TZA A;  1SYM A;  3NSO A;  2EC6 B;  1SR6 C;  3DQC A;  2WCM A;  3RWT A;  1F09 A;  4B30 A;  3UNW A;  4CFQ A;  4B30 B;  1IQ3 A;  4NDD A;  1YHH A;  1AJ5 A;  3BUO B;  3CS1 A;  3BFB A;  4OVN F;  1W7U A;  2LCP A;  1FF1 A;  4C0J A;  1QWV A;  1CB1 A;  3LF4 B;  2AH8 A;  3I5G B;  4JQ0 D;  1BFP A;  1QS7 A;  3V2L A;  4M2P A;  4A4B A;  1XAE A;  2PAL A;  3I5I B;  1XA9 A;  5FI7 A;  3A8S A;  1B47 A;  1LA3 A;  4W6H A;  1H4U A;  3DQH A;  1SL8 A;  5KSZ A;  4AR7 A;  3K1K A;  3CAB A;  2Z1O A;  3PAL A;  1GJY A;  5J2O A;  2O2B A;  2QEV A;  4IL1 A;  3W1D A;  2KLD A;  1S6Z A;  5HZU A;  3DQK A;  3HX4 A;  3SRY A;  2OS8 C;  2E30 A;  2O29 A;  1JWD A;  1S1E A;  2K61 A;  3NHI A;  2BNX A;  1F54 A;  2M3W A;  1XMZ A;  4HQC A;  5PAL A;  2HPW A;  2WHT A;  3SS5 A;  1B4C A;  3O78 A;  4GBA A;  1OW4 A;  1SL7 A;  1ZGO A;  3SSK A;  2JTT A;  3DQ5 A;  3RLZ A;  2KAV A;  2P70 A;  3L4L A;  3A8R A;  1N2D A;  3D10 A;  1K2H A;  2DD9 A;  4NDB A;  4IK3 A;  3SVB A;  3SVC A;  4BY4 A;  4JEO A;  2RH7 A;  1Q4A A;  4WQ2 A;  4H3M A;  4Q7U A;  1WRZ A;  3BQ3 A;  1Y0V H;  3RM1 A;  3GJ1 A;  5AQB B;  2L2E A;  2H61 A;  1MYW A;  5JOL A;  2H9W A;  4MZK A;  4KEX A;  3PJ7 A;  2OKW A;  3IF7 A;  1RTP 1;  3CZ2 A;  1OOH A;  2BAP A;  3DQE A;  1SBJ A;  2JAD A;  3ST0 A;  3BFH A;  3NSK A;  4DXQ A;  3SV5 A;  4CID A;  2L51 A;  1XSS A;  2EC6 C;  4QJ4 B;  4KGE A;  1TOP A;  2G5Z B;  4MEW A;  3L47 A;  2KI4 C;  2PAS A;  4PPK A;  4CPV A;  3AKB A;  3BUM B;  2K7D A;  1SW8 A;  3SJS A;  4DCK A;  1RWY A;  4MZL A;  3CYZ A;  4W6J A;  3TUY B;  2KQ6 A;  2I7A A;  4I2Y A;  2GV5 A;  2WC6 A;  1QX5 B;  1KFX S;  3DQJ A;  5CSJ A;  2KPH A;  1QJT A;  2MLF C;  2ZN8 A;  3ZUF A;  5HBD A;  1NCX A;  1XYD A;  2YE1 A;  3S0F A;  3BXA A;  1LXF C;  1EG4 A;  2L4H A;  3UG0 A;  5FHV A;  2HQK A;  2P6B B;  1REC A;  1DJG A;  1KYS A;  1RMP A;  2PRU A;  5FI2 A;  2V4E A;  3DPX A;  2BEC A;  2JC2 A;  4FQT A;  2V4E B;  2TN4 A;  2JUL A;  1CNP A;  4W7D A;  2ZFD A;  1EMF A;  2KAY A;  3ADF A;  2PQL A;  2NCP A;  5TNC A;  1JFK A;  3FE8 A;  2HQW A;  2NZ0 A;  3TS5 C;  2POX A;  3DQN A;  3KCT A;  1S6J A;  1YVH A;  1XVJ A;  2JXC A;  3CBE A;  5FVF A;  1JC2 A;  4PPJ A;  2A4J A;  4ZBL A;  2QLG A;  4CFR A;  1FPW A;  4QJ3 B;  2QLG B;  1YR5 A;  2BBM A;  3DQO A;  1XK4 A;  1TNP A;  2A52 B;  1W7I B;  2AMI A;  2CT9 A;  2M97 A;  3M0W A;  1OMV A;  2D8N A;  4I5J A;  3KCS A;  4J89 A;  4H3L A;  1YTZ C;  2M49 B;  3RZS A;  1G7K A;  5HW9 A;  1EMC A;  2BKI B;  1SRA A;  3BX9 A;  4RYS A;  4YI8 A;  4W7C A;  4KW9 A;  2WND A;  3SVD A;  1MQ1 A;  1LIN A;  5HKW A;  4PPL A;  2H61 C;  3EK7 A;  2COL B;  1M31 A;  5K89 A;  5I8N A;  3EKH A;  1GGZ A;  1G4Y R;  3BJH A;  1NCZ A;  5CSF A;  3DQF A;  1AVS A;  4GUK A;  2B1U A;  1KYR A;  1K9K A;  4Q7T A;  1DVI A;  4KF5 C;  5HZS A;  5JJG A;  4OCI A;  4B5Y A;  5AXI A;  5EHU A;  3ZWH A;  3I5H C;  1QVI Z;  4HRG A;  3DQ7 A;  4I5N B;  3DQ9 A;  5EB7 A;  5EXB A;  2LC5 A;  2BE4 A;  1KYP A;  3TUY C;  5F6T A;  1QYO A;  2L98 A;  1ZUZ A;  1NX0 A;  1YHI A;  1DQE A;  5DU0 A;  5LTP A;  4IK5 A;  1UHN A;  2BTJ A;  3CD1 A;  4MSP A;  4OJ0 A;  2WCH A;  2HQZ A;  2B3Q A;  4W6B A;  2ZO6 A;  1L2O C;  3S0D A;  3GB3 A;  2O5G A;  3BXK A;  2L0P A;  1GGX A;  3S0G A;  1R6P A;  1NX1 A;  3SVR A;  4GGF C;  1HT9 A;  3K21 A;  1ZMZ A;  1CTR A;  1DJZ A;  2BCB A;  4W6C A;  1YX8 A;  2VZX A;  4P76 A;  3LCP C;  1BOC A;  4W6R A;  1NP8 A;  3TDI A;  2ZMW A;  4JPZ B;  4MVF A;  2LVJ A;  3SVO A;  1SR6 B;  2QRF A;  2JOJ A;  3LK1 A;  1LS8 A;  3U8C A;  2FCE A;  1XFV O;  5D69 A;  3KEV A;  1SPY A;  2K8M B;  5DY6 A;  1CV7 A;  3CDN A;  2LVI A;  4W6A A;  2MHH A;  5HZT A;  1QVI Y;  1TUZ A;  2BKH B;  1YJF A;  3AAJ A;  1EMK A;  1ZGQ A;  1IWQ A;  3LLE A;  5FVI A;  2G2B A;  1WLM A;  3FWB A;  3VRR A;  2DOQ A;  4XJK A;  4I5K A;  4PE0 A;  5KTY A;  4W7E A;  1RMO A;  1Y1U A;  5J3X A;  1XO5 A;  1PVB A;  1YRT B;  4AQJ A;  1JC1 A;  3CR2 A;  1Q4D A;  4GES B;  1X02 A;  1RMM A;  5DIC A;  1QX7 A;  1QLS A;  3GK1 A;  2MLE C;  1XFX O;  3TDZ A;  2DUG A;  4YGD B;  3O77 A;  3D74 A;  2KBM A;  1IRJ A;  1ZGP A;  4MLW A;  1PSB A;  1TNX A;  4OGS A;  1F4Q A;  2PSR A;  2L5X B;  1HCJ A;  1BJF A;  1FI6 A;  3DVM A;  3AI5 A;  4EDS A;  3SG4 A;  1UHJ A;  3AKO A;  3PM8 A;  2ZNE A;  2CNP A;  2ZRS A;  4W7R A;  1H4B A;  2DD7 A;  2MBX A;  2MAZ A;  3ZUJ A;  4GNK B;  3BOW A;  3B88 A;  5BTT A;  3ED8 A;  3BOW B;  4DIR A;  5BTT B;  5B8I B;  3VHT A;  3VHT B;  1DJW A;  1MF8 B;  1YUR A;  3EVV A;  1QV1 A;  2Q91 A;  3CWG A;  2QZ0 A;  1KFX L;  4W6O A;  3SG5 A;  1Q4B A;  1RRO A;  1K9P A;  2KYC A;  1IH0 A;  4OHS A;  3EVR A;  2V53 A;  3U8P A;  3R1V A;  1W7T A;  4M2O A;  2HET A;  2F3Z A;  5CSI A;  4NWS A;  3SG6 A;  4ZIO A;  2A50 B;  5DPJ A;  2FOT A;  4HRH A;  3AI4 A;  1Y1A A;  1XFZ O;  1CFP A;  2P4M A;  4IK8 A;  3SSV A;  1DEK A;  1QLK A;  4LJD C;  4LJC A;  2KI4 B;  1A2X A;  1YX7 A;  1BU3 A;  2VVI A;  1QTX A;  3DQ2 A;  3OGO A;  2K7C A;  4DS7 A;  3CGA A;  3OSQ A;  4MBE A;  4ZCV A;  1W7J B;  3BUX B;  2L50 A;  2IB6 A;  4GAO A;  4J88 A;  4USL A;  2EHB A;  1UIS A;  3DQ3 A;  4GOB A;  5LK4 A;  3QRX A;  2IE2 A;  2BL0 B;  4W6N A;  2NXQ A;  3NED A;  3VIC A;  4E68 A;  3WHU B;  2M0R A;  2DUH A;  2LUC A;  2YFP A;  1KCY A;  4ZF3 A;  2KBI A;  2AWK A;  3KO0 A;  1F71 A;  1F4O A;  1CMF A;  2HRS A;  2AUC A;  3S0B A;  4DXO A;  1YUT A;  5HL1 A;  3IQQ A;  4INW A;  1KK8 C;  1SCM B;  4JKT A;  5AAN A;  5EJU A;  3PN7 B;  2H5P A;  3EKJ A;  3DPW A;  2KOT A;  3WNX B;  2F33 A;  2O24 A;  1OE9 B;  4UPG A;  2JU0 A;  2YGU A;  2BCA A;  2JT0 A;  1XQM A;  3TS5 B;  3EK4 A;  3BFA A;  1EH2 A;  4DXI A;  4PCW A;  1FW4 A;  5EBJ A;  4PHK A;  3KF9 A;  5I2Q A;  3PAT A;  1DMO A;  3TZ1 A;  2ARL A;  1JBY A;  4JF9 A;  2WCK A;  3IP2 A;  1Y6W A;  5HGE A;  1BF5 A;  2EMO A;  4J8A A;  4YGB B;  4BDU A;  3DQ4 A;  3TDU A;  2FZU A;  1EME A;  3EVP A;  2P71 A;  2H5Q A;  1S36 A;  3NEZ A;  3B87 A;  5GQQ C;  3DQ1 A;  1YVL A;  5EL2 A;  3SG7 A;  4JFG A;  5EXU A;  5HZO A;  2AWM A;  2Y4Q A;  1EG3 A;  4KA9 A;  3D73 A;  3LK0 A;  5KU1 A;  3QME A;  1QXP A;  5HYD A;  2A48 A;  4N5X A;  3EVU A;  2IB5 A;  4W72 A;  2NCO A;  2M8U A;  3S0E A;  3DQU A;  1K90 D;  4GF6 B;  4KF5 A;  5DTL A;  1H8B A;  1B8R A;  2ISD A;  2ZMU A;  3D0Y A;  1XFW O;  3I5H B;  2OTB A;  3TMR A;  4KYN A;  2KFF A;  2MA2 A;  4ZFS A;  2JT8 A;  5DTY A;  1AK8 A;  4YI9 A;  1OOI X;  3E5V A;  3CLN A;  1IG5 A;  3GL4 A;  4DXM A;  2Y1M A;  1WY9 A;  2LM5 A;  2BL0 C;  4OZD A;  3LS3 A;  1AHR A;  1L2O B;  4EMQ A;  1A03 A;  3F45 A;  2BBN A;  4W6G A;  4ZF5 A;  1KFU S;  2OTG B;  1EJ3 A;  1PAL A;  4RTC A;  4W74 A;  3I5F C;  4OY4 A;  2EMN A;  1WRL A;  4DXP A;  4GGF A;  1SCM C;  2JNX A;  1L7Z A;  3PN7 C;  4DXN A;  2PYQ A;  1UWO A;  3DQD A;  3WCK A;  4LJB A;  2WHS A;  2M7L A;  2C9I A;  1JBA A;  4KAG A;  1FBV A;  2JT3 A;  1Q4C A;  1UUS A;  2PVB A;  1XFU O;  2K7O A;  1A75 A;  4FTG A;  1BG1 A;  1Q80 A;  4R1E A;  4P2Y B;  1OOJ A;  2G3D B;  4JWQ A;  2KFG A;  4PHN A;  4W6T A;  2C9J A;  2HGD A;  5ER4 X;  2Q6P A;  2GGZ A;  2KLE A;  3EG5 B;  2F3Y A;  1YRU B;  5H88 A;  1CLB A;  1K94 A;  1SSE B;  4I5L B;  4HQ8 A;  2LVK A;  1NPQ A;  1NX2 A;  1IIO A;  2KAX A;  2JRF A;  2Y5I A;  1W7S A;  2JXL A;  3MSE B;  5FI6 A;  1YUS A;  2WC5 A;  3WHT B;  2CCM A;  2LMU A;  1QY3 A;  5AER A;  2A53 B;  3CR4 X;  3L4A A;  4M2Q A;  4IK9 A;  1GL4 A;  1KSM A;  1CM4 A;  4W75 A;  4H3N A;  3SG2 A;  4OR9 B;  5HLO A;  2H6V A;  2H5O A;  3SST A;  3O4X A;  2Y0G A;  3MGF A;  3DY9 A;  2YDZ A;  1PUL A;  1PVA A;  1R2U A;  1WRK A;  4ORN A;  4PAL A;  2I18 A;  1NIW A;  1DF0 A;  1MOV A;  1LKJ A;  1DF0 B;  2K0J A;  1Z1Q A;  1N65 A;  4WRI A;  3NHT A;  1K95 A;  1E8A A;  4XYN A;  5G08 A;  4ORC B;  2GGM A;  3VRQ A;  1MXL C;  3CR5 X;  2RGI A;  1EML A;  1RM9 A;  3OHM B;  2VVH A;  2M1U A;  2NLN A;  2QEO A;  3NGV A;  2CBL A;  2M9G A;  3LSA A;  2BE6 A;  2LHL A;  4EUL A;  2Z6Z A;  2E6W A;  4C0K A;  2OTG C;  2F8P A;  5CSN A;  1QAS A;  2KNE A;  2LUX A;  3CFA A;  1BR4 B;  2WCJ A;  5D3O A;  1C3Z A;  4MRX A;  1K96 A;  2G9B A;  3PLF B;  1Q73 A;  1QYQ A;  4IZN A;  2QLE A;  4JRB A;  3DF0 A;  3AKA A;  5ER5 A;  3LF3 A;  1WDC B;  3D75 A;  4LJD A;  1ZUX A;  2FJU B;  2QAC A;  1SKT A;  1EL4 A;  3VRN A;  3OB1 B;  4JGE A;  1RRX A;  3K1E A;  1IJ6 A;  3KPX A;  4OQW A;  1CM1 A;  1TCO B;  1CLM A;  3SS0 A;  4IK1 A;  2JZI A;  2H2K A;  2WCF A;  2BCX A;  2QEB A;  3DVJ A;  2ZRT A;  3JVT B;  2A47 A;  2ZO7 A;  1JUO A;  2HQ8 A;  1GGW A;  3S0A A;  4IJ7 A;  2H5R A;  3SVS A;  2F2O A;  3IR8 A;  4U8D A;  4XJK B;  1HUY A;  5DTX A;  1NX3 A;  5EXC I;  2I94 A;  3ICB A;  1TUJ A;  1YJ2 A;  1G33 A;  4WQ3 A;  2LVV A;  5DQB A;  3E5W A;  3NXA A;  4ORA B;  1KK8 B;  4PFE A;  4Z4M A;  1OZO A;  2LAP A;  3LVD A;  3ZTF A;  1TRF A;  5EB6 A;  2OKY A;  4ORB B;  1TNQ A;  2QT2 A;  1OQP A;  3SIB A;  5BQL A;  4N3D A;  2LMT A;  5HKZ A;  2A54 B;  4EN1 A;  4GGN A;  2G2S B;  2EMD A;  4W6K A;  1F55 A;  3TMT A;  2LLU A;  3EK8 A;  1ZAC A;  4OKH A;  4N1G A;  4W6D A;  2QPT A;  3FS7 A;  4NDC A;  3DQ8 A;  5DPH A;  3U8A A;  3VK1 A;  5CPV A;  1GM0 A;  1C4F A;  1RFJ A;  1MR8 A;  2ICR A;  1BOD A;  3CZ1 A;  5LTQ A;  3PJI A;  3CGL A;  1TCF A;  1AP4 A;  1JBZ A;  3S05 A;  1CFC A;  1KQV A;  1IQ5 A;  2AWL A;  1G8I A;  1CDN A;  3D76 A;  5I2L A;  3FE6 A;  3JTD C;  2DDD A;  1B7T Z;  2I2R E;  2H8Q A;  4AS8 A;  3NT3 A;  1C3Y A;  2WUR A;  4YGE B;  4PE1 A;  3BXC A;  3B7A A;  3D77 A;  3GEX A;  2EGD A;  3AAK A;  1KQM C;  4W73 A;  3LA1 A;  4DKM A;  2KSP A;  4Q9W A;  2PXW A;  1WDC C;  3DZT A;  1SNL A;  4MZJ A;  1QV0 A;  1OXD A;  4JD9 A;  1YHG A;  1FI5 A;  1B9A A;  4GPL B;  1CMG A;  2G6Y A;  3WLC A;  1EMA A;  2ZN9 A;  2DDC A;  1UHK A;  2OGR A;  1IKU A;  5LTR A;  4H47 A;  1S5G Z;  3JVT C;  1XA5 A;  2G6X A;  1J7O A;  2LE9 B;  4OV2 A;  3ST2 A;  5FYX A;  1DTL A;  1Z4H A;  5DKN A;  1YZW A;  4ANJ A;  2LNK A;  3SSY A;  2JQ6 A;  2Y1N A;  5KTG A;  4PE7 A;  1MOU A;  3SS4 A;  1SL9 A;  1JC0 A;  3OP0 A;  2AAO A;  3U0M A;  3DQI A;  2ZND A;  4HVF A;  3I5F B;  1B7T Y;  2LMV A;  4L12 A;  1DT7 B;  2OTE A;  4F0Z B;  3U0L A;  3LL8 B;  1HQV A;  4W7F A;  1ALW A;  3SG3 A;  1DJH A;  2FCD A;  1CFD A;  3DVE A;  3ST3 A;  1B8L A;  2GTE A;  5DKQ A;  4F7F A;  1EMG A;  4H48 A;  2OJK A;  1K9U A;  3CD9 A;  1OMR A;  3OX5 A;  1LA0 A;  5F9G A;  5DPG A;  3OB2 B;  2WIQ A;  4ZB1 A;  2H8V A;  3NT9 A;  3R1P A;  1ALV A;  1S5G Y;  1Y1X A;  1V1F A;  3UO9 A;  2GW4 B;  4TZG A;  4KF4 A;  3BXB A;  2HGY A;  4XGY A;  1CDM A;  4D1E A;  1W9Z A;  2LP3 A;  4JC2 A;  4P1Q A;  2K60 A;  1H6R A;  2QLH A;  2L2C A;  1C7V A;  4UTS A;  3H1R A;  1OOF A;  1S3P A;  3NSI A;  2AHA A;  1GQM A;  1IJ5 A;  2HPS A;  4FQO A;  3C1V A;  2G3O A;  3SSP A;  3R72 A;  2PMY A;  1DC1 A;  1EXR A;  1MXE A;  3PJB A;  4XOW A;  2AWJ A;  1TN4 A;  2KDH A;  3U0K A;  2GX2 A;  4BY5 A;  3PIB A;  1P28 A;  2LV7 A;  2JPT A;  4LQT A;  2WC8 A;  4HE4 A;  3H4S E;  1YUU A;  1V1G A;  3PM2 A;  3O6B A;  1B1G A;  2MRD A;  2B3P A;  1JSA A;  3LVA A;  4DUQ A;  3B6X A;  3E5T A;  3FE9 A;  1NCY A;  1LVC D;  3D0Y B;  2KI6 D;  5H87 A;  1Z2C B;  2CXJ A;  5BPJ A;  5D7F A;  1AJ4 A;  3ST4 A;  2K7B A;  1BT6 A;  1DJI A;  1PSR A;  2L5Y A;  1B9C A;  4PDZ A; 
#chains in the Genus database with same CATH homology
 3SVU A;  2KHN A;  1VRK A;  1PK0 D;  4KPI A;  4W76 A;  1M63 B;  3SVN A;  4ZF4 A;  4AQI A;  3WLD A;  1OXE A;  1F8H A;  2HF5 A;  4HSZ A;  1WLZ A;  3I5G C;  1OXF A;  4ICB A;  1NWD A;  1OMD A;  4DRW A;  1JFJ A;  3M22 A;  1Q4E A;  1KK7 Z;  2GW3 A;  4KGF A;  3G9A A;  4Q9X A;  1N0Y A;  1CFF A;  2O60 A;  3I5I C;  4ETO A;  2Q4U A;  1DGU A;  4RYW A;  3CZT X;  3DPZ A;  1SCV A;  2LAN A;  1S26 D;  2M29 A;  2G6E A;  1A4P A;  4YBH B;  2SAS A;  1UP5 A;  1M46 A;  4PE4 A;  2WCE A;  1M39 A;  2LHI A;  2M7N A;  3GK4 X;  2LLT A;  3FWC A;  3OX6 A;  4NQG A;  1J1D A;  2VVJ A;  1A75 B;  1A29 A;  3CTN A;  1NUB A;  4W7X A;  2SCP A;  1TTX A;  2IOV A;  5AEQ A;  3ZNI A;  4W6M A;  3M24 A;  1F0B A;  3P8U A;  2JTZ A;  3IQO A;  2KFH A;  3GK2 A;  3DQA A;  5DRG A;  4L13 A;  3PSR A;  2YE0 A;  2KGB C;  4Z4K A;  1IGV A;  1KK7 Y;  5H89 A;  4R6B A;  1K93 D;  4EDO A;  3GJ2 A;  4W6U A;  4YRU A;  5DTZ A;  1J7R A;  4ZCU A;  4MN0 A;  4AOM A;  3BUN B;  4GFT A;  3NSL A;  4R6D A;  2KYF A;  1SY9 A;  2FL1 A;  2Z6X A;  2JWW A;  1DJY A;  3OSR A;  4IK4 A;  4U2V A;  1F70 A;  1YFP A;  2IS9 A;  1KWO B;  2WSO A;  2FWQ A;  4YGC B;  4W6S A;  1C07 A;  1QIW A;  4XVP A;  2WHU A;  4HRE E;  2Q57 A;  5DQM A;  3O4Y A;  3DVK A;  4ZIN A;  2VRG A;  2WOS A;  2KI6 C;  1MHO A;  2KGR A;  4W69 A;  3LVC A;  3FIA A;  4LQU A;  1J7Q A;  3NF0 A;  3JTD B;  5IBW A;  2MJW B;  2HFC A;  2LP2 A;  4C0L A;  1BLQ A;  1QIV A;  5AFP A;  1C7W A;  3HCM A;  4KW4 A;  1BR1 B;  1KQM B;  2DUF A;  3ZUL A;  1Z1P A;  3O2P A;  2HJO A;  2WIS A;  4W6L A;  1CLL A;  3DF0 B;  1PRW A;  2V4E C;  3CFH A;  4MRY A;  1SMG A;  3DD4 A;  3BUW B;  1EMM A;  3RWA A;  1UHH A;  4L9M A;  3BYA A;  1BMO A;  2CTN A;  2L4I A;  1QYF A;  1OSA A;  2LLS A;  3SSH A;  5HLV A;  1QAT A;  1ZFS A;  4PHJ A;  1ZOT B;  3I19 A;  2Z6Y A;  1UHI A;  2GX0 A;  1S6I A;  2QU1 A;  5DPI A;  1SK6 D;  1XK4 C;  4LW5 A;  2F2P A;  2VAE A;  2VAD A;  4P5O E;  1J1E A;  1K8U A;  1D1O A;  4KW8 A;  2ZKM X;  3SVE A;  4CLN A;  1U5I A;  1KSO A;  5DKR A;  2PXS A;  1U5I B;  1KP5 A;  1M45 A;  3DQ6 A;  4L1I A;  3PJ5 A;  1JF0 A;  2WSN A;  3SIA A;  3VRP A;  1JF2 A;  3DQM A;  3VGO A;  1RK9 A;  4TNC A;  1UUR A;  1J7P A;  2OPO A;  5T3I A;  3V3D A;  2K2A A;  3E3R A;  1CDP A;  2A56 B;  4N1F A;  3VRO A;  2G16 B;  1GFL A;  4YGA A;  4W7A A;  3W1C A;  1AUI B;  1KWO C;  3CB9 A;  4HQ9 A;  2WOR A;  1S6C A;  4Q7R A;  2OS8 B;  3H1O A;  5DRF A;  4DKN A;  3U0N A;  1RJV A;  1DJX A;  1OZS A;  3UFZ A;  3P28 A;  4W6I A;  3SSL A;  4XL5 A;  4Q04 A;  3WXA A;  3A4U B;  1EMB A;  1KFU L;  4A4C A;  3KHE A;  1ODB A;  1XFY O;  4PHM A;  2WCB A;  2A46 A;  3CFF A;  1NSH A;  3PFV A;  1CDL A;  2HCG A;  5FVG A;  1MWN A;  5BT0 A;  3DQL A;  5I2O A;  1CKK A;  2K2F A;  4XOV A;  4W6F A;  3GOF A;  2JNF A;  1TIZ A;  1J55 A;  2DUI A;  2DUE A;  2R2I A;  2KQY A;  1QX2 A;  1TNW A;  5HKY A;  1QXT A;  1B8C A;  1NYA A;  4QJ5 B;  4W77 A;  2M1K B;  1DGV A;  2QLI A;  4W6P A;  1MUX A;  4TZA A;  1SYM A;  3NSO A;  2EC6 B;  1SR6 C;  3DQC A;  3RWT A;  1F09 A;  4B30 A;  4CFQ A;  4B30 B;  1IQ3 A;  4NDD A;  1YHH A;  1AJ5 A;  3BUO B;  3CS1 A;  4OVN F;  1W7U A;  2LCP A;  1FF1 A;  4C0J A;  1CB1 A;  3LF4 B;  2AH8 A;  3I5G B;  4JQ0 D;  1BFP A;  1QS7 A;  4M2P A;  4A4B A;  1XAE A;  2PAL A;  3I5I B;  1XA9 A;  3A8S A;  1B47 A;  1LA3 A;  4W6H A;  1H4U A;  3DQH A;  1SL8 A;  5KSZ A;  4AR7 A;  3K1K A;  2Z1O A;  3PAL A;  1GJY A;  5J2O A;  2O2B A;  4IL1 A;  3W1D A;  1S6Z A;  5HZU A;  3DQK A;  3HX4 A;  3SRY A;  2OS8 C;  2E30 A;  2O29 A;  1JWD A;  1S1E A;  2K61 A;  1F54 A;  2M3W A;  1XMZ A;  4HQC A;  5PAL A;  2HPW A;  2WHT A;  1B4C A;  3O78 A;  4GBA A;  1SL7 A;  1ZGO A;  3SSK A;  2JTT A;  3DQ5 A;  3RLZ A;  2KAV A;  3A8R A;  1N2D A;  3D10 A;  1K2H A;  2DD9 A;  4NDB A;  4IK3 A;  3SVB A;  3SVC A;  4BY4 A;  4JEO A;  2RH7 A;  1Q4A A;  4WQ2 A;  4H3M A;  4Q7U A;  1WRZ A;  3BQ3 A;  1Y0V H;  3RM1 A;  3GJ1 A;  5AQB B;  2L2E A;  2H61 A;  1MYW A;  5JOL A;  2H9W A;  4MZK A;  4KEX A;  3PJ7 A;  2OKW A;  3IF7 A;  1RTP 1;  3DQE A;  1SBJ A;  2JAD A;  3ST0 A;  3NSK A;  4DXQ A;  3SV5 A;  4CID A;  2L51 A;  1XSS A;  2EC6 C;  4QJ4 B;  4KGE A;  1TOP A;  2G5Z B;  4MEW A;  2KI4 C;  2PAS A;  4PPK A;  4CPV A;  3AKB A;  3BUM B;  2K7D A;  1SW8 A;  3SJS A;  4DCK A;  1RWY A;  4MZL A;  4W6J A;  3TUY B;  2KQ6 A;  2I7A A;  4I2Y A;  2GV5 A;  1QX5 B;  1KFX S;  3DQJ A;  5CSJ A;  1QJT A;  2MLF C;  2ZN8 A;  3ZUF A;  5HBD A;  1NCX A;  1XYD A;  2YE1 A;  3BXA A;  1LXF C;  1EG4 A;  2L4H A;  3UG0 A;  5FHV A;  2HQK A;  2P6B B;  1REC A;  1DJG A;  1KYS A;  1RMP A;  2PRU A;  2V4E A;  3DPX A;  2BEC A;  2JC2 A;  2V4E B;  2TN4 A;  2JUL A;  1CNP A;  4W7D A;  2ZFD A;  1EMF A;  2KAY A;  3ADF A;  2NCP A;  5TNC A;  1JFK A;  2HQW A;  2NZ0 A;  3TS5 C;  2POX A;  3DQN A;  3KCT A;  1S6J A;  1YVH A;  1XVJ A;  2JXC A;  3CBE A;  5FVF A;  1JC2 A;  4PPJ A;  2A4J A;  4ZBL A;  2QLG A;  4CFR A;  1FPW A;  4QJ3 B;  2QLG B;  1YR5 A;  2BBM A;  3DQO A;  1XK4 A;  1TNP A;  2A52 B;  1W7I B;  2AMI A;  2CT9 A;  2M97 A;  3M0W A;  1OMV A;  2D8N A;  4I5J A;  3KCS A;  4J89 A;  4H3L A;  1YTZ C;  2M49 B;  1G7K A;  5HW9 A;  1EMC A;  2BKI B;  1SRA A;  3BX9 A;  4RYS A;  4YI8 A;  4W7C A;  4KW9 A;  2WND A;  3SVD A;  1MQ1 A;  1LIN A;  5HKW A;  4PPL A;  2H61 C;  3EK7 A;  2COL B;  1M31 A;  5K89 A;  5I8N A;  3EKH A;  1GGZ A;  1G4Y R;  5CSF A;  1NCZ A;  3DQF A;  1AVS A;  4GUK A;  2B1U A;  1KYR A;  1K9K A;  4Q7T A;  1DVI A;  4KF5 C;  5HZS A;  5JJG A;  4OCI A;  4B5Y A;  5AXI A;  5EHU A;  3ZWH A;  3I5H C;  1QVI Z;  4HRG A;  3DQ7 A;  4I5N B;  3DQ9 A;  5EB7 A;  5EXB A;  2LC5 A;  2BE4 A;  1KYP A;  3TUY C;  5F6T A;  1QYO A;  2L98 A;  1ZUZ A;  1NX0 A;  1YHI A;  5DU0 A;  5LTP A;  4IK5 A;  1UHN A;  2BTJ A;  3CD1 A;  4MSP A;  4OJ0 A;  2HQZ A;  2B3Q A;  4W6B A;  2ZO6 A;  1L2O C;  3GB3 A;  2O5G A;  3BXK A;  2L0P A;  1GGX A;  1R6P A;  1NX1 A;  3SVR A;  4GGF C;  1HT9 A;  3K21 A;  1ZMZ A;  1CTR A;  1DJZ A;  2BCB A;  4W6C A;  1YX8 A;  2VZX A;  4P76 A;  3LCP C;  1BOC A;  4W6R A;  1NP8 A;  3TDI A;  2ZMW A;  4JPZ B;  4MVF A;  2LVJ A;  3SVO A;  1SR6 B;  2QRF A;  2JOJ A;  3LK1 A;  3U8C A;  2FCE A;  1XFV O;  5D69 A;  3KEV A;  1SPY A;  2K8M B;  5DY6 A;  1CV7 A;  2LVI A;  4W6A A;  2MHH A;  5HZT A;  1QVI Y;  2BKH B;  1YJF A;  3AAJ A;  1EMK A;  1ZGQ A;  1IWQ A;  3LLE A;  5FVI A;  2G2B A;  1WLM A;  3FWB A;  3VRR A;  2DOQ A;  4XJK A;  4I5K A;  4PE0 A;  5KTY A;  4W7E A;  1RMO A;  1Y1U A;  5J3X A;  1XO5 A;  1PVB A;  1YRT B;  4AQJ A;  1JC1 A;  3CR2 A;  1Q4D A;  4GES B;  1X02 A;  1RMM A;  1QX7 A;  1QLS A;  3GK1 A;  2MLE C;  1XFX O;  3TDZ A;  2DUG A;  4YGD B;  3O77 A;  2KBM A;  1IRJ A;  1ZGP A;  4MLW A;  1PSB A;  1TNX A;  4OGS A;  1F4Q A;  2PSR A;  2L5X B;  1HCJ A;  1BJF A;  1FI6 A;  3DVM A;  3AI5 A;  4EDS A;  3SG4 A;  1UHJ A;  3AKO A;  3PM8 A;  2ZNE A;  2CNP A;  2ZRS A;  4W7R A;  1H4B A;  2DD7 A;  2MBX A;  2MAZ A;  3ZUJ A;  4GNK B;  3BOW A;  5BTT A;  3ED8 A;  3BOW B;  4DIR A;  5BTT B;  5B8I B;  3VHT A;  3VHT B;  1DJW A;  1MF8 B;  1YUR A;  3EVV A;  1QV1 A;  2Q91 A;  3CWG A;  2QZ0 A;  1KFX L;  4W6O A;  3SG5 A;  1Q4B A;  1RRO A;  1K9P A;  2KYC A;  1IH0 A;  4OHS A;  3EVR A;  2V53 A;  3U8P A;  1W7T A;  4M2O A;  2HET A;  2F3Z A;  5CSI A;  4NWS A;  3SG6 A;  4ZIO A;  2A50 B;  5DPJ A;  2FOT A;  4HRH A;  3AI4 A;  1Y1A A;  1XFZ O;  1CFP A;  2P4M A;  4IK8 A;  3SSV A;  1QLK A;  4LJD C;  4LJC A;  2KI4 B;  1A2X A;  1YX7 A;  1BU3 A;  2VVI A;  1QTX A;  3DQ2 A;  3OGO A;  2K7C A;  4DS7 A;  3CGA A;  3OSQ A;  4MBE A;  4ZCV A;  1W7J B;  3BUX B;  2L50 A;  2IB6 A;  4GAO A;  4J88 A;  4USL A;  2EHB A;  1UIS A;  3DQ3 A;  4GOB A;  5LK4 A;  3QRX A;  2IE2 A;  2BL0 B;  4W6N A;  2NXQ A;  3NED A;  3VIC A;  4E68 A;  3WHU B;  2M0R A;  2DUH A;  2LUC A;  2YFP A;  1KCY A;  4ZF3 A;  2KBI A;  2AWK A;  3KO0 A;  1F71 A;  1F4O A;  1CMF A;  2HRS A;  2AUC A;  4DXO A;  1YUT A;  3IQQ A;  1KK8 C;  1SCM B;  5AAN A;  5EJU A;  3PN7 B;  2H5P A;  3EKJ A;  3DPW A;  2KOT A;  3WNX B;  2F33 A;  2O24 A;  1OE9 B;  4UPG A;  2JU0 A;  2BCA A;  2JT0 A;  1XQM A;  3TS5 B;  3EK4 A;  1EH2 A;  4DXI A;  4PCW A;  1FW4 A;  5EBJ A;  4PHK A;  3KF9 A;  5I2Q A;  3PAT A;  1DMO A;  3TZ1 A;  2ARL A;  1JBY A;  4JF9 A;  3IP2 A;  1Y6W A;  5HGE A;  1BF5 A;  2EMO A;  4J8A A;  4YGB B;  4BDU A;  3DQ4 A;  3TDU A;  2FZU A;  1EME A;  3EVP A;  2H5Q A;  1S36 A;  3NEZ A;  5GQQ C;  3DQ1 A;  1YVL A;  4JFG A;  3SG7 A;  5EXU A;  5HZO A;  2AWM A;  2Y4Q A;  1EG3 A;  4KA9 A;  3LK0 A;  5KU1 A;  1QXP A;  5HYD A;  2A48 A;  4N5X A;  3EVU A;  2IB5 A;  4W72 A;  2NCO A;  2M8U A;  3DQU A;  1K90 D;  4GF6 B;  4KF5 A;  5DTL A;  1H8B A;  1B8R A;  2ISD A;  2ZMU A;  3D0Y A;  1XFW O;  3I5H B;  2OTB A;  3TMR A;  2KFF A;  2MA2 A;  4ZFS A;  2JT8 A;  5DTY A;  1AK8 A;  4YI9 A;  3E5V A;  3CLN A;  1IG5 A;  3GL4 A;  4DXM A;  2Y1M A;  1WY9 A;  2LM5 A;  2BL0 C;  3LS3 A;  1AHR A;  1L2O B;  4EMQ A;  1A03 A;  3F45 A;  2BBN A;  4W6G A;  4ZF5 A;  1KFU S;  2OTG B;  1EJ3 A;  1PAL A;  4RTC A;  4W74 A;  3I5F C;  4OY4 A;  2EMN A;  1WRL A;  4DXP A;  4GGF A;  1SCM C;  2JNX A;  1L7Z A;  3PN7 C;  4DXN A;  1UWO A;  3DQD A;  3WCK A;  4LJB A;  2WHS A;  2M7L A;  2C9I A;  1JBA A;  4KAG A;  1FBV A;  2JT3 A;  1Q4C A;  1UUS A;  2PVB A;  1XFU O;  2K7O A;  1A75 A;  4FTG A;  1BG1 A;  1Q80 A;  4R1E A;  4P2Y B;  1OOJ A;  2G3D B;  4JWQ A;  2KFG A;  4PHN A;  4W6T A;  2C9J A;  2HGD A;  5ER4 X;  2Q6P A;  2GGZ A;  2F3Y A;  1YRU B;  5H88 A;  1CLB A;  1K94 A;  4I5L B;  4HQ8 A;  2LVK A;  1NPQ A;  1NX2 A;  2KAX A;  2JRF A;  2Y5I A;  1W7S A;  2JXL A;  3MSE B;  1YUS A;  3WHT B;  2CCM A;  2LMU A;  1QY3 A;  5AER A;  2A53 B;  3CR4 X;  4M2Q A;  4IK9 A;  1GL4 A;  1KSM A;  4W75 A;  1CM4 A;  4H3N A;  3SG2 A;  4OR9 B;  5HLO A;  2H6V A;  2H5O A;  3SST A;  2Y0G A;  3MGF A;  2YDZ A;  1PUL A;  1PVA A;  1R2U A;  1WRK A;  4ORN A;  4PAL A;  2I18 A;  1NIW A;  1DF0 A;  1MOV A;  1LKJ A;  1DF0 B;  2K0J A;  1Z1Q A;  1N65 A;  4WRI A;  1K95 A;  1E8A A;  4XYN A;  5G08 A;  4ORC B;  2GGM A;  3VRQ A;  1MXL C;  3CR5 X;  2RGI A;  1EML A;  1RM9 A;  3OHM B;  2VVH A;  2M1U A;  2NLN A;  2CBL A;  2M9G A;  3LSA A;  2BE6 A;  2LHL A;  4EUL A;  2Z6Z A;  2E6W A;  4C0K A;  2OTG C;  2F8P A;  5CSN A;  1QAS A;  2KNE A;  2LUX A;  3CFA A;  1BR4 B;  4MRX A;  1K96 A;  2G9B A;  3PLF B;  1Q73 A;  1QYQ A;  4IZN A;  2QLE A;  4JRB A;  3DF0 A;  3AKA A;  5ER5 A;  3LF3 A;  1WDC B;  4LJD A;  1ZUX A;  2FJU B;  2QAC A;  1SKT A;  1EL4 A;  3VRN A;  3OB1 B;  4JGE A;  1RRX A;  1IJ6 A;  3KPX A;  4OQW A;  1CM1 A;  1TCO B;  1CLM A;  3SS0 A;  4IK1 A;  2JZI A;  2H2K A;  2WCF A;  2BCX A;  3DVJ A;  2ZRT A;  3JVT B;  2A47 A;  2ZO7 A;  1JUO A;  2HQ8 A;  1GGW A;  2H5R A;  3SVS A;  2F2O A;  3IR8 A;  4U8D A;  4XJK B;  1HUY A;  5DTX A;  1NX3 A;  5EXC I;  2I94 A;  3ICB A;  1YJ2 A;  1G33 A;  4WQ3 A;  2LVV A;  5DQB A;  3E5W A;  3NXA A;  4ORA B;  1KK8 B;  4PFE A;  4Z4M A;  1OZO A;  2LAP A;  3LVD A;  3ZTF A;  1TRF A;  5EB6 A;  2OKY A;  4ORB B;  1TNQ A;  2QT2 A;  1OQP A;  3SIB A;  5BQL A;  4N3D A;  2LMT A;  5HKZ A;  2A54 B;  4EN1 A;  4GGN A;  2G2S B;  2EMD A;  4W6K A;  1F55 A;  3TMT A;  2LLU A;  3EK8 A;  1ZAC A;  4OKH A;  4N1G A;  4W6D A;  2QPT A;  3FS7 A;  4NDC A;  3DQ8 A;  5DPH A;  3U8A A;  3VK1 A;  5CPV A;  1C4F A;  1RFJ A;  1MR8 A;  2ICR A;  1BOD A;  5LTQ A;  3CGL A;  1TCF A;  1AP4 A;  1JBZ A;  3S05 A;  1CFC A;  1KQV A;  1IQ5 A;  2AWL A;  1G8I A;  1CDN A;  5I2L A;  3JTD C;  2DDD A;  1B7T Z;  2I2R E;  2H8Q A;  4AS8 A;  3NT3 A;  2WUR A;  4YGE B;  4PE1 A;  3BXC A;  3GEX A;  2EGD A;  3AAK A;  1KQM C;  4W73 A;  3LA1 A;  4DKM A;  2KSP A;  4Q9W A;  2PXW A;  1WDC C;  1SNL A;  4MZJ A;  1QV0 A;  1OXD A;  1YHG A;  1FI5 A;  1B9A A;  4GPL B;  1CMG A;  2G6Y A;  3WLC A;  1EMA A;  2ZN9 A;  2DDC A;  1UHK A;  2OGR A;  1IKU A;  5LTR A;  4H47 A;  1S5G Z;  3JVT C;  1XA5 A;  2G6X A;  1J7O A;  2LE9 B;  4OV2 A;  3ST2 A;  5FYX A;  1DTL A;  5DKN A;  1YZW A;  4ANJ A;  2LNK A;  3SSY A;  2JQ6 A;  2Y1N A;  5KTG A;  4PE7 A;  1MOU A;  1SL9 A;  1JC0 A;  3OP0 A;  2AAO A;  3U0M A;  3DQI A;  2ZND A;  4HVF A;  3I5F B;  1B7T Y;  2LMV A;  4L12 A;  1DT7 B;  2OTE A;  4F0Z B;  3U0L A;  3LL8 B;  1HQV A;  4W7F A;  1ALW A;  3SG3 A;  1DJH A;  2FCD A;  1CFD A;  3DVE A;  3ST3 A;  1B8L A;  5DKQ A;  1EMG A;  4H48 A;  2OJK A;  1K9U A;  3CD9 A;  1OMR A;  3OX5 A;  1LA0 A;  5F9G A;  5DPG A;  3OB2 B;  2WIQ A;  4ZB1 A;  3NT9 A;  1ALV A;  1S5G Y;  1Y1X A;  1V1F A;  2GW4 B;  4TZG A;  4KF4 A;  3BXB A;  2HGY A;  4XGY A;  1CDM A;  4D1E A;  2LP3 A;  4JC2 A;  4P1Q A;  1H6R A;  2QLH A;  1C7V A;  4UTS A;  3H1R A;  1S3P A;  3NSI A;  2AHA A;  1GQM A;  1IJ5 A;  2HPS A;  4FQO A;  3C1V A;  2G3O A;  3SSP A;  2PMY A;  1EXR A;  1MXE A;  3PJB A;  4XOW A;  2AWJ A;  1TN4 A;  2KDH A;  3U0K A;  2GX2 A;  4BY5 A;  3PIB A;  2LV7 A;  2JPT A;  4LQT A;  2WC8 A;  4HE4 A;  3H4S E;  1YUU A;  1V1G A;  3O6B A;  1B1G A;  2MRD A;  2B3P A;  1JSA A;  3LVA A;  4DUQ A;  3E5T A;  1NCY A;  1LVC D;  3D0Y B;  2KI6 D;  5H87 A;  2CXJ A;  5BPJ A;  5D7F A;  1AJ4 A;  3ST4 A;  2K7B A;  1BT6 A;  1DJI A;  1PSR A;  1B9C A;  4PDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...