3SG2A

Crystal structure of gcamp2-t116v,d381y
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
409
structure length
394
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKYTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 142
structure length 394
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg2A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg2A02
1JWDA 2L0PA 1PSBA 2O2BA 3SSHA 2NLNA 3SIAA 1SL9A 2IB5A 2QLIA 1WY9A 2ZMWA 2WOSA 4LQTA 5I2QA 1YHIA 3O77A 2QPTA 1YTZC 4KF5A 4I5JA 1BG1A 4H3NA 1FPWA 1B8RA 1XA5A 2A56B 1J1DA 3EK4A 4W6RA 4NDCA 4YBHB 5BTTB 1M31A 4GOBA 2K8MB 2FL1A 4JGEA 1F54A 2ZN9A 2V4EC 1MWNA 4W6FA 4PE4A 1UP5A 1QVIZ 4W6TA 2VADA 2K0JA 1M63B 4TZAA 4XL5A 4Z4MA 1F4QA 1SW8A 1MXLC 1S6CA 3HCMA 2PXSA 2TN4A 4W6AA 2HETA 3EVPA 3M0WA 5IBWA 2LP2A 4MZLA 4J8AA 2M9GA 3BXBA 3M24A 2NXQA 3BX9A 4TNCA 2WCEA 2HF5A 2HQZA 1XK4C 3W1DA 3DQHA 4HQ8A 2JRFA 1XO5A 4JQ0D 1K8UA 1EL4A 1OXEA 4XVPA 2YFPA 1XAEA 1CB1A 4Q7RA 2CTNA 2OPOA 1W7UA 3PM8A 2KI6D 3U0NA 2MAZA 4Q9XA 2CNPA 5TNCA 3CFAA 1MOUA 3OHMB 2NZ0A 1N2DA 5HBDA 4W7FA 2LC5A 2KI4C 4LQUA 5I2OA 5HZTA 1OOJA 2V4EA 1NP8A 2KFHA 2JT8A 5ER4X 3DQEA 2HPSA 1CDLA 3A8RA 4DS7A 2PMYA 5LTRA 3WCKA 5F9GA 4W77A 2AWKA 3DVJA 4LJDA 3CBEA 1NCXA 2AHAA 1YUSA 2Q57A 1EMAA 1J7PA 1BU3A 2ZO7A 5HZUA 1GGZA 1QV0A 2BL0B 3IR8A 1VRKA 1H4BA 4EULA 2K2AA 1IQ3A 3TZ1A 1K94A 2PALA 1PSRA 3SIBA 3SSKA 2WCFA 2G16B 4LJBA 3ADFA 1D1OA 1XK4A 2KBMA 3CS1A 2L4HA 1Z1PA 1Q4CA 2CT9A 2A50B 2MRDA 1MYWA 1OMDA 4W6UA 5DTXA 4EMQA 3SVRA 1XA9A 5AQBB 3BYAA 2LMVA 1QIVA 4HREE 3LK0A 4M2QA 2F3ZA 4Q7TA 4NDBA 4HE4A 1LA3A 1S6IA 1NSHA 3FWCA 3SSYA 2KHNA 4OHSA 4HQ9A 4OCIA 3GJ2A 1K9PA 1SCMC 4OV2A 1QYQA 3DQAA 2JTZA 5GQQC 4DXQA 3TMTA 1JFKA 1YX7A 1XYDA 3ICBA 5HGEA 2LANA 1DJGA 1HT9A 3I5HC 5LK4A 5AERA 3CGLA 2CCMA 1Y1AA 3E5VA 2DD9A 2F2OA 2QLEA 3I5GB 2H61C 5CPVA 2A47A 4YGDB 3WXAA 4OGSA 3CB9A 2F2PA 1S26D 3VRPA 3VGOA 3PJ7A 3BQ3A 2GX2A 3WNXB 1ZGPA 2HJOA 1GGXA 4D1EA 3A8SA 1SYMA 2P6BB 5JOLA 2A46A 4P76A 1S6ZA 2PSRA 3CR2A 2K7OA 2POXA 5J3XA 2GV5A 2VZXA 3LS3A 4RTCA 1CDNA 4Q04A 4OY4A 1DGUA 2FCDA 1TN4A 4NQGA 1RMOA 1MUXA 1Q73A 3QRXA 2PVBA 3SSTA 2LUXA 1BF5A 1S6JA 3CR4X 5HYDA 4ZB1A 4J89A 4U2VA 5DKRA 3EKJA 2ZNDA 5PALA 1F71A 1XVJA 3TS5C 3IF7A 1DF0B 1A75B 2H5PA 3LLEA 1WDCB 3TDUA 5DPGA 1QXTA 4C0LA 4W6OA 1NCZA 4A4BA 1SCVA 4KEXA 2H5RA 2G9BA 3H1RA 2COLB 1HUYA 1S5GZ 2JNFA 2FCEA 1RJVA 4DXIA 1YFPA 1MHOA 3LK1A 2PXWA 3DPWA 2JU0A 1UHKA 4PE0A 1SL8A 2JZIA 1TTXA 4PPLA 1IRJA 5DU0A 2G2SB 2MHHA 1CNPA 1AJ5A 1IJ6A 4W6DA 4MZJA 2EGDA 1UURA 2Y0GA 2G6YA 3CLNA 4DXOA 2L4IA 2ZKMX 2DOQA 5FYXA 1U5IA 2Z1OA 1GQMA 4M2PA 1H8BA 1EG4A 1NX2A 3GL4A 1Z1QA 1JUOA 1Q4EA 1WRZA 4UPGA 3DPXA 1QJTA 1QLSA 4PHMA 3O6BA 5F6TA 4FQOA 4XOWA 1Q4BA 2I2RE 2ZFDA 3DQCA 2AWJA 3GJ1A 1MOVA 2QZ0A 2QLGA 5FVFA 2CXJA 1XFWO 4P2YB 1KQVA 2KAVA 2DDCA 4OVNF 2KAYA 3M22A 1QATA 3ZTFA 4KPIA 1EMMA 4W6CA 1YJ2A 3GB3A 2LLTA 5K89A 1OXFA 3DVKA 2A53B 4ZINA 1YRTB 2M49B 1PALA 2HGYA 4USLA 1BR4B 4W7DA 2QLHA 1TCOB 1JC2A 3CTNA 2D8NA 4PE7A 4DIRA 3O78A 1TNXA 3D0YB 4AQJA 3PLFB 4W6NA 2KYFA 2DUIA 5BQLA 2KYCA 1TOPA 3RWTA 3PATA 3OSRA 5BTTA 2L98A 2OKWA 3LVDA 1EJ3A 4OJ0A 1N0YA 1NX3A 1NPQA 3BUMB 1V1GA 2KBIA 3GOFA 3KEVA 2GW3A 3U0MA 2G6XA 3SRYA 3PALA 3SG4A 4N5XA 3VICA 3RLZA 5I2LA 5AEQA 3DQNA 1J1EA 2LAPA 4W7EA 4Z4KA 1B8CA 2H9WA 1S36A 3KHEA 2HRSA 3EK7A 2E6WA 3CFHA 1YJFA 5EB6A 3EVVA 4WQ3A 2ZRSA 2G6EA 3DQUA 4R6BA 2Q4UA 4HRGA 1TNWA 2BL0C 2MBXA 4OKHA 2LCPA 1QLKA 1YHHA 1GJYA 3NSLA 1DMOA 4ANJA 2LVIA 3UG0A 1MR8A 1RTP1 1GL4A 2KSPA 5I8NA 4CPVA 3BOWB 3DQKA 2LP3A 2G2BA 1A29A 1A03A 3LF4B 2H8QA 3V3DA 1ZGOA 2Z6ZA 1B9AA 4XOVA 2G3DB 2NCPA 2QU1A 2BKIB 1W7SA 4W72A 2WHTA 1TNPA 4U8DA 5LTPA 2DD7A 3SVOA 1KCYA 1B47A 1LVCD 2MJWB 2KNEA 1JC1A 1H4UA 3U8AA 1RECA 1ZMZA 3CR5X 5DRGA 1JSAA 5DQMA 3AAJA 2A4JA 1OMRA 4R1EA 4L9MA 1L7ZA 3I5GC 4I5LB 4XYNA 4PHKA 2JT0A 1Q4AA 3SG3A 1WLZA 3OSQA 3GK1A 1KK8B 3OP0A 1YHGA 3SG6A 4OR9B 4UTSA 4HSZA 1B9CA 1RMMA 2JXLA 4W6IA 2K7CA 1J7OA 1LA0A 4CIDA 1F8HA 2QACA 2VRGA 2JXCA 4WQ2A 1BODA 1CV7A 1CDMA 4JF9A 1FF1A 1C4FA 4DXPA 1EMGA 5DPIA 5HKZA 1X02A 4KGEA 1C7WA 2PRUA 3E5WA 4MVFA 2H5QA 4GUKA 2HGDA 3CGAA 2EMNA 1SK6D 3E3RA 1W7TA 1PVBA 3DPZA 1BFPA 1CFFA 1EXRA 2M97A 4LW5A 2YE1A 2JOJA 1YUTA 1K9KA 2OGRA 1KFUS 3LSAA 2K7BA 5KTGA 2BTJA 1TIZA 1KFXS 3SG5A 1WDCC 4BY5A 2L2EA 4EN1A 1HCJA 3O2PA 1KFUL 4GESB 3ST2A 4PPKA 1B7TZ 1F0BA 2QT2A 4L12A 1CFCA 1DTLA 1KFXL 1Q4DA 2MLFC 3O4YA 1DJHA 2O5GA 2WURA 2KGBC 1B8LA 4YRUA 3DQ5A 4GBAA 4XJKB 4YI8A 3DQ4A 3BXKA 5HZSA 2R2IA 3LCPC 2L50A 4EDSA 3E5TA 5EXCI 1BT6A 4PDZA 1XFUO 1RRXA 1NIWA 4ZCUA 2EMDA 1QVIY 5DPJA 3SVCA 2EMOA 3VRNA 1UUSA 3GEXA 3DQ7A 3DF0B 1AVSA 4W69A 4MBEA 3LF3A 1YR5A 2WC8A 1QX5B 3BXAA 2JPTA 2ISDA 3VRQA 3NSKA 3I5FB 4YGCB 2WNDA 4DKMA 1XFYO 1EMCA 1BMOA 4DCKA 2L5XB 1DF0A 3VROA 3S05A 5DTZA 1J7QA 1A75A 3DQ2A 4CFRA 1OMVA 3TUYB 3SJSA 4IK9A 1QYFA 1DJWA 4W6LA 1SNLA 2F8PA 4JWQA 4PPJA 1ZOTB 3SG2A 4P1QA 4J88A 2JULA 3BXCA 3PIBA 4IK4A 2OTEA 3ZUJA 3DQLA 1UHIA 1K2HA 5JJGA 1CMFA 4MLWA 4ZFSA 2HQ8A 3SS0A 1FI6A 1NX1A 1PRWA 3AI5A 3OX6A 4C0KA 1YZWA 2JADA 1QTXA 3VHTA 2AUCA 2WSNA 3NEZA 2RH7A 1G8IA 1YRUB 2LVVA 1H6RA 2SCPA 3JVTB 2B3PA 3SV5A 4PCWA 1WRLA 3DD4A 1EMBA 3DQ8A 4L1IA 3ST4A 1F55A 1KK7Z 3DQIA 4DXNA 5HW9A 3SVNA 3NF0A 2WORA 5D7FA 2LHLA 1EMLA 2EC6B 3G9AA 4AOMA 2LVKA 4DRWA 2H61A 2KQYA 2BCAA 2WISA 5ER5A 1DT7B 4HRHA 4N1FA 1EMKA 2SASA 2DUGA 2L51A 4GAOA 1B7TY 2KQ6A 4N3DA 3RWAA 2F33A 1B4CA 2GGMA 4N1GA 3JTDB 1M45A 1DJXA 4W6HA 4ZF3A 4H48A 2BCBA 2VVIA 3SSLA 1QASA 2IS9A 2OS8B 3AKAA 2O29A 1G4YR 5FVGA 5KU1A 4ZF4A 5AXIA 1RMPA 1DJIA 3D0YA 3IP2A 1CLBA 2H2KA 4ICBA 4QJ4B 5T3IA 1TCFA 1GGWA 1JBAA 3SVEA 5CSJA 1FI5A 2BBMA 1OQPA 1NWDA 4GGNA 2OKYA 3DQ9A 3U0KA 2YE0A 3SVSA 3ST0A 2JC2A 5KSZA 2LLUA 2WIQA 4H3MA 2LM5A 1ZACA 1KYRA 1R6PA 1ZFSA 4W7AA 3DQOA 1QYOA 3ZULA 1J7RA 4CLNA 4ORAB 4EDOA 2KFGA 1KQMB 1UHNA 2Y5IA 5FVIA 1KK8C 2Q91A 3MSEB 3K21A 1CMGA 4YGAA 2LMTA 3CZTX 3WHUB 5B8IB 1IH0A 3U0LA 3BOWA 4B30B 2ZN8A 3D10A 1IQ5A 1WLMA 2CBLA 1KWOC 5H89A 4C0JA 1Y1UA 4A4CA 2LVJA 2A48A 1K93D 4W73A 5EB7A 3SVDA 1AJ4A 3P8UA 4QJ3B 2BE6A 1EG3A 1JF0A 1SL7A 2K7DA 4IL1A 3VK1A 3I5IB 4YGEB 4OQWA 4KA9A 4GNKB 3SG7A 3CFFA 1LXFC 1R2UA 2BCXA 2M7NA 1OZOA 4BY4A 1IGVA 1QY3A 2HFCA 1XFXO 2FOTA 1ODBA 3PFVA 4KW9A 1QV1A 4W75A 3A4UB 2JT3A 5DTLA 1S5GY 4XGYA 2WCBA 2ICRA 3LVCA 4I2YA 1C7VA 1F4OA 1W7JB 4F0ZB 4ORCB 2Z6YA 1A2XA 1IKUA 1SR6B 2M1UA 1CM1A 5G08A 1J55A 2EHBA 1BLQA 1CFDA 2A54B 2JNXA 2G3OA 3PSRA 3AKOA 4YGBB 2BE4A 4HQCA 1AUIB 2F3YA 3BUOB 1M39A 3PN7C 1LINA 4L13A 3LVAA 1TNQA 3DQ6A 4ZIOA 3U8PA 2KGRA 2M8UA 1SBJA 1QX2A 2OJKA 5CSNA 1AK8A 3EKHA 2G5ZB 1K9UA 3OB1B 4LJDC 3H1OA 3F45A 2VVJA 3I5FC 5HLVA 5CSIA 2H5OA 4JC2A 1FBVA 4P5OE 2OTGB 2PASA 3H4SE 2P4MA 1F09A 3TUYC 1ZGQA 2V53A 1W7IB 2VVHA 2Q6PA 1NUBA 1DJZA 4ZF5A 2M7LA 1KYSA 4ORBB 5EHUA 2JTTA 1G7KA 5FHVA 3ST3A 3TDIA 4DKNA 1OXDA 1Y6WA 1AP4A 1JBYA 1L2OC 1K96A 3AKBA 3SVBA 5J2OA 4XJKA 1JF2A 4ETOA 1KWOB 2ZO6A 2WHSA 2FZUA 4WRIA 1CLLA 1BR1B 2WHUA 1WRKA 1Y0VH 4R6DA 3UFZA 2I7AA 4JPZB 1QX7A 1ALVA 2AMIA 3KPXA 3JVTC 3ZWHA 1V1FA 2E30A 1XSSA 2ZRTA 1K90D 4CFQA 3IQQA 4W6GA 3VRRA 5BPJA 4PFEA 4B5YA 1NX0A 3BUNB 4DXMA 1DJYA 2KAXA 3NXAA 2KFFA 4PHJA 3DF0A 1CDPA 2AH8A 2DUFA 4KGFA 2Y1MA 4I5KA 3WLCA 1YUUA 4MN0A 2EC6C 3ZUFA 4KW4A 1PULA 4PE1A 1SRAA 2BKHB 3KCSA 2GX0A 1BJFA 5DKNA 3MGFA 3LA1A 1OE9B 1RK9A 4GPLB 4W7RA 1E8AA 1SKTA 1F70A 3KF9A 1DVIA 1RWYA 2AAOA 4W7XA 3JTDC 1MQ1A 2BBNA 5DQBA 2GW4B 5D69A 2BECA 2HQWA 4QJ5B 4NWSA 2GGZA 4RYWA 3DQFA 5DRFA 1B1GA 4HVFA 2OS8C 3PN7B 4KAGA 3DQDA 4MRXA 1SMGA 3I19A 3W1CA 2V4EB 1JFJA 2LUCA 1FW4A 2M0RA 1ALWA 2M29A 3AAKA 5BT0A 1YVHA 1IJ5A 2M3WA 1HQVA 2ARLA 3NEDA 2IB6A 1LKJA 4NDDA 1EMEA 3OX5A 2KI6C 2NCOA 2RGIA 4FTGA 1KSMA 2LV7A 1CFPA 5HKWA 4RYSA 1YX8A 1OSAA 1S1EA 2Z6XA 3U8CA 2VAEA 4GF6B 3GK2A 1MF8B 1CM4A 1PK0D 2IOVA 4LJCA 1ZUXA 4GFTA 5LTQA 1TRFA 3SVUA 1KQMC 4MZKA 2B3QA 2WSOA 4GGFC 3IQOA 3NT9A 5EBJA 1GFLA 1XFVO 1L2OB 1Y1XA 4KF4A 1AHRA 1DGVA 3DVEA 1IWQA 2JWWA 5AANA 2FWQA 2HCGA 3OB2B 5HKYA 1UHJA 2C9IA 3AI4A 5HLOA 5DKQA 1BOCA 5EXUA 2C9JA 4JEOA 2KI4B 1A4PA 3DQJA 4PALA 5H88A 3EK8A 2LMUA 2Y4QA 1SPYA 4MEWA 1YVLA 4AS8A 4W74A 3CD9A 3BUWB 4IZNA 4TZGA 4Q9WA 3I5IC 1YURA 4W7CA 2MLEC 2OTBA 1UHHA 3OGOA 3NSIA 3EVRA 2A52B 1MXEA 5EJUA 4W6JA 5EXBA 3DVMA 2Y1NA 3EVUA 4MSPA 2DDDA 2LNKA 1CTRA 3GK4X 1SY9A 2AWMA 4GGFA 2K61A 3ED8A 3DQ1A 1ZUZA 2HPWA 4H3LA 1KYPA 3LL8B 4W6MA 4ZCVA 1SR6C 1EH2A 2KDHA 4IK8A 2DUEA 1EMFA 1G33A 1RM9A 4W6BA 1S3PA 3PJBA 4W6KA 4AR7A 1NCYA 4I5NB 3VHTB 2QRFA 2IE2A 2FJUB 1K95A 2I18A 4B30A 1UISA 4E68A 1SCMB 4H47A 2O60A 3FS7A 1JC0A 1KSOA 3PJ5A 2YDZA 4AQIA 1UWOA 1CKKA 2LHIA 3NSOA 3KCTA 4IK1A 3SSPA 1OZSA 3I5HB 2DUHA 3CWGA 2MA2A 5DTYA 2ZNEA 2HQKA 3ZNIA 3WHTB 2B1UA 1RROA 1IG5A 4BDUA 4DUQA 3TDZA 3WLDA 2LE9B 3SSVA 3FIAA 3K1KA 4JFGA 4ORNA 2OTGC 4W6PA 4ZBLA 3FWBA 2AWLA 3DQMA 4KF5C 5H87A 2ZMUA 3TMRA 5CSFA 3CD1A 2H6VA 1XMZA 1RFJA 1XQMA 4W76A 3RM1A 2JQ6A 2K2FA 1QS7A 5KTYA 2KOTA 4YI9A 4Q7UA 2M1KB 4W6SA 1PVAA 3NT3A 1C07A 3P28A 3BUXB 1U5IB 1N65A 1NYAA 1CLMA 3DQ3A 1KP5A 4KW8A 4IK5A 1M46A 3C1VA 1KK7Y 1Q80A 3TS5B 4IK3A 3KO0A 4PHNA 5DPHA 4MRYA 2LLSA 1XFZO 1QIWA 1JBZA 2QLGB 5HZOA 3HX4A 4M2OA 1QXPA 4JRBA 2I94A 5AFPA 5DY6A 2O24A
chains in the Genus database with same CATH superfamily
2P70A 1JWDA 2L0PA 1PSBA 2O2BA 3SSHA 3DY9A 2NLNA 3SIAA 1SL9A 2IB5A 2QLIA 1WY9A 2ZMWA 2WOSA 4LQTA 5I2QA 1YHIA 3O77A 2QPTA 1YTZC 4KF5A 4I5JA 2WC5A 1BG1A 4H3NA 1FPWA 1B8RA 4KYNA 1XA5A 2A56B 1J1DA 3EK4A 4W6RA 4NDCA 4YBHB 5BTTB 1M31A 4GOBA 2K8MB 2FL1A 4JGEA 1F54A 2ZN9A 2V4EC 1MWNA 4W6FA 2QDIA 4PE4A 1UP5A 1QVIZ 4W6TA 2VADA 2K0JA 1M63B 4TZAA 4XL5A 4Z4MA 1F4QA 1SW8A 1MXLC 1S6CA 3HCMA 2PXSA 2TN4A 4W6AA 2HETA 3EVPA 3M0WA 5IBWA 2LP2A 4MZLA 4J8AA 2M9GA 3BXBA 3M24A 2BAPA 2NXQA 3BX9A 4TNCA 2WCEA 2HF5A 2HQZA 1XK4C 3W1DA 3DQHA 4HQ8A 3S0AA 2QEOA 2JRFA 1XO5A 4JQ0D 1K8UA 1EL4A 4OZDA 1OXEA 4XVPA 2YFPA 1XAEA 1CB1A 4Q7RA 2CTNA 2OPOA 3RZSA 1W7UA 5I94A 3PM8A 2KI6D 3U0NA 2H8VA 2MAZA 4Q9XA 2CNPA 5TNCA 3CFAA 1MOUA 3OHMB 2NZ0A 1N2DA 5HBDA 4W7FA 2LC5A 2KI4C 4LQUA 5I2OA 5HZTA 1OOJA 2V4EA 1NP8A 2KFHA 2JT8A 5ER4X 3DQEA 2HPSA 1CDLA 3A8RA 4DS7A 2PMYA 5LTRA 3WCKA 5F9GA 4W77A 2AWKA 3DVJA 1TWOA 4LJDA 3CBEA 3S0EA 3R1PA 1NCXA 2AHAA 1YUSA 2Q57A 1EMAA 1J7PA 4PT1A 1BU3A 2ZO7A 5HZUA 1GGZA 1QV0A 2BL0B 3IR8A 1VRKA 1H4BA 4EULA 2K2AA 1IQ3A 3TZ1A 1K94A 2PALA 1PSRA 3SIBA 3SSKA 2WCFA 2G16B 4LJBA 3ADFA 1D1OA 1XK4A 2KBMA 3CS1A 2L4HA 1Z1PA 1Q4CA 2CT9A 2A50B 2MRDA 1MYWA 1OMDA 4W6UA 5DTXA 4EMQA 3SVRA 1XA9A 5AQBB 3BYAA 2LMVA 1QIVA 4HREE 3LK0A 4M2QA 2F3ZA 4Q7TA 4NDBA 4HE4A 1LA3A 1S6IA 1NSHA 3FWCA 3SSYA 2KHNA 4OHSA 4HQ9A 4OCIA 3GJ2A 1K9PA 1SCMC 4OV2A 1QYQA 3DQAA 2JTZA 5GQQC 4DXQA 3TMTA 1JFKA 3R1VA 1YX7A 1XYDA 3ICBA 5HGEA 2LANA 1DJGA 1HT9A 3I5HC 5LK4A 5AERA 3CGLA 5EL2A 2CCMA 1Y1AA 3E5VA 1IIOA 3FE9A 2DD9A 2F2OA 3S0GA 2QLEA 3BJHA 1Z2CB 3I5GB 2H61C 5CPVA 2A47A 4YGDB 3WXAA 1ORGA 4OGSA 3CB9A 2QEBA 2F2PA 1S26D 3VRPA 3VGOA 3PJ7A 3BQ3A 2GX2A 3WNXB 1ZGPA 2HJOA 1GGXA 4D1EA 3A8SA 3N7HA 1SYMA 2P6BB 5JOLA 2A46A 4P76A 1S6ZA 2PSRA 3DXLA 3CR2A 2K7OA 2POXA 5J3XA 2GV5A 2VZXA 3LS3A 4RTCA 1CDNA 4Q04A 4OY4A 1DGUA 2FCDA 1TN4A 4NQGA 3S0FA 1RMOA 1MUXA 1Q73A 3QRXA 2PVBA 3SSTA 2LUXA 1BF5A 1S6JA 1SSEB 3CR4X 5HYDA 4ZB1A 4J89A 4U2VA 5DKRA 3EKJA 2ZNDA 5PALA 1F71A 1XVJA 3TS5C 3IF7A 1DF0B 1A75B 2H5PA 3LLEA 1LS8A 1WDCB 3CABA 3TDUA 5DPGA 1QXTA 4C0LA 1QWVA 4W6OA 1NCZA 4A4BA 1SCVA 4KEXA 2H5RA 2G9BA 3H1RA 2COLB 1HUYA 3CZ0A 1S5GZ 2JNFA 1OOHA 2FCEA 1RJVA 5HL1A 4DXIA 1YFPA 1MHOA 3LK1A 2PXWA 3DPWA 2JU0A 1UHKA 4PE0A 1SL8A 2JZIA 1TTXA 4PPLA 1IRJA 5DU0A 2G2SB 2MHHA 1CNPA 1AJ5A 1IJ6A 4W6DA 4MZJA 2EGDA 1UURA 2Y0GA 4IJ7A 2G6YA 3CLNA 1TUJA 4DXOA 2L4IA 2ZKMX 2DOQA 5FYXA 1U5IA 2Z1OA 3R72A 1GQMA 4M2PA 1H8BA 1EG4A 1NX2A 3GL4A 1Z1QA 1JUOA 1Q4EA 1WRZA 4UPGA 3DPXA 1QJTA 1QLSA 4PHMA 3O6BA 5F6TA 4FQOA 4XOWA 1Q4BA 2I2RE 2ZFDA 5D3OA 3DQCA 2AWJA 3GJ1A 1MOVA 2QZ0A 2QLGA 5FVFA 2CXJA 1XFWO 4P2YB 1KQVA 2KAVA 2DDCA 4OVNF 2KAYA 3M22A 1QATA 3ZTFA 4KPIA 1EMMA 4W6CA 1YJ2A 3GB3A 2LLTA 5K89A 1OXFA 3DVKA 2A53B 1DEKA 4ZINA 1YRTB 2M49B 1PALA 2HGYA 2WC6A 1BR4B 4USLA 4W7DA 2QLHA 1TCOB 1JC2A 3CTNA 2D8NA 4PE7A 4DIRA 3O78A 1TNXA 3D0YB 4AQJA 3PLFB 4W6NA 2WCLA 2KYFA 2DUIA 5BQLA 2KYCA 1TOPA 3RWTA 3PATA 3OSRA 5BTTA 2L98A 2OKWA 3LVDA 1EJ3A 4OJ0A 1N0YA 1NX3A 1NPQA 3BUMB 1V1GA 2KBIA 3GOFA 3KEVA 2GW3A 3U0MA 2G6XA 3SRYA 3PALA 3SG4A 4N5XA 3VICA 3RLZA 2JPOA 5I2LA 5AEQA 3DQNA 1J1EA 2LAPA 4W7EA 4Z4KA 1B8CA 2H9WA 1S36A 3KHEA 2HRSA 2KPHA 3EG5B 3EK7A 2E6WA 3CFHA 1YJFA 5EB6A 3EVVA 4WQ3A 2ZRSA 2G6EA 3DQUA 4R6BA 2Q4UA 4HRGA 1TNWA 2BL0C 2MBXA 4OKHA 1OW4A 1XFRA 2LCPA 1QLKA 1YHHA 1GJYA 1C3ZA 3NSLA 1DMOA 4ANJA 2LVIA 3UG0A 1MR8A 1RTP1 1GL4A 2KSPA 5I8NA 4CPVA 3BOWB 3DQKA 2LP3A 2G2BA 1A29A 1A03A 3LF4B 2H8QA 3V3DA 1ZGOA 3CYZA 2QEVA 2Z6ZA 1B9AA 4XOVA 2G3DB 2NCPA 2QU1A 2BKIB 1W7SA 4W72A 2WHTA 1TNPA 4U8DA 5LTPA 2DD7A 3SVOA 1KCYA 1B47A 1LVCD 2MJWB 2KNEA 1JC1A 1H4UA 2WCKA 3U8AA 4INWA 3IVTA 1RECA 1ZMZA 3CR5X 5DRGA 1JSAA 5DQMA 3AAJA 2A4JA 1OMRA 4R1EA 4L9MA 1L7ZA 3I5GC 4I5LB 4XYNA 4PHKA 2JT0A 1Q4AA 3SG3A 1WLZA 3OSQA 3GK1A 1KK8B 3OP0A 1YHGA 3SG6A 4OR9B 4UTSA 4HSZA 3NGVA 1B9CA 1RMMA 2JXLA 4W6IA 2K7CA 1J7OA 1LA0A 4CIDA 1F8HA 2QACA 2VRGA 2JXCA 1C3YA 4WQ2A 1BODA 1CV7A 1CDMA 4JF9A 1FF1A 1C4FA 4DXPA 1EMGA 3L47A 5DPIA 5HKZA 1X02A 4KGEA 1C7WA 2PRUA 3E5WA 4MVFA 2H5QA 4GUKA 2HGDA 3CGAA 2EMNA 1SK6D 3E3RA 1W7TA 1PVBA 3DPZA 1BFPA 1CFFA 1EXRA 2M97A 4LW5A 2YE1A 2JOJA 1YUTA 1K9KA 2OGRA 1KFUS 3LSAA 2K7BA 1W9ZA 2K60A 5KTGA 2BTJA 1TIZA 1KFXS 3SG5A 1WDCC 4BY5A 2L2EA 4EN1A 1HCJA 3O2PA 1KFUL 4GESB 1OOGA 3ST2A 4PPKA 1B7TZ 1F0BA 2QT2A 4L12A 1CFCA 1Z4HA 1DTLA 1KFXL 1GM0A 1Q4DA 2MLFC 3K1EA 3O4YA 1DJHA 2O5GA 2WURA 2KGBC 1B8LA 4YRUA 3DQ5A 4GBAA 4XJKB 4YI8A 3DQ4A 3BXKA 5HZSA 2R2IA 3LCPC 3OGNA 2L50A 4EDSA 3E5TA 5EXCI 1BT6A 4JKTA 4PDZA 1XFUO 1RRXA 2KLEA 3DYEA 1NIWA 4ZCUA 2EMDA 1QVIY 5DPJA 3SVCA 2EMOA 3VRNA 1UUSA 3GEXA 3DQ7A 3DF0B 1AVSA 4W69A 4MBEA 3LF3A 1YR5A 2WC8A 1QX5B 3BXAA 2JPTA 2ISDA 3VRQA 3NSKA 3I5FB 4YGCB 2WNDA 4DKMA 1XFYO 1EMCA 1BMOA 4DCKA 2L5XB 1DF0A 3VROA 3S05A 5DTZA 1J7QA 4JD9A 1A75A 3DQ2A 2BNXA 3D78A 4CFRA 1DC1A 3B6XA 1OMVA 2YGUA 3SJSA 3NHIA 3TUYB 4IK9A 1QYFA 1DJWA 4W6LA 1SNLA 2F8PA 4JWQA 4PPJA 1ZOTB 3SG2A 4P1QA 4J88A 2JULA 3BXCA 3PIBA 4IK4A 2OTEA 3ZUJA 3DQLA 1UHIA 1K2HA 5JJGA 1CMFA 4MLWA 4ZFSA 2HQ8A 3SS0A 1FI6A 1NX1A 1PRWA 3AI5A 3OX6A 4C0KA 1YZWA 2JADA 1QTXA 3VHTA 2AUCA 2WSNA 3NEZA 2RH7A 1G8IA 1YRUB 2LVVA 1H6RA 2SCPA 3JVTB 2B3PA 3SV5A 4PCWA 1WRLA 3DD4A 1EMBA 3DQ8A 2KLDA 4L1IA 3ST4A 1F55A 1KK7Z 3DQIA 4DXNA 5HW9A 3SVNA 3NF0A 2WORA 5D7FA 2LHLA 1EMLA 2EC6B 3G9AA 4AOMA 2LVKA 4DRWA 2H61A 2KQYA 2BCAA 2WISA 5ER5A 1DT7B 4HRHA 4N1FA 5FI7A 1EMKA 2SASA 2DUGA 2L51A 4GAOA 1B7TY 2KQ6A 4N3DA 3RWAA 2F33A 1B4CA 2GGMA 4N1GA 3JTDB 1M45A 1DJXA 4W6HA 4ZF3A 4H48A 2BCBA 2VVIA 3SSLA 1QASA 2IS9A 2OS8B 3AKAA 2O29A 1G4YR 5FVGA 5KU1A 4ZF4A 5AXIA 1RMPA 1DJIA 3D0YA 3IP2A 1CLBA 2H2KA 4ICBA 3D73A 4QJ4B 5T3IA 1TCFA 1GGWA 1JBAA 3SVEA 3VB1A 5CSJA 1FI5A 2BBMA 1OQPA 1NWDA 4GGNA 2OKYA 3DQ9A 3U0KA 2YE0A 3SVSA 3ST0A 2JC2A 5KSZA 2LLUA 2WIQA 4H3MA 2LM5A 1ZACA 1KYRA 1R6PA 1ZFSA 4W7AA 3DQOA 3B86A 1QYOA 3ZULA 1J7RA 4CLNA 4ORAB 4EDOA 2KFGA 1KQMB 1UHNA 1DQEA 2Y5IA 5FVIA 1KK8C 2Q91A 3MSEB 3K21A 1CMGA 3S0DA 4YGAA 2LMTA 2PQLA 3CZTX 3FE6A 3WHUB 1DELA 5B8IB 1IH0A 3U0LA 3BOWA 3O4XA 4B30B 2ZN8A 3S0BA 3B7AA 3D10A 1IQ5A 1WLMA 2CBLA 1KWOC 5H89A 4C0JA 1Y1UA 4A4CA 2LVJA 2A48A 3CZ2A 1K93D 4W73A 5EB7A 3SVDA 1AJ4A 3P8UA 4QJ3B 2BE6A 1EG3A 1JF0A 3NHTA 1OOIX 1SL7A 3D76A 2K7DA 4IL1A 3VK1A 3I5IB 4YGEB 4OQWA 4KA9A 4GNKB 3SG7A 3L4AA 3CFFA 1LXFC 1R2UA 2BCXA 2M7NA 1OZOA 4BY4A 1IGVA 1QY3A 2HFCA 1XFXO 2FOTA 1ODBA 3PFVA 4KW9A 1QV1A 4W75A 3A4UB 2JT3A 3SS5A 5DTLA 1S5GY 4XGYA 2WCBA 2ICRA 3LVCA 4I2YA 4FQTA 1C7VA 1F4OA 1W7JB 4F0ZB 4ORCB 2Z6YA 1A2XA 1IKUA 1SR6B 2M1UA 1CM1A 5G08A 1J55A 2EHBA 1BLQA 1CFDA 1TUZA 2A54B 2JNXA 2G3OA 3PSRA 3AKOA 4YGBB 2GTEA 2BE4A 1AUIB 2F3YA 3BUOB 4HQCA 1M39A 3PN7C 1LINA 4L13A 3LVAA 1TNQA 3DQ6A 4ZIOA 3U8PA 2KGRA 2M8UA 1SBJA 1QX2A 2OJKA 5CSNA 1AK8A 3EKHA 2G5ZB 1K9UA 3OB1B 4LJDC 3H1OA 3F45A 2VVJA 5HLVA 3I5FC 5CSIA 3DZTA 2H5OA 4JC2A 1FBVA 4P5OE 2OTGB 3B87A 2PASA 3H4SE 2P4MA 1F09A 3TUYC 2FJYA 4INXA 1ZGQA 2V53A 1W7IB 2VVHA 2Q6PA 1NUBA 1DJZA 4ZF5A 2M7LA 1KYSA 4ORBB 5EHUA 2JTTA 1G7KA 5FHVA 3ST3A 2L5YA 3TDIA 4DKNA 1OXDA 1Y6WA 1AP4A 1JBYA 1P28A 1L2OC 1K96A 3AKBA 3SVBA 5J2OA 4XJKA 1JF2A 4ETOA 1KWOB 2ZO6A 2WHSA 2FZUA 4WRIA 1CLLA 1BR1B 2WHUA 1WRKA 1Y0VH 4R6DA 3UFZA 2I7AA 4JPZB 1QX7A 1ALVA 3B88A 2AMIA 3KPXA 3JVTC 3ZWHA 1V1FA 2E30A 1XSSA 2ZRTA 1K90D 4CFQA 3IQQA 4W6GA 3VRRA 5BPJA 4PFEA 4B5YA 1NX0A 3BUNB 4DXMA 3D75A 1DJYA 2KAXA 3NXAA 2KFFA 4PHJA 3Q8IA 3DF0A 1CDPA 3L4LA 3UNWA 2AH8A 2DUFA 4KGFA 2Y1MA 4I5KA 3WLCA 1YUUA 4MN0A 2EC6C 3ZUFA 4KW4A 1PULA 4PE1A 1SRAA 2BKHB 3KCSA 2GX0A 1BJFA 1OOFA 5DKNA 3MGFA 3LA1A 1OE9B 1RK9A 4GPLB 4W7RA 1E8AA 1SKTA 1F70A 3KF9A 1DVIA 1RWYA 2AAOA 2QEHA 4W7XA 3JTDC 1MQ1A 2BBNA 5DQBA 2GW4B 5D69A 2BECA 2HQWA 4QJ5B 4NWSA 2GGZA 4RYWA 3DQFA 5DRFA 1B1GA 2WCJA 4HVFA 4F7FA 2OS8C 3PN7B 4KAGA 3DQDA 4MRXA 1SMGA 3I19A 3W1CA 2V4EB 1JFJA 2LUCA 1FW4A 2M0RA 1ALWA 2M29A 3AAKA 5BT0A 1YVHA 1IJ5A 2M3WA 1HQVA 2ARLA 3NEDA 2IB6A 1LKJA 4NDDA 1EMEA 3OX5A 2KI6C 2NCOA 2RGIA 3CZ1A 4FTGA 1KSMA 2LV7A 1CFPA 5HKWA 4RYSA 1YX8A 1OSAA 1S1EA 2Z6XA 3U8CA 2VAEA 4GF6B 3GK2A 1MF8B 1CM4A 1PK0D 2IOVA 4LJCA 1ZUXA 4GFTA 5LTQA 1TRFA 3SVUA 1KQMC 4MZKA 2B3QA 2WSOA 4GGFC 3IQOA 3NT9A 5EBJA 1GFLA 1XFVO 3FE8A 1L2OB 1Y1XA 3V2LA 1AHRA 4KF4A 1DGVA 3DVEA 2ERBA 1IWQA 2JWWA 5AANA 2FWQA 5DICA 2HCGA 3OB2B 5HKYA 1UHJA 2C9IA 3AI4A 5HLOA 5DKQA 3BFBA 1BOCA 5EXUA 2C9JA 2WCHA 4JEOA 2KI4B 1A4PA 3DQJA 4PALA 5H88A 2L2CA 3EK8A 2LMUA 2Y4QA 1SPYA 4MEWA 1YVLA 5FI2A 4AS8A 4W74A 3CD9A 3BUWB 4IZNA 4TZGA 4Q9WA 3I5IC 1YURA 4W7CA 2MLEC 2OTBA 1UHHA 3OGOA 3NSIA 3EVRA 2A52B 1MXEA 5EJUA 4W6JA 5EXBA 3DVMA 2Y1NA 3EVUA 4MSPA 2DDDA 2LNKA 3R1OA 1CTRA 3GK4X 1SY9A 2AWMA 4GGFA 2K61A 1T14A 3ED8A 3DQ1A 1ZUZA 2HPWA 4H3LA 3OBVA 1KYPA 3LL8B 3BFAA 3SS4A 4W6MA 4ZCVA 1SR6C 1EH2A 2KDHA 4IK8A 2DUEA 3D77A 1EMFA 1G33A 5FI6A 1RM9A 4W6BA 1S3PA 3PJBA 4W6KA 4AR7A 1NCYA 4I5NB 3VHTB 2QRFA 2IE2A 2FJUB 1K95A 2I18A 4B30A 2WCMA 1UISA 4E68A 1SCMB 4H47A 3PM2A 2O60A 3FS7A 1JC0A 1KSOA 3PJ5A 2YDZA 4AQIA 1UWOA 3D74A 1CKKA 2PYQA 2LHIA 3NSOA 3KCTA 4IK1A 3SSPA 1OZSA 3I5HB 2DUHA 3CWGA 2MA2A 5DTYA 3SS3A 2ZNEA 2HQKA 3ZNIA 3WHTB 2B1UA 1RROA 1IG5A 3QMEA 4BDUA 4DUQA 3TDZA 3WLDA 2LE9B 3SSVA 3FIAA 3K1KA 4JFGA 4ORNA 2OTGC 4W6PA 4ZBLA 3FWBA 2AWLA 3DQMA 4KF5C 5H87A 2ZMUA 3TMRA 5CSFA 3CD1A 2H6VA 1XMZA 1RFJA 2P71A 1XQMA 4W76A 3RM1A 2JQ6A 2K2FA 1QS7A 5KTYA 2KOTA 4YI9A 4Q7UA 2M1KB 4W6SA 1PVAA 3NT3A 1C07A 3P28A 3BUXB 1U5IB 1N65A 1NYAA 3PJIA 1CLMA 3DQ3A 1KP5A 3BFHA 4KW8A 4IK5A 1M46A 3CDNA 3C1VA 1KK7Y 1Q80A 3TS5B 4IK3A 3KO0A 4PHNA 5DPHA 4MRYA 3UO9A 2LLSA 1XFZO 1QIWA 1JBZA 2QLGB 5HZOA 3HX4A 4M2OA 1QXPA 4JRBA 2I94A 5AFPA 5DY6A 2O24A
chains in the Genus database with same CATH topology
1JWDA 2L0PA 1PSBA 2O2BA 3SSHA 2NLNA 3SIAA 1SL9A 2IB5A 2QLIA 1WY9A 2ZMWA 2WOSA 4LQTA 5I2QA 1YHIA 3O77A 2QPTA 1YTZC 4KF5A 4I5JA 1BG1A 4H3NA 1FPWA 1B8RA 1XA5A 2A56B 1J1DA 3EK4A 4W6RA 4NDCA 4YBHB 5BTTB 1M31A 4GOBA 2K8MB 2FL1A 4JGEA 1F54A 2ZN9A 2V4EC 1MWNA 4W6FA 4PE4A 1UP5A 1QVIZ 4W6TA 2VADA 2K0JA 1M63B 4TZAA 4XL5A 4Z4MA 1F4QA 1SW8A 1MXLC 1S6CA 3HCMA 2PXSA 2TN4A 4W6AA 2HETA 3EVPA 3M0WA 5IBWA 2LP2A 4MZLA 4J8AA 2M9GA 3BXBA 3M24A 2NXQA 3BX9A 4TNCA 2WCEA 2HF5A 2HQZA 1XK4C 3W1DA 3DQHA 4HQ8A 2JRFA 1XO5A 4JQ0D 1K8UA 1EL4A 1OXEA 4XVPA 2YFPA 1XAEA 1CB1A 4Q7RA 2CTNA 2OPOA 1W7UA 3PM8A 2KI6D 3U0NA 2MAZA 4Q9XA 2CNPA 5TNCA 3CFAA 1MOUA 3OHMB 2NZ0A 1N2DA 5HBDA 4W7FA 2LC5A 2KI4C 4LQUA 5I2OA 5HZTA 1OOJA 2V4EA 1NP8A 2KFHA 2JT8A 5ER4X 3DQEA 2HPSA 1CDLA 3A8RA 4DS7A 2PMYA 5LTRA 3WCKA 5F9GA 4W77A 2AWKA 3DVJA 4LJDA 3CBEA 1NCXA 2AHAA 1YUSA 2Q57A 1EMAA 1J7PA 1BU3A 2ZO7A 5HZUA 1GGZA 1QV0A 2BL0B 3IR8A 1VRKA 1H4BA 4EULA 2K2AA 1IQ3A 3TZ1A 1K94A 2PALA 1PSRA 3SIBA 3SSKA 2WCFA 2G16B 4LJBA 3ADFA 1D1OA 1XK4A 2KBMA 3CS1A 2L4HA 1Z1PA 1Q4CA 2CT9A 2A50B 2MRDA 1MYWA 1OMDA 4W6UA 5DTXA 4EMQA 3SVRA 1XA9A 5AQBB 3BYAA 2LMVA 1QIVA 4HREE 3LK0A 4M2QA 2F3ZA 4Q7TA 4NDBA 4HE4A 1LA3A 1S6IA 1NSHA 3FWCA 3SSYA 2KHNA 4OHSA 4HQ9A 4OCIA 3GJ2A 1K9PA 1SCMC 4OV2A 1QYQA 3DQAA 2JTZA 5GQQC 4DXQA 3TMTA 1JFKA 1YX7A 1XYDA 3ICBA 5HGEA 2LANA 1DJGA 1HT9A 3I5HC 5LK4A 5AERA 3CGLA 2CCMA 1Y1AA 3E5VA 2DD9A 2F2OA 2QLEA 3I5GB 2H61C 5CPVA 2A47A 4YGDB 3WXAA 4OGSA 3CB9A 2F2PA 1S26D 3VRPA 3VGOA 3PJ7A 3BQ3A 2GX2A 3WNXB 1ZGPA 2HJOA 1GGXA 4D1EA 3A8SA 1SYMA 2P6BB 5JOLA 2A46A 4P76A 1S6ZA 2PSRA 3CR2A 2K7OA 2POXA 5J3XA 2GV5A 2VZXA 3LS3A 4RTCA 1CDNA 4Q04A 4OY4A 1DGUA 2FCDA 1TN4A 4NQGA 1RMOA 1MUXA 1Q73A 3QRXA 2PVBA 3SSTA 2LUXA 1BF5A 1S6JA 3CR4X 5HYDA 4ZB1A 4J89A 4U2VA 5DKRA 3EKJA 2ZNDA 5PALA 1F71A 1XVJA 3TS5C 3IF7A 1DF0B 1A75B 2H5PA 3LLEA 1WDCB 3TDUA 5DPGA 1QXTA 4C0LA 4W6OA 1NCZA 4A4BA 1SCVA 4KEXA 2H5RA 2G9BA 3H1RA 2COLB 1HUYA 1S5GZ 2JNFA 2FCEA 1RJVA 4DXIA 1YFPA 1MHOA 3LK1A 2PXWA 3DPWA 2JU0A 1UHKA 4PE0A 1SL8A 2JZIA 1TTXA 4PPLA 1IRJA 5DU0A 2G2SB 2MHHA 1CNPA 1AJ5A 1IJ6A 4W6DA 4MZJA 2EGDA 1UURA 2Y0GA 2G6YA 3CLNA 4DXOA 2L4IA 2ZKMX 2DOQA 5FYXA 1U5IA 2Z1OA 1GQMA 4M2PA 1H8BA 1EG4A 1NX2A 3GL4A 1Z1QA 1JUOA 1Q4EA 1WRZA 4UPGA 3DPXA 1QJTA 1QLSA 4PHMA 3O6BA 5F6TA 4FQOA 4XOWA 1Q4BA 2I2RE 2ZFDA 3DQCA 2AWJA 3GJ1A 1MOVA 2QZ0A 2QLGA 5FVFA 2CXJA 1XFWO 4P2YB 1KQVA 2KAVA 2DDCA 4OVNF 2KAYA 3M22A 1QATA 3ZTFA 4KPIA 1EMMA 4W6CA 1YJ2A 3GB3A 2LLTA 5K89A 1OXFA 3DVKA 2A53B 4ZINA 1YRTB 2M49B 1PALA 2HGYA 4USLA 1BR4B 4W7DA 2QLHA 1TCOB 1JC2A 3CTNA 2D8NA 4PE7A 4DIRA 3O78A 1TNXA 3D0YB 4AQJA 3PLFB 4W6NA 2KYFA 2DUIA 5BQLA 2KYCA 1TOPA 3RWTA 3PATA 3OSRA 5BTTA 2L98A 2OKWA 3LVDA 1EJ3A 4OJ0A 1N0YA 1NX3A 1NPQA 3BUMB 1V1GA 2KBIA 3GOFA 3KEVA 2GW3A 3U0MA 2G6XA 3SRYA 3PALA 3SG4A 4N5XA 3VICA 3RLZA 5I2LA 5AEQA 3DQNA 1J1EA 2LAPA 4W7EA 4Z4KA 1B8CA 2H9WA 1S36A 3KHEA 2HRSA 3EK7A 2E6WA 3CFHA 1YJFA 5EB6A 3EVVA 4WQ3A 2ZRSA 2G6EA 3DQUA 4R6BA 2Q4UA 4HRGA 1TNWA 2BL0C 2MBXA 4OKHA 2LCPA 1QLKA 1YHHA 1GJYA 3NSLA 1DMOA 4ANJA 2LVIA 3UG0A 1MR8A 1RTP1 1GL4A 2KSPA 5I8NA 4CPVA 3BOWB 3DQKA 2LP3A 2G2BA 1A29A 1A03A 3LF4B 2H8QA 3V3DA 1ZGOA 2Z6ZA 1B9AA 4XOVA 2G3DB 2NCPA 2QU1A 2BKIB 1W7SA 4W72A 2WHTA 1TNPA 4U8DA 5LTPA 2DD7A 3SVOA 1KCYA 1B47A 1LVCD 2MJWB 2KNEA 1JC1A 1H4UA 3U8AA 1RECA 1ZMZA 3CR5X 5DRGA 1JSAA 5DQMA 3AAJA 2A4JA 1OMRA 4R1EA 4L9MA 1L7ZA 3I5GC 4I5LB 4XYNA 4PHKA 2JT0A 1Q4AA 3SG3A 1WLZA 3OSQA 3GK1A 1KK8B 3OP0A 1YHGA 3SG6A 4OR9B 4UTSA 4HSZA 1B9CA 1RMMA 2JXLA 4W6IA 2K7CA 1J7OA 1LA0A 4CIDA 1F8HA 2QACA 2VRGA 2JXCA 4WQ2A 1BODA 1CV7A 1CDMA 4JF9A 1FF1A 1C4FA 4DXPA 1EMGA 5DPIA 5HKZA 1X02A 4KGEA 1C7WA 2PRUA 3E5WA 4MVFA 2H5QA 4GUKA 2HGDA 3CGAA 2EMNA 1SK6D 3E3RA 1W7TA 1PVBA 3DPZA 1BFPA 1CFFA 1EXRA 2M97A 4LW5A 2YE1A 2JOJA 1YUTA 1K9KA 2OGRA 1KFUS 3LSAA 2K7BA 5KTGA 2BTJA 1TIZA 1KFXS 3SG5A 1WDCC 4BY5A 2L2EA 4EN1A 1HCJA 3O2PA 1KFUL 4GESB 3ST2A 4PPKA 1B7TZ 1F0BA 2QT2A 4L12A 1CFCA 1DTLA 1KFXL 1Q4DA 2MLFC 3O4YA 1DJHA 2O5GA 2WURA 2KGBC 1B8LA 4YRUA 3DQ5A 4GBAA 4XJKB 4YI8A 3DQ4A 3BXKA 5HZSA 2R2IA 3LCPC 2L50A 4EDSA 3E5TA 5EXCI 1BT6A 4PDZA 1XFUO 1RRXA 1NIWA 4ZCUA 2EMDA 1QVIY 5DPJA 3SVCA 2EMOA 3VRNA 1UUSA 3GEXA 3DQ7A 3DF0B 1AVSA 4W69A 4MBEA 3LF3A 1YR5A 2WC8A 1QX5B 3BXAA 2JPTA 2ISDA 3VRQA 3NSKA 3I5FB 4YGCB 2WNDA 4DKMA 1XFYO 1EMCA 1BMOA 4DCKA 2L5XB 1DF0A 3VROA 3S05A 5DTZA 1J7QA 1A75A 3DQ2A 4CFRA 1OMVA 3TUYB 3SJSA 4IK9A 1QYFA 1DJWA 4W6LA 1SNLA 2F8PA 4JWQA 4PPJA 1ZOTB 3SG2A 4P1QA 4J88A 2JULA 3BXCA 3PIBA 4IK4A 2OTEA 3ZUJA 3DQLA 1UHIA 1K2HA 5JJGA 1CMFA 4MLWA 4ZFSA 2HQ8A 3SS0A 1FI6A 1NX1A 1PRWA 3AI5A 3OX6A 4C0KA 1YZWA 2JADA 1QTXA 3VHTA 2AUCA 2WSNA 3NEZA 2RH7A 1G8IA 1YRUB 2LVVA 1H6RA 2SCPA 3JVTB 2B3PA 3SV5A 4PCWA 1WRLA 3DD4A 1EMBA 3DQ8A 4L1IA 3ST4A 1F55A 1KK7Z 3DQIA 4DXNA 5HW9A 3SVNA 3NF0A 2WORA 5D7FA 2LHLA 1EMLA 2EC6B 3G9AA 4AOMA 2LVKA 4DRWA 2H61A 2KQYA 2BCAA 2WISA 5ER5A 1DT7B 4HRHA 4N1FA 1EMKA 2SASA 2DUGA 2L51A 4GAOA 1B7TY 2KQ6A 4N3DA 3RWAA 2F33A 1B4CA 2GGMA 4N1GA 3JTDB 1M45A 1DJXA 4W6HA 4ZF3A 4H48A 2BCBA 2VVIA 3SSLA 1QASA 2IS9A 2OS8B 3AKAA 2O29A 1G4YR 5FVGA 5KU1A 4ZF4A 5AXIA 1RMPA 1DJIA 3D0YA 3IP2A 1CLBA 2H2KA 4ICBA 4QJ4B 5T3IA 1TCFA 1GGWA 1JBAA 3SVEA 5CSJA 1FI5A 2BBMA 1OQPA 1NWDA 4GGNA 2OKYA 3DQ9A 3U0KA 2YE0A 3SVSA 3ST0A 2JC2A 5KSZA 2LLUA 2WIQA 4H3MA 2LM5A 1ZACA 1KYRA 1R6PA 1ZFSA 4W7AA 3DQOA 1QYOA 3ZULA 1J7RA 4CLNA 4ORAB 4EDOA 2KFGA 1KQMB 1UHNA 2Y5IA 5FVIA 1KK8C 2Q91A 3MSEB 3K21A 1CMGA 4YGAA 2LMTA 3CZTX 3WHUB 5B8IB 1IH0A 3U0LA 3BOWA 4B30B 2ZN8A 3D10A 1IQ5A 1WLMA 2CBLA 1KWOC 5H89A 4C0JA 1Y1UA 4A4CA 2LVJA 2A48A 1K93D 4W73A 5EB7A 3SVDA 1AJ4A 3P8UA 4QJ3B 2BE6A 1EG3A 1JF0A 1SL7A 2K7DA 4IL1A 3VK1A 3I5IB 4YGEB 4OQWA 4KA9A 4GNKB 3SG7A 3CFFA 1LXFC 1R2UA 2BCXA 2M7NA 1OZOA 4BY4A 1IGVA 1QY3A 2HFCA 1XFXO 2FOTA 1ODBA 3PFVA 4KW9A 1QV1A 4W75A 3A4UB 2JT3A 5DTLA 1S5GY 4XGYA 2WCBA 2ICRA 3LVCA 4I2YA 1C7VA 1F4OA 1W7JB 4F0ZB 4ORCB 2Z6YA 1A2XA 1IKUA 1SR6B 2M1UA 1CM1A 5G08A 1J55A 2EHBA 1BLQA 1CFDA 2A54B 2JNXA 2G3OA 3PSRA 3AKOA 4YGBB 2BE4A 4HQCA 1AUIB 2F3YA 3BUOB 1M39A 3PN7C 1LINA 4L13A 3LVAA 1TNQA 3DQ6A 4ZIOA 3U8PA 2KGRA 2M8UA 1SBJA 1QX2A 2OJKA 5CSNA 1AK8A 3EKHA 2G5ZB 1K9UA 3OB1B 4LJDC 3H1OA 3F45A 2VVJA 3I5FC 5HLVA 5CSIA 2H5OA 4JC2A 1FBVA 4P5OE 2OTGB 2PASA 3H4SE 2P4MA 1F09A 3TUYC 1ZGQA 2V53A 1W7IB 2VVHA 2Q6PA 1NUBA 1DJZA 4ZF5A 2M7LA 1KYSA 4ORBB 5EHUA 2JTTA 1G7KA 5FHVA 3ST3A 3TDIA 4DKNA 1OXDA 1Y6WA 1AP4A 1JBYA 1L2OC 1K96A 3AKBA 3SVBA 5J2OA 4XJKA 1JF2A 4ETOA 1KWOB 2ZO6A 2WHSA 2FZUA 4WRIA 1CLLA 1BR1B 2WHUA 1WRKA 1Y0VH 4R6DA 3UFZA 2I7AA 4JPZB 1QX7A 1ALVA 2AMIA 3KPXA 3JVTC 3ZWHA 1V1FA 2E30A 1XSSA 2ZRTA 1K90D 4CFQA 3IQQA 4W6GA 3VRRA 5BPJA 4PFEA 4B5YA 1NX0A 3BUNB 4DXMA 1DJYA 2KAXA 3NXAA 2KFFA 4PHJA 3DF0A 1CDPA 2AH8A 2DUFA 4KGFA 2Y1MA 4I5KA 3WLCA 1YUUA 4MN0A 2EC6C 3ZUFA 4KW4A 1PULA 4PE1A 1SRAA 2BKHB 3KCSA 2GX0A 1BJFA 5DKNA 3MGFA 3LA1A 1OE9B 1RK9A 4GPLB 4W7RA 1E8AA 1SKTA 1F70A 3KF9A 1DVIA 1RWYA 2AAOA 4W7XA 3JTDC 1MQ1A 2BBNA 5DQBA 2GW4B 5D69A 2BECA 2HQWA 4QJ5B 4NWSA 2GGZA 4RYWA 3DQFA 5DRFA 1B1GA 4HVFA 2OS8C 3PN7B 4KAGA 3DQDA 4MRXA 1SMGA 3I19A 3W1CA 2V4EB 1JFJA 2LUCA 1FW4A 2M0RA 1ALWA 2M29A 3AAKA 5BT0A 1YVHA 1IJ5A 2M3WA 1HQVA 2ARLA 3NEDA 2IB6A 1LKJA 4NDDA 1EMEA 3OX5A 2KI6C 2NCOA 2RGIA 4FTGA 1KSMA 2LV7A 1CFPA 5HKWA 4RYSA 1YX8A 1OSAA 1S1EA 2Z6XA 3U8CA 2VAEA 4GF6B 3GK2A 1MF8B 1CM4A 1PK0D 2IOVA 4LJCA 1ZUXA 4GFTA 5LTQA 1TRFA 3SVUA 1KQMC 4MZKA 2B3QA 2WSOA 4GGFC 3IQOA 3NT9A 5EBJA 1GFLA 1XFVO 1L2OB 1Y1XA 4KF4A 1AHRA 1DGVA 3DVEA 1IWQA 2JWWA 5AANA 2FWQA 2HCGA 3OB2B 5HKYA 1UHJA 2C9IA 3AI4A 5HLOA 5DKQA 1BOCA 5EXUA 2C9JA 4JEOA 2KI4B 1A4PA 3DQJA 4PALA 5H88A 3EK8A 2LMUA 2Y4QA 1SPYA 4MEWA 1YVLA 4AS8A 4W74A 3CD9A 3BUWB 4IZNA 4TZGA 4Q9WA 3I5IC 1YURA 4W7CA 2MLEC 2OTBA 1UHHA 3OGOA 3NSIA 3EVRA 2A52B 1MXEA 5EJUA 4W6JA 5EXBA 3DVMA 2Y1NA 3EVUA 4MSPA 2DDDA 2LNKA 1CTRA 3GK4X 1SY9A 2AWMA 4GGFA 2K61A 3ED8A 3DQ1A 1ZUZA 2HPWA 4H3LA 1KYPA 3LL8B 4W6MA 4ZCVA 1SR6C 1EH2A 2KDHA 4IK8A 2DUEA 1EMFA 1G33A 1RM9A 4W6BA 1S3PA 3PJBA 4W6KA 4AR7A 1NCYA 4I5NB 3VHTB 2QRFA 2IE2A 2FJUB 1K95A 2I18A 4B30A 1UISA 4E68A 1SCMB 4H47A 2O60A 3FS7A 1JC0A 1KSOA 3PJ5A 2YDZA 4AQIA 1UWOA 1CKKA 2LHIA 3NSOA 3KCTA 4IK1A 3SSPA 1OZSA 3I5HB 2DUHA 3CWGA 2MA2A 5DTYA 2ZNEA 2HQKA 3ZNIA 3WHTB 2B1UA 1RROA 1IG5A 4BDUA 4DUQA 3TDZA 3WLDA 2LE9B 3SSVA 3FIAA 3K1KA 4JFGA 4ORNA 2OTGC 4W6PA 4ZBLA 3FWBA 2AWLA 3DQMA 4KF5C 5H87A 2ZMUA 3TMRA 5CSFA 3CD1A 2H6VA 1XMZA 1RFJA 1XQMA 4W76A 3RM1A 2JQ6A 2K2FA 1QS7A 5KTYA 2KOTA 4YI9A 4Q7UA 2M1KB 4W6SA 1PVAA 3NT3A 1C07A 3P28A 3BUXB 1U5IB 1N65A 1NYAA 1CLMA 3DQ3A 1KP5A 4KW8A 4IK5A 1M46A 3C1VA 1KK7Y 1Q80A 3TS5B 4IK3A 3KO0A 4PHNA 5DPHA 4MRYA 2LLSA 1XFZO 1QIWA 1JBZA 2QLGB 5HZOA 3HX4A 4M2OA 1QXPA 4JRBA 2I94A 5AFPA 5DY6A 2O24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWD A;  2L0P A;  1PSB A;  2O2B A;  3SSH A;  2NLN A;  3SIA A;  1SL9 A;  2IB5 A;  2QLI A;  1WY9 A;  2ZMW A;  2WOS A;  4LQT A;  5I2Q A;  1YHI A;  3O77 A;  2QPT A;  1YTZ C;  4KF5 A;  4I5J A;  1BG1 A;  4H3N A;  1FPW A;  1B8R A;  1XA5 A;  2A56 B;  1J1D A;  3EK4 A;  4W6R A;  4NDC A;  4YBH B;  5BTT B;  1M31 A;  4GOB A;  2K8M B;  2FL1 A;  4JGE A;  1F54 A;  2ZN9 A;  2V4E C;  1MWN A;  4W6F A;  4PE4 A;  1UP5 A;  1QVI Z;  4W6T A;  2VAD A;  2K0J A;  1M63 B;  4TZA A;  4XL5 A;  4Z4M A;  1F4Q A;  1SW8 A;  1MXL C;  1S6C A;  3HCM A;  2PXS A;  2TN4 A;  4W6A A;  2HET A;  3EVP A;  3M0W A;  5IBW A;  2LP2 A;  4MZL A;  4J8A A;  2M9G A;  3BXB A;  3M24 A;  2NXQ A;  3BX9 A;  4TNC A;  2WCE A;  2HF5 A;  2HQZ A;  1XK4 C;  3W1D A;  3DQH A;  4HQ8 A;  2JRF A;  1XO5 A;  4JQ0 D;  1K8U A;  1EL4 A;  1OXE A;  4XVP A;  2YFP A;  1XAE A;  1CB1 A;  4Q7R A;  2CTN A;  2OPO A;  1W7U A;  3PM8 A;  2KI6 D;  3U0N A;  2MAZ A;  4Q9X A;  2CNP A;  5TNC A;  3CFA A;  1MOU A;  3OHM B;  2NZ0 A;  1N2D A;  5HBD A;  4W7F A;  2LC5 A;  2KI4 C;  4LQU A;  5I2O A;  5HZT A;  1OOJ A;  2V4E A;  1NP8 A;  2KFH A;  2JT8 A;  5ER4 X;  3DQE A;  2HPS A;  1CDL A;  3A8R A;  4DS7 A;  2PMY A;  5LTR A;  3WCK A;  5F9G A;  4W77 A;  2AWK A;  3DVJ A;  4LJD A;  3CBE A;  1NCX A;  2AHA A;  1YUS A;  2Q57 A;  1EMA A;  1J7P A;  1BU3 A;  2ZO7 A;  5HZU A;  1GGZ A;  1QV0 A;  2BL0 B;  3IR8 A;  1VRK A;  1H4B A;  4EUL A;  2K2A A;  1IQ3 A;  3TZ1 A;  1K94 A;  2PAL A;  1PSR A;  3SIB A;  3SSK A;  2WCF A;  2G16 B;  4LJB A;  3ADF A;  1D1O A;  1XK4 A;  2KBM A;  3CS1 A;  2L4H A;  1Z1P A;  1Q4C A;  2CT9 A;  2A50 B;  2MRD A;  1MYW A;  1OMD A;  4W6U A;  5DTX A;  4EMQ A;  3SVR A;  1XA9 A;  5AQB B;  3BYA A;  2LMV A;  1QIV A;  4HRE E;  3LK0 A;  4M2Q A;  2F3Z A;  4Q7T A;  4NDB A;  4HE4 A;  1LA3 A;  1S6I A;  1NSH A;  3FWC A;  3SSY A;  2KHN A;  4OHS A;  4HQ9 A;  4OCI A;  3GJ2 A;  1K9P A;  1SCM C;  4OV2 A;  1QYQ A;  3DQA A;  2JTZ A;  5GQQ C;  4DXQ A;  3TMT A;  1JFK A;  1YX7 A;  1XYD A;  3ICB A;  5HGE A;  2LAN A;  1DJG A;  1HT9 A;  3I5H C;  5LK4 A;  5AER A;  3CGL A;  2CCM A;  1Y1A A;  3E5V A;  2DD9 A;  2F2O A;  2QLE A;  3I5G B;  2H61 C;  5CPV A;  2A47 A;  4YGD B;  3WXA A;  4OGS A;  3CB9 A;  2F2P A;  1S26 D;  3VRP A;  3VGO A;  3PJ7 A;  3BQ3 A;  2GX2 A;  3WNX B;  1ZGP A;  2HJO A;  1GGX A;  4D1E A;  3A8S A;  1SYM A;  2P6B B;  5JOL A;  2A46 A;  4P76 A;  1S6Z A;  2PSR A;  3CR2 A;  2K7O A;  2POX A;  5J3X A;  2GV5 A;  2VZX A;  3LS3 A;  4RTC A;  1CDN A;  4Q04 A;  4OY4 A;  1DGU A;  2FCD A;  1TN4 A;  4NQG A;  1RMO A;  1MUX A;  1Q73 A;  3QRX A;  2PVB A;  3SST A;  2LUX A;  1BF5 A;  1S6J A;  3CR4 X;  5HYD A;  4ZB1 A;  4J89 A;  4U2V A;  5DKR A;  3EKJ A;  2ZND A;  5PAL A;  1F71 A;  1XVJ A;  3TS5 C;  3IF7 A;  1DF0 B;  1A75 B;  2H5P A;  3LLE A;  1WDC B;  3TDU A;  5DPG A;  1QXT A;  4C0L A;  4W6O A;  1NCZ A;  4A4B A;  1SCV A;  4KEX A;  2H5R A;  2G9B A;  3H1R A;  2COL B;  1HUY A;  1S5G Z;  2JNF A;  2FCE A;  1RJV A;  4DXI A;  1YFP A;  1MHO A;  3LK1 A;  2PXW A;  3DPW A;  2JU0 A;  1UHK A;  4PE0 A;  1SL8 A;  2JZI A;  1TTX A;  4PPL A;  1IRJ A;  5DU0 A;  2G2S B;  2MHH A;  1CNP A;  1AJ5 A;  1IJ6 A;  4W6D A;  4MZJ A;  2EGD A;  1UUR A;  2Y0G A;  2G6Y A;  3CLN A;  4DXO A;  2L4I A;  2ZKM X;  2DOQ A;  5FYX A;  1U5I A;  2Z1O A;  1GQM A;  4M2P A;  1H8B A;  1EG4 A;  1NX2 A;  3GL4 A;  1Z1Q A;  1JUO A;  1Q4E A;  1WRZ A;  4UPG A;  3DPX A;  1QJT A;  1QLS A;  4PHM A;  3O6B A;  5F6T A;  4FQO A;  4XOW A;  1Q4B A;  2I2R E;  2ZFD A;  3DQC A;  2AWJ A;  3GJ1 A;  1MOV A;  2QZ0 A;  2QLG A;  5FVF A;  2CXJ A;  1XFW O;  4P2Y B;  1KQV A;  2KAV A;  2DDC A;  4OVN F;  2KAY A;  3M22 A;  1QAT A;  3ZTF A;  4KPI A;  1EMM A;  4W6C A;  1YJ2 A;  3GB3 A;  2LLT A;  5K89 A;  1OXF A;  3DVK A;  2A53 B;  4ZIN A;  1YRT B;  2M49 B;  1PAL A;  2HGY A;  4USL A;  1BR4 B;  4W7D A;  2QLH A;  1TCO B;  1JC2 A;  3CTN A;  2D8N A;  4PE7 A;  4DIR A;  3O78 A;  1TNX A;  3D0Y B;  4AQJ A;  3PLF B;  4W6N A;  2KYF A;  2DUI A;  5BQL A;  2KYC A;  1TOP A;  3RWT A;  3PAT A;  3OSR A;  5BTT A;  2L98 A;  2OKW A;  3LVD A;  1EJ3 A;  4OJ0 A;  1N0Y A;  1NX3 A;  1NPQ A;  3BUM B;  1V1G A;  2KBI A;  3GOF A;  3KEV A;  2GW3 A;  3U0M A;  2G6X A;  3SRY A;  3PAL A;  3SG4 A;  4N5X A;  3VIC A;  3RLZ A;  5I2L A;  5AEQ A;  3DQN A;  1J1E A;  2LAP A;  4W7E A;  4Z4K A;  1B8C A;  2H9W A;  1S36 A;  3KHE A;  2HRS A;  3EK7 A;  2E6W A;  3CFH A;  1YJF A;  5EB6 A;  3EVV A;  4WQ3 A;  2ZRS A;  2G6E A;  3DQU A;  4R6B A;  2Q4U A;  4HRG A;  1TNW A;  2BL0 C;  2MBX A;  4OKH A;  2LCP A;  1QLK A;  1YHH A;  1GJY A;  3NSL A;  1DMO A;  4ANJ A;  2LVI A;  3UG0 A;  1MR8 A;  1RTP 1;  1GL4 A;  2KSP A;  5I8N A;  4CPV A;  3BOW B;  3DQK A;  2LP3 A;  2G2B A;  1A29 A;  1A03 A;  3LF4 B;  2H8Q A;  3V3D A;  1ZGO A;  2Z6Z A;  1B9A A;  4XOV A;  2G3D B;  2NCP A;  2QU1 A;  2BKI B;  1W7S A;  4W72 A;  2WHT A;  1TNP A;  4U8D A;  5LTP A;  2DD7 A;  3SVO A;  1KCY A;  1B47 A;  1LVC D;  2MJW B;  2KNE A;  1JC1 A;  1H4U A;  3U8A A;  1REC A;  1ZMZ A;  3CR5 X;  5DRG A;  1JSA A;  5DQM A;  3AAJ A;  2A4J A;  1OMR A;  4R1E A;  4L9M A;  1L7Z A;  3I5G C;  4I5L B;  4XYN A;  4PHK A;  2JT0 A;  1Q4A A;  3SG3 A;  1WLZ A;  3OSQ A;  3GK1 A;  1KK8 B;  3OP0 A;  1YHG A;  3SG6 A;  4OR9 B;  4UTS A;  4HSZ A;  1B9C A;  1RMM A;  2JXL A;  4W6I A;  2K7C A;  1J7O A;  1LA0 A;  4CID A;  1F8H A;  2QAC A;  2VRG A;  2JXC A;  4WQ2 A;  1BOD A;  1CV7 A;  1CDM A;  4JF9 A;  1FF1 A;  1C4F A;  4DXP A;  1EMG A;  5DPI A;  5HKZ A;  1X02 A;  4KGE A;  1C7W A;  2PRU A;  3E5W A;  4MVF A;  2H5Q A;  4GUK A;  2HGD A;  3CGA A;  2EMN A;  1SK6 D;  3E3R A;  1W7T A;  1PVB A;  3DPZ A;  1BFP A;  1CFF A;  1EXR A;  2M97 A;  4LW5 A;  2YE1 A;  2JOJ A;  1YUT A;  1K9K A;  2OGR A;  1KFU S;  3LSA A;  2K7B A;  5KTG A;  2BTJ A;  1TIZ A;  1KFX S;  3SG5 A;  1WDC C;  4BY5 A;  2L2E A;  4EN1 A;  1HCJ A;  3O2P A;  1KFU L;  4GES B;  3ST2 A;  4PPK A;  1B7T Z;  1F0B A;  2QT2 A;  4L12 A;  1CFC A;  1DTL A;  1KFX L;  1Q4D A;  2MLF C;  3O4Y A;  1DJH A;  2O5G A;  2WUR A;  2KGB C;  1B8L A;  4YRU A;  3DQ5 A;  4GBA A;  4XJK B;  4YI8 A;  3DQ4 A;  3BXK A;  5HZS A;  2R2I A;  3LCP C;  2L50 A;  4EDS A;  3E5T A;  5EXC I;  1BT6 A;  4PDZ A;  1XFU O;  1RRX A;  1NIW A;  4ZCU A;  2EMD A;  1QVI Y;  5DPJ A;  3SVC A;  2EMO A;  3VRN A;  1UUS A;  3GEX A;  3DQ7 A;  3DF0 B;  1AVS A;  4W69 A;  4MBE A;  3LF3 A;  1YR5 A;  2WC8 A;  1QX5 B;  3BXA A;  2JPT A;  2ISD A;  3VRQ A;  3NSK A;  3I5F B;  4YGC B;  2WND A;  4DKM A;  1XFY O;  1EMC A;  1BMO A;  4DCK A;  2L5X B;  1DF0 A;  3VRO A;  3S05 A;  5DTZ A;  1J7Q A;  1A75 A;  3DQ2 A;  4CFR A;  1OMV A;  3TUY B;  3SJS A;  4IK9 A;  1QYF A;  1DJW A;  4W6L A;  1SNL A;  2F8P A;  4JWQ A;  4PPJ A;  1ZOT B;  3SG2 A;  4P1Q A;  4J88 A;  2JUL A;  3BXC A;  3PIB A;  4IK4 A;  2OTE A;  3ZUJ A;  3DQL A;  1UHI A;  1K2H A;  5JJG A;  1CMF A;  4MLW A;  4ZFS A;  2HQ8 A;  3SS0 A;  1FI6 A;  1NX1 A;  1PRW A;  3AI5 A;  3OX6 A;  4C0K A;  1YZW A;  2JAD A;  1QTX A;  3VHT A;  2AUC A;  2WSN A;  3NEZ A;  2RH7 A;  1G8I A;  1YRU B;  2LVV A;  1H6R A;  2SCP A;  3JVT B;  2B3P A;  3SV5 A;  4PCW A;  1WRL A;  3DD4 A;  1EMB A;  3DQ8 A;  4L1I A;  3ST4 A;  1F55 A;  1KK7 Z;  3DQI A;  4DXN A;  5HW9 A;  3SVN A;  3NF0 A;  2WOR A;  5D7F A;  2LHL A;  1EML A;  2EC6 B;  3G9A A;  4AOM A;  2LVK A;  4DRW A;  2H61 A;  2KQY A;  2BCA A;  2WIS A;  5ER5 A;  1DT7 B;  4HRH A;  4N1F A;  1EMK A;  2SAS A;  2DUG A;  2L51 A;  4GAO A;  1B7T Y;  2KQ6 A;  4N3D A;  3RWA A;  2F33 A;  1B4C A;  2GGM A;  4N1G A;  3JTD B;  1M45 A;  1DJX A;  4W6H A;  4ZF3 A;  4H48 A;  2BCB A;  2VVI A;  3SSL A;  1QAS A;  2IS9 A;  2OS8 B;  3AKA A;  2O29 A;  1G4Y R;  5FVG A;  5KU1 A;  4ZF4 A;  5AXI A;  1RMP A;  1DJI A;  3D0Y A;  3IP2 A;  1CLB A;  2H2K A;  4ICB A;  4QJ4 B;  5T3I A;  1TCF A;  1GGW A;  1JBA A;  3SVE A;  5CSJ A;  1FI5 A;  2BBM A;  1OQP A;  1NWD A;  4GGN A;  2OKY A;  3DQ9 A;  3U0K A;  2YE0 A;  3SVS A;  3ST0 A;  2JC2 A;  5KSZ A;  2LLU A;  2WIQ A;  4H3M A;  2LM5 A;  1ZAC A;  1KYR A;  1R6P A;  1ZFS A;  4W7A A;  3DQO A;  1QYO A;  3ZUL A;  1J7R A;  4CLN A;  4ORA B;  4EDO A;  2KFG A;  1KQM B;  1UHN A;  2Y5I A;  5FVI A;  1KK8 C;  2Q91 A;  3MSE B;  3K21 A;  1CMG A;  4YGA A;  2LMT A;  3CZT X;  3WHU B;  5B8I B;  1IH0 A;  3U0L A;  3BOW A;  4B30 B;  2ZN8 A;  3D10 A;  1IQ5 A;  1WLM A;  2CBL A;  1KWO C;  5H89 A;  4C0J A;  1Y1U A;  4A4C A;  2LVJ A;  2A48 A;  1K93 D;  4W73 A;  5EB7 A;  3SVD A;  1AJ4 A;  3P8U A;  4QJ3 B;  2BE6 A;  1EG3 A;  1JF0 A;  1SL7 A;  2K7D A;  4IL1 A;  3VK1 A;  3I5I B;  4YGE B;  4OQW A;  4KA9 A;  4GNK B;  3SG7 A;  3CFF A;  1LXF C;  1R2U A;  2BCX A;  2M7N A;  1OZO A;  4BY4 A;  1IGV A;  1QY3 A;  2HFC A;  1XFX O;  2FOT A;  1ODB A;  3PFV A;  4KW9 A;  1QV1 A;  4W75 A;  3A4U B;  2JT3 A;  5DTL A;  1S5G Y;  4XGY A;  2WCB A;  2ICR A;  3LVC A;  4I2Y A;  1C7V A;  1F4O A;  1W7J B;  4F0Z B;  4ORC B;  2Z6Y A;  1A2X A;  1IKU A;  1SR6 B;  2M1U A;  1CM1 A;  5G08 A;  1J55 A;  2EHB A;  1BLQ A;  1CFD A;  2A54 B;  2JNX A;  2G3O A;  3PSR A;  3AKO A;  4YGB B;  2BE4 A;  4HQC A;  1AUI B;  2F3Y A;  3BUO B;  1M39 A;  3PN7 C;  1LIN A;  4L13 A;  3LVA A;  1TNQ A;  3DQ6 A;  4ZIO A;  3U8P A;  2KGR A;  2M8U A;  1SBJ A;  1QX2 A;  2OJK A;  5CSN A;  1AK8 A;  3EKH A;  2G5Z B;  1K9U A;  3OB1 B;  4LJD C;  3H1O A;  3F45 A;  2VVJ A;  3I5F C;  5HLV A;  5CSI A;  2H5O A;  4JC2 A;  1FBV A;  4P5O E;  2OTG B;  2PAS A;  3H4S E;  2P4M A;  1F09 A;  3TUY C;  1ZGQ A;  2V53 A;  1W7I B;  2VVH A;  2Q6P A;  1NUB A;  1DJZ A;  4ZF5 A;  2M7L A;  1KYS A;  4ORB B;  5EHU A;  2JTT A;  1G7K A;  5FHV A;  3ST3 A;  3TDI A;  4DKN A;  1OXD A;  1Y6W A;  1AP4 A;  1JBY A;  1L2O C;  1K96 A;  3AKB A;  3SVB A;  5J2O A;  4XJK A;  1JF2 A;  4ETO A;  1KWO B;  2ZO6 A;  2WHS A;  2FZU A;  4WRI A;  1CLL A;  1BR1 B;  2WHU A;  1WRK A;  1Y0V H;  4R6D A;  3UFZ A;  2I7A A;  4JPZ B;  1QX7 A;  1ALV A;  2AMI A;  3KPX A;  3JVT C;  3ZWH A;  1V1F A;  2E30 A;  1XSS A;  2ZRT A;  1K90 D;  4CFQ A;  3IQQ A;  4W6G A;  3VRR A;  5BPJ A;  4PFE A;  4B5Y A;  1NX0 A;  3BUN B;  4DXM A;  1DJY A;  2KAX A;  3NXA A;  2KFF A;  4PHJ A;  3DF0 A;  1CDP A;  2AH8 A;  2DUF A;  4KGF A;  2Y1M A;  4I5K A;  3WLC A;  1YUU A;  4MN0 A;  2EC6 C;  3ZUF A;  4KW4 A;  1PUL A;  4PE1 A;  1SRA A;  2BKH B;  3KCS A;  2GX0 A;  1BJF A;  5DKN A;  3MGF A;  3LA1 A;  1OE9 B;  1RK9 A;  4GPL B;  4W7R A;  1E8A A;  1SKT A;  1F70 A;  3KF9 A;  1DVI A;  1RWY A;  2AAO A;  4W7X A;  3JTD C;  1MQ1 A;  2BBN A;  5DQB A;  2GW4 B;  5D69 A;  2BEC A;  2HQW A;  4QJ5 B;  4NWS A;  2GGZ A;  4RYW A;  3DQF A;  5DRF A;  1B1G A;  4HVF A;  2OS8 C;  3PN7 B;  4KAG A;  3DQD A;  4MRX A;  1SMG A;  3I19 A;  3W1C A;  2V4E B;  1JFJ A;  2LUC A;  1FW4 A;  2M0R A;  1ALW A;  2M29 A;  3AAK A;  5BT0 A;  1YVH A;  1IJ5 A;  2M3W A;  1HQV A;  2ARL A;  3NED A;  2IB6 A;  1LKJ A;  4NDD A;  1EME A;  3OX5 A;  2KI6 C;  2NCO A;  2RGI A;  4FTG A;  1KSM A;  2LV7 A;  1CFP A;  5HKW A;  4RYS A;  1YX8 A;  1OSA A;  1S1E A;  2Z6X A;  3U8C A;  2VAE A;  4GF6 B;  3GK2 A;  1MF8 B;  1CM4 A;  1PK0 D;  2IOV A;  4LJC A;  1ZUX A;  4GFT A;  5LTQ A;  1TRF A;  3SVU A;  1KQM C;  4MZK A;  2B3Q A;  2WSO A;  4GGF C;  3IQO A;  3NT9 A;  5EBJ A;  1GFL A;  1XFV O;  1L2O B;  1Y1X A;  4KF4 A;  1AHR A;  1DGV A;  3DVE A;  1IWQ A;  2JWW A;  5AAN A;  2FWQ A;  2HCG A;  3OB2 B;  5HKY A;  1UHJ A;  2C9I A;  3AI4 A;  5HLO A;  5DKQ A;  1BOC A;  5EXU A;  2C9J A;  4JEO A;  2KI4 B;  1A4P A;  3DQJ A;  4PAL A;  5H88 A;  3EK8 A;  2LMU A;  2Y4Q A;  1SPY A;  4MEW A;  1YVL A;  4AS8 A;  4W74 A;  3CD9 A;  3BUW B;  4IZN A;  4TZG A;  4Q9W A;  3I5I C;  1YUR A;  4W7C A;  2MLE C;  2OTB A;  1UHH A;  3OGO A;  3NSI A;  3EVR A;  2A52 B;  1MXE A;  5EJU A;  4W6J A;  5EXB A;  3DVM A;  2Y1N A;  3EVU A;  4MSP A;  2DDD A;  2LNK A;  1CTR A;  3GK4 X;  1SY9 A;  2AWM A;  4GGF A;  2K61 A;  3ED8 A;  3DQ1 A;  1ZUZ A;  2HPW A;  4H3L A;  1KYP A;  3LL8 B;  4W6M A;  4ZCV A;  1SR6 C;  1EH2 A;  2KDH A;  4IK8 A;  2DUE A;  1EMF A;  1G33 A;  1RM9 A;  4W6B A;  1S3P A;  3PJB A;  4W6K A;  4AR7 A;  1NCY A;  4I5N B;  3VHT B;  2QRF A;  2IE2 A;  2FJU B;  1K95 A;  2I18 A;  4B30 A;  1UIS A;  4E68 A;  1SCM B;  4H47 A;  2O60 A;  3FS7 A;  1JC0 A;  1KSO A;  3PJ5 A;  2YDZ A;  4AQI A;  1UWO A;  1CKK A;  2LHI A;  3NSO A;  3KCT A;  4IK1 A;  3SSP A;  1OZS A;  3I5H B;  2DUH A;  3CWG A;  2MA2 A;  5DTY A;  2ZNE A;  2HQK A;  3ZNI A;  3WHT B;  2B1U A;  1RRO A;  1IG5 A;  4BDU A;  4DUQ A;  3TDZ A;  3WLD A;  2LE9 B;  3SSV A;  3FIA A;  3K1K A;  4JFG A;  4ORN A;  2OTG C;  4W6P A;  4ZBL A;  3FWB A;  2AWL A;  3DQM A;  4KF5 C;  5H87 A;  2ZMU A;  3TMR A;  5CSF A;  3CD1 A;  2H6V A;  1XMZ A;  1RFJ A;  1XQM A;  4W76 A;  3RM1 A;  2JQ6 A;  2K2F A;  1QS7 A;  5KTY A;  2KOT A;  4YI9 A;  4Q7U A;  2M1K B;  4W6S A;  1PVA A;  3NT3 A;  1C07 A;  3P28 A;  3BUX B;  1U5I B;  1N65 A;  1NYA A;  1CLM A;  3DQ3 A;  1KP5 A;  4KW8 A;  4IK5 A;  1M46 A;  3C1V A;  1KK7 Y;  1Q80 A;  3TS5 B;  4IK3 A;  3KO0 A;  4PHN A;  5DPH A;  4MRY A;  2LLS A;  1XFZ O;  1QIW A;  1JBZ A;  2QLG B;  5HZO A;  3HX4 A;  4M2O A;  1QXP A;  4JRB A;  2I94 A;  5AFP A;  5DY6 A;  2O24 A; 
#chains in the Genus database with same CATH topology
 2P70 A;  1JWD A;  2L0P A;  1PSB A;  2O2B A;  3SSH A;  3DY9 A;  2NLN A;  3SIA A;  1SL9 A;  2IB5 A;  2QLI A;  1WY9 A;  2ZMW A;  2WOS A;  4LQT A;  5I2Q A;  1YHI A;  3O77 A;  2QPT A;  1YTZ C;  4KF5 A;  4I5J A;  2WC5 A;  1BG1 A;  4H3N A;  1FPW A;  1B8R A;  4KYN A;  1XA5 A;  2A56 B;  1J1D A;  3EK4 A;  4W6R A;  4NDC A;  4YBH B;  5BTT B;  1M31 A;  4GOB A;  2K8M B;  2FL1 A;  4JGE A;  1F54 A;  2ZN9 A;  2V4E C;  1MWN A;  4W6F A;  2QDI A;  4PE4 A;  1UP5 A;  1QVI Z;  4W6T A;  2VAD A;  2K0J A;  1M63 B;  4TZA A;  4XL5 A;  4Z4M A;  1F4Q A;  1SW8 A;  1MXL C;  1S6C A;  3HCM A;  2PXS A;  2TN4 A;  4W6A A;  2HET A;  3EVP A;  3M0W A;  5IBW A;  2LP2 A;  4MZL A;  4J8A A;  2M9G A;  3BXB A;  3M24 A;  2BAP A;  2NXQ A;  3BX9 A;  4TNC A;  2WCE A;  2HF5 A;  2HQZ A;  1XK4 C;  3W1D A;  3DQH A;  4HQ8 A;  3S0A A;  2QEO A;  2JRF A;  1XO5 A;  4JQ0 D;  1K8U A;  1EL4 A;  4OZD A;  1OXE A;  4XVP A;  2YFP A;  1XAE A;  1CB1 A;  4Q7R A;  2CTN A;  2OPO A;  3RZS A;  1W7U A;  5I94 A;  3PM8 A;  2KI6 D;  3U0N A;  2H8V A;  2MAZ A;  4Q9X A;  2CNP A;  5TNC A;  3CFA A;  1MOU A;  3OHM B;  2NZ0 A;  1N2D A;  5HBD A;  4W7F A;  2LC5 A;  2KI4 C;  4LQU A;  5I2O A;  5HZT A;  1OOJ A;  2V4E A;  1NP8 A;  2KFH A;  2JT8 A;  5ER4 X;  3DQE A;  2HPS A;  1CDL A;  3A8R A;  4DS7 A;  2PMY A;  5LTR A;  3WCK A;  5F9G A;  4W77 A;  2AWK A;  3DVJ A;  1TWO A;  4LJD A;  3CBE A;  3S0E A;  3R1P A;  1NCX A;  2AHA A;  1YUS A;  2Q57 A;  1EMA A;  1J7P A;  4PT1 A;  1BU3 A;  2ZO7 A;  5HZU A;  1GGZ A;  1QV0 A;  2BL0 B;  3IR8 A;  1VRK A;  1H4B A;  4EUL A;  2K2A A;  1IQ3 A;  3TZ1 A;  1K94 A;  2PAL A;  1PSR A;  3SIB A;  3SSK A;  2WCF A;  2G16 B;  4LJB A;  3ADF A;  1D1O A;  1XK4 A;  2KBM A;  3CS1 A;  2L4H A;  1Z1P A;  1Q4C A;  2CT9 A;  2A50 B;  2MRD A;  1MYW A;  1OMD A;  4W6U A;  5DTX A;  4EMQ A;  3SVR A;  1XA9 A;  5AQB B;  3BYA A;  2LMV A;  1QIV A;  4HRE E;  3LK0 A;  4M2Q A;  2F3Z A;  4Q7T A;  4NDB A;  4HE4 A;  1LA3 A;  1S6I A;  1NSH A;  3FWC A;  3SSY A;  2KHN A;  4OHS A;  4HQ9 A;  4OCI A;  3GJ2 A;  1K9P A;  1SCM C;  4OV2 A;  1QYQ A;  3DQA A;  2JTZ A;  5GQQ C;  4DXQ A;  3TMT A;  1JFK A;  3R1V A;  1YX7 A;  1XYD A;  3ICB A;  5HGE A;  2LAN A;  1DJG A;  1HT9 A;  3I5H C;  5LK4 A;  5AER A;  3CGL A;  5EL2 A;  2CCM A;  1Y1A A;  3E5V A;  1IIO A;  3FE9 A;  2DD9 A;  2F2O A;  3S0G A;  2QLE A;  3BJH A;  1Z2C B;  3I5G B;  2H61 C;  5CPV A;  2A47 A;  4YGD B;  3WXA A;  1ORG A;  4OGS A;  3CB9 A;  2QEB A;  2F2P A;  1S26 D;  3VRP A;  3VGO A;  3PJ7 A;  3BQ3 A;  2GX2 A;  3WNX B;  1ZGP A;  2HJO A;  1GGX A;  4D1E A;  3A8S A;  3N7H A;  1SYM A;  2P6B B;  5JOL A;  2A46 A;  4P76 A;  1S6Z A;  2PSR A;  3DXL A;  3CR2 A;  2K7O A;  2POX A;  5J3X A;  2GV5 A;  2VZX A;  3LS3 A;  4RTC A;  1CDN A;  4Q04 A;  4OY4 A;  1DGU A;  2FCD A;  1TN4 A;  4NQG A;  3S0F A;  1RMO A;  1MUX A;  1Q73 A;  3QRX A;  2PVB A;  3SST A;  2LUX A;  1BF5 A;  1S6J A;  1SSE B;  3CR4 X;  5HYD A;  4ZB1 A;  4J89 A;  4U2V A;  5DKR A;  3EKJ A;  2ZND A;  5PAL A;  1F71 A;  1XVJ A;  3TS5 C;  3IF7 A;  1DF0 B;  1A75 B;  2H5P A;  3LLE A;  1LS8 A;  1WDC B;  3CAB A;  3TDU A;  5DPG A;  1QXT A;  4C0L A;  1QWV A;  4W6O A;  1NCZ A;  4A4B A;  1SCV A;  4KEX A;  2H5R A;  2G9B A;  3H1R A;  2COL B;  1HUY A;  3CZ0 A;  1S5G Z;  2JNF A;  1OOH A;  2FCE A;  1RJV A;  5HL1 A;  4DXI A;  1YFP A;  1MHO A;  3LK1 A;  2PXW A;  3DPW A;  2JU0 A;  1UHK A;  4PE0 A;  1SL8 A;  2JZI A;  1TTX A;  4PPL A;  1IRJ A;  5DU0 A;  2G2S B;  2MHH A;  1CNP A;  1AJ5 A;  1IJ6 A;  4W6D A;  4MZJ A;  2EGD A;  1UUR A;  2Y0G A;  4IJ7 A;  2G6Y A;  3CLN A;  1TUJ A;  4DXO A;  2L4I A;  2ZKM X;  2DOQ A;  5FYX A;  1U5I A;  2Z1O A;  3R72 A;  1GQM A;  4M2P A;  1H8B A;  1EG4 A;  1NX2 A;  3GL4 A;  1Z1Q A;  1JUO A;  1Q4E A;  1WRZ A;  4UPG A;  3DPX A;  1QJT A;  1QLS A;  4PHM A;  3O6B A;  5F6T A;  4FQO A;  4XOW A;  1Q4B A;  2I2R E;  2ZFD A;  5D3O A;  3DQC A;  2AWJ A;  3GJ1 A;  1MOV A;  2QZ0 A;  2QLG A;  5FVF A;  2CXJ A;  1XFW O;  4P2Y B;  1KQV A;  2KAV A;  2DDC A;  4OVN F;  2KAY A;  3M22 A;  1QAT A;  3ZTF A;  4KPI A;  1EMM A;  4W6C A;  1YJ2 A;  3GB3 A;  2LLT A;  5K89 A;  1OXF A;  3DVK A;  2A53 B;  1DEK A;  4ZIN A;  1YRT B;  2M49 B;  1PAL A;  2HGY A;  2WC6 A;  1BR4 B;  4USL A;  4W7D A;  2QLH A;  1TCO B;  1JC2 A;  3CTN A;  2D8N A;  4PE7 A;  4DIR A;  3O78 A;  1TNX A;  3D0Y B;  4AQJ A;  3PLF B;  4W6N A;  2WCL A;  2KYF A;  2DUI A;  5BQL A;  2KYC A;  1TOP A;  3RWT A;  3PAT A;  3OSR A;  5BTT A;  2L98 A;  2OKW A;  3LVD A;  1EJ3 A;  4OJ0 A;  1N0Y A;  1NX3 A;  1NPQ A;  3BUM B;  1V1G A;  2KBI A;  3GOF A;  3KEV A;  2GW3 A;  3U0M A;  2G6X A;  3SRY A;  3PAL A;  3SG4 A;  4N5X A;  3VIC A;  3RLZ A;  2JPO A;  5I2L A;  5AEQ A;  3DQN A;  1J1E A;  2LAP A;  4W7E A;  4Z4K A;  1B8C A;  2H9W A;  1S36 A;  3KHE A;  2HRS A;  2KPH A;  3EG5 B;  3EK7 A;  2E6W A;  3CFH A;  1YJF A;  5EB6 A;  3EVV A;  4WQ3 A;  2ZRS A;  2G6E A;  3DQU A;  4R6B A;  2Q4U A;  4HRG A;  1TNW A;  2BL0 C;  2MBX A;  4OKH A;  1OW4 A;  1XFR A;  2LCP A;  1QLK A;  1YHH A;  1GJY A;  1C3Z A;  3NSL A;  1DMO A;  4ANJ A;  2LVI A;  3UG0 A;  1MR8 A;  1RTP 1;  1GL4 A;  2KSP A;  5I8N A;  4CPV A;  3BOW B;  3DQK A;  2LP3 A;  2G2B A;  1A29 A;  1A03 A;  3LF4 B;  2H8Q A;  3V3D A;  1ZGO A;  3CYZ A;  2QEV A;  2Z6Z A;  1B9A A;  4XOV A;  2G3D B;  2NCP A;  2QU1 A;  2BKI B;  1W7S A;  4W72 A;  2WHT A;  1TNP A;  4U8D A;  5LTP A;  2DD7 A;  3SVO A;  1KCY A;  1B47 A;  1LVC D;  2MJW B;  2KNE A;  1JC1 A;  1H4U A;  2WCK A;  3U8A A;  4INW A;  3IVT A;  1REC A;  1ZMZ A;  3CR5 X;  5DRG A;  1JSA A;  5DQM A;  3AAJ A;  2A4J A;  1OMR A;  4R1E A;  4L9M A;  1L7Z A;  3I5G C;  4I5L B;  4XYN A;  4PHK A;  2JT0 A;  1Q4A A;  3SG3 A;  1WLZ A;  3OSQ A;  3GK1 A;  1KK8 B;  3OP0 A;  1YHG A;  3SG6 A;  4OR9 B;  4UTS A;  4HSZ A;  3NGV A;  1B9C A;  1RMM A;  2JXL A;  4W6I A;  2K7C A;  1J7O A;  1LA0 A;  4CID A;  1F8H A;  2QAC A;  2VRG A;  2JXC A;  1C3Y A;  4WQ2 A;  1BOD A;  1CV7 A;  1CDM A;  4JF9 A;  1FF1 A;  1C4F A;  4DXP A;  1EMG A;  3L47 A;  5DPI A;  5HKZ A;  1X02 A;  4KGE A;  1C7W A;  2PRU A;  3E5W A;  4MVF A;  2H5Q A;  4GUK A;  2HGD A;  3CGA A;  2EMN A;  1SK6 D;  3E3R A;  1W7T A;  1PVB A;  3DPZ A;  1BFP A;  1CFF A;  1EXR A;  2M97 A;  4LW5 A;  2YE1 A;  2JOJ A;  1YUT A;  1K9K A;  2OGR A;  1KFU S;  3LSA A;  2K7B A;  1W9Z A;  2K60 A;  5KTG A;  2BTJ A;  1TIZ A;  1KFX S;  3SG5 A;  1WDC C;  4BY5 A;  2L2E A;  4EN1 A;  1HCJ A;  3O2P A;  1KFU L;  4GES B;  1OOG A;  3ST2 A;  4PPK A;  1B7T Z;  1F0B A;  2QT2 A;  4L12 A;  1CFC A;  1Z4H A;  1DTL A;  1KFX L;  1GM0 A;  1Q4D A;  2MLF C;  3K1E A;  3O4Y A;  1DJH A;  2O5G A;  2WUR A;  2KGB C;  1B8L A;  4YRU A;  3DQ5 A;  4GBA A;  4XJK B;  4YI8 A;  3DQ4 A;  3BXK A;  5HZS A;  2R2I A;  3LCP C;  3OGN A;  2L50 A;  4EDS A;  3E5T A;  5EXC I;  1BT6 A;  4JKT A;  4PDZ A;  1XFU O;  1RRX A;  2KLE A;  3DYE A;  1NIW A;  4ZCU A;  2EMD A;  1QVI Y;  5DPJ A;  3SVC A;  2EMO A;  3VRN A;  1UUS A;  3GEX A;  3DQ7 A;  3DF0 B;  1AVS A;  4W69 A;  4MBE A;  3LF3 A;  1YR5 A;  2WC8 A;  1QX5 B;  3BXA A;  2JPT A;  2ISD A;  3VRQ A;  3NSK A;  3I5F B;  4YGC B;  2WND A;  4DKM A;  1XFY O;  1EMC A;  1BMO A;  4DCK A;  2L5X B;  1DF0 A;  3VRO A;  3S05 A;  5DTZ A;  1J7Q A;  4JD9 A;  1A75 A;  3DQ2 A;  2BNX A;  3D78 A;  4CFR A;  1DC1 A;  3B6X A;  1OMV A;  2YGU A;  3SJS A;  3NHI A;  3TUY B;  4IK9 A;  1QYF A;  1DJW A;  4W6L A;  1SNL A;  2F8P A;  4JWQ A;  4PPJ A;  1ZOT B;  3SG2 A;  4P1Q A;  4J88 A;  2JUL A;  3BXC A;  3PIB A;  4IK4 A;  2OTE A;  3ZUJ A;  3DQL A;  1UHI A;  1K2H A;  5JJG A;  1CMF A;  4MLW A;  4ZFS A;  2HQ8 A;  3SS0 A;  1FI6 A;  1NX1 A;  1PRW A;  3AI5 A;  3OX6 A;  4C0K A;  1YZW A;  2JAD A;  1QTX A;  3VHT A;  2AUC A;  2WSN A;  3NEZ A;  2RH7 A;  1G8I A;  1YRU B;  2LVV A;  1H6R A;  2SCP A;  3JVT B;  2B3P A;  3SV5 A;  4PCW A;  1WRL A;  3DD4 A;  1EMB A;  3DQ8 A;  2KLD A;  4L1I A;  3ST4 A;  1F55 A;  1KK7 Z;  3DQI A;  4DXN A;  5HW9 A;  3SVN A;  3NF0 A;  2WOR A;  5D7F A;  2LHL A;  1EML A;  2EC6 B;  3G9A A;  4AOM A;  2LVK A;  4DRW A;  2H61 A;  2KQY A;  2BCA A;  2WIS A;  5ER5 A;  1DT7 B;  4HRH A;  4N1F A;  5FI7 A;  1EMK A;  2SAS A;  2DUG A;  2L51 A;  4GAO A;  1B7T Y;  2KQ6 A;  4N3D A;  3RWA A;  2F33 A;  1B4C A;  2GGM A;  4N1G A;  3JTD B;  1M45 A;  1DJX A;  4W6H A;  4ZF3 A;  4H48 A;  2BCB A;  2VVI A;  3SSL A;  1QAS A;  2IS9 A;  2OS8 B;  3AKA A;  2O29 A;  1G4Y R;  5FVG A;  5KU1 A;  4ZF4 A;  5AXI A;  1RMP A;  1DJI A;  3D0Y A;  3IP2 A;  1CLB A;  2H2K A;  4ICB A;  3D73 A;  4QJ4 B;  5T3I A;  1TCF A;  1GGW A;  1JBA A;  3SVE A;  3VB1 A;  5CSJ A;  1FI5 A;  2BBM A;  1OQP A;  1NWD A;  4GGN A;  2OKY A;  3DQ9 A;  3U0K A;  2YE0 A;  3SVS A;  3ST0 A;  2JC2 A;  5KSZ A;  2LLU A;  2WIQ A;  4H3M A;  2LM5 A;  1ZAC A;  1KYR A;  1R6P A;  1ZFS A;  4W7A A;  3DQO A;  3B86 A;  1QYO A;  3ZUL A;  1J7R A;  4CLN A;  4ORA B;  4EDO A;  2KFG A;  1KQM B;  1UHN A;  1DQE A;  2Y5I A;  5FVI A;  1KK8 C;  2Q91 A;  3MSE B;  3K21 A;  1CMG A;  3S0D A;  4YGA A;  2LMT A;  2PQL A;  3CZT X;  3FE6 A;  3WHU B;  1DEL A;  5B8I B;  1IH0 A;  3U0L A;  3BOW A;  3O4X A;  4B30 B;  2ZN8 A;  3S0B A;  3B7A A;  3D10 A;  1IQ5 A;  1WLM A;  2CBL A;  1KWO C;  5H89 A;  4C0J A;  1Y1U A;  4A4C A;  2LVJ A;  2A48 A;  3CZ2 A;  1K93 D;  4W73 A;  5EB7 A;  3SVD A;  1AJ4 A;  3P8U A;  4QJ3 B;  2BE6 A;  1EG3 A;  1JF0 A;  3NHT A;  1OOI X;  1SL7 A;  3D76 A;  2K7D A;  4IL1 A;  3VK1 A;  3I5I B;  4YGE B;  4OQW A;  4KA9 A;  4GNK B;  3SG7 A;  3L4A A;  3CFF A;  1LXF C;  1R2U A;  2BCX A;  2M7N A;  1OZO A;  4BY4 A;  1IGV A;  1QY3 A;  2HFC A;  1XFX O;  2FOT A;  1ODB A;  3PFV A;  4KW9 A;  1QV1 A;  4W75 A;  3A4U B;  2JT3 A;  3SS5 A;  5DTL A;  1S5G Y;  4XGY A;  2WCB A;  2ICR A;  3LVC A;  4I2Y A;  4FQT A;  1C7V A;  1F4O A;  1W7J B;  4F0Z B;  4ORC B;  2Z6Y A;  1A2X A;  1IKU A;  1SR6 B;  2M1U A;  1CM1 A;  5G08 A;  1J55 A;  2EHB A;  1BLQ A;  1CFD A;  1TUZ A;  2A54 B;  2JNX A;  2G3O A;  3PSR A;  3AKO A;  4YGB B;  2GTE A;  2BE4 A;  1AUI B;  2F3Y A;  3BUO B;  4HQC A;  1M39 A;  3PN7 C;  1LIN A;  4L13 A;  3LVA A;  1TNQ A;  3DQ6 A;  4ZIO A;  3U8P A;  2KGR A;  2M8U A;  1SBJ A;  1QX2 A;  2OJK A;  5CSN A;  1AK8 A;  3EKH A;  2G5Z B;  1K9U A;  3OB1 B;  4LJD C;  3H1O A;  3F45 A;  2VVJ A;  5HLV A;  3I5F C;  5CSI A;  3DZT A;  2H5O A;  4JC2 A;  1FBV A;  4P5O E;  2OTG B;  3B87 A;  2PAS A;  3H4S E;  2P4M A;  1F09 A;  3TUY C;  2FJY A;  4INX A;  1ZGQ A;  2V53 A;  1W7I B;  2VVH A;  2Q6P A;  1NUB A;  1DJZ A;  4ZF5 A;  2M7L A;  1KYS A;  4ORB B;  5EHU A;  2JTT A;  1G7K A;  5FHV A;  3ST3 A;  2L5Y A;  3TDI A;  4DKN A;  1OXD A;  1Y6W A;  1AP4 A;  1JBY A;  1P28 A;  1L2O C;  1K96 A;  3AKB A;  3SVB A;  5J2O A;  4XJK A;  1JF2 A;  4ETO A;  1KWO B;  2ZO6 A;  2WHS A;  2FZU A;  4WRI A;  1CLL A;  1BR1 B;  2WHU A;  1WRK A;  1Y0V H;  4R6D A;  3UFZ A;  2I7A A;  4JPZ B;  1QX7 A;  1ALV A;  3B88 A;  2AMI A;  3KPX A;  3JVT C;  3ZWH A;  1V1F A;  2E30 A;  1XSS A;  2ZRT A;  1K90 D;  4CFQ A;  3IQQ A;  4W6G A;  3VRR A;  5BPJ A;  4PFE A;  4B5Y A;  1NX0 A;  3BUN B;  4DXM A;  3D75 A;  1DJY A;  2KAX A;  3NXA A;  2KFF A;  4PHJ A;  3Q8I A;  3DF0 A;  1CDP A;  3L4L A;  3UNW A;  2AH8 A;  2DUF A;  4KGF A;  2Y1M A;  4I5K A;  3WLC A;  1YUU A;  4MN0 A;  2EC6 C;  3ZUF A;  4KW4 A;  1PUL A;  4PE1 A;  1SRA A;  2BKH B;  3KCS A;  2GX0 A;  1BJF A;  1OOF A;  5DKN A;  3MGF A;  3LA1 A;  1OE9 B;  1RK9 A;  4GPL B;  4W7R A;  1E8A A;  1SKT A;  1F70 A;  3KF9 A;  1DVI A;  1RWY A;  2AAO A;  2QEH A;  4W7X A;  3JTD C;  1MQ1 A;  2BBN A;  5DQB A;  2GW4 B;  5D69 A;  2BEC A;  2HQW A;  4QJ5 B;  4NWS A;  2GGZ A;  4RYW A;  3DQF A;  5DRF A;  1B1G A;  2WCJ A;  4HVF A;  4F7F A;  2OS8 C;  3PN7 B;  4KAG A;  3DQD A;  4MRX A;  1SMG A;  3I19 A;  3W1C A;  2V4E B;  1JFJ A;  2LUC A;  1FW4 A;  2M0R A;  1ALW A;  2M29 A;  3AAK A;  5BT0 A;  1YVH A;  1IJ5 A;  2M3W A;  1HQV A;  2ARL A;  3NED A;  2IB6 A;  1LKJ A;  4NDD A;  1EME A;  3OX5 A;  2KI6 C;  2NCO A;  2RGI A;  3CZ1 A;  4FTG A;  1KSM A;  2LV7 A;  1CFP A;  5HKW A;  4RYS A;  1YX8 A;  1OSA A;  1S1E A;  2Z6X A;  3U8C A;  2VAE A;  4GF6 B;  3GK2 A;  1MF8 B;  1CM4 A;  1PK0 D;  2IOV A;  4LJC A;  1ZUX A;  4GFT A;  5LTQ A;  1TRF A;  3SVU A;  1KQM C;  4MZK A;  2B3Q A;  2WSO A;  4GGF C;  3IQO A;  3NT9 A;  5EBJ A;  1GFL A;  1XFV O;  3FE8 A;  1L2O B;  1Y1X A;  3V2L A;  1AHR A;  4KF4 A;  1DGV A;  3DVE A;  2ERB A;  1IWQ A;  2JWW A;  5AAN A;  2FWQ A;  5DIC A;  2HCG A;  3OB2 B;  5HKY A;  1UHJ A;  2C9I A;  3AI4 A;  5HLO A;  5DKQ A;  3BFB A;  1BOC A;  5EXU A;  2C9J A;  2WCH A;  4JEO A;  2KI4 B;  1A4P A;  3DQJ A;  4PAL A;  5H88 A;  2L2C A;  3EK8 A;  2LMU A;  2Y4Q A;  1SPY A;  4MEW A;  1YVL A;  5FI2 A;  4AS8 A;  4W74 A;  3CD9 A;  3BUW B;  4IZN A;  4TZG A;  4Q9W A;  3I5I C;  1YUR A;  4W7C A;  2MLE C;  2OTB A;  1UHH A;  3OGO A;  3NSI A;  3EVR A;  2A52 B;  1MXE A;  5EJU A;  4W6J A;  5EXB A;  3DVM A;  2Y1N A;  3EVU A;  4MSP A;  2DDD A;  2LNK A;  3R1O A;  1CTR A;  3GK4 X;  1SY9 A;  2AWM A;  4GGF A;  2K61 A;  1T14 A;  3ED8 A;  3DQ1 A;  1ZUZ A;  2HPW A;  4H3L A;  3OBV A;  1KYP A;  3LL8 B;  3BFA A;  3SS4 A;  4W6M A;  4ZCV A;  1SR6 C;  1EH2 A;  2KDH A;  4IK8 A;  2DUE A;  3D77 A;  1EMF A;  1G33 A;  5FI6 A;  1RM9 A;  4W6B A;  1S3P A;  3PJB A;  4W6K A;  4AR7 A;  1NCY A;  4I5N B;  3VHT B;  2QRF A;  2IE2 A;  2FJU B;  1K95 A;  2I18 A;  4B30 A;  2WCM A;  1UIS A;  4E68 A;  1SCM B;  4H47 A;  3PM2 A;  2O60 A;  3FS7 A;  1JC0 A;  1KSO A;  3PJ5 A;  2YDZ A;  4AQI A;  1UWO A;  3D74 A;  1CKK A;  2PYQ A;  2LHI A;  3NSO A;  3KCT A;  4IK1 A;  3SSP A;  1OZS A;  3I5H B;  2DUH A;  3CWG A;  2MA2 A;  5DTY A;  3SS3 A;  2ZNE A;  2HQK A;  3ZNI A;  3WHT B;  2B1U A;  1RRO A;  1IG5 A;  3QME A;  4BDU A;  4DUQ A;  3TDZ A;  3WLD A;  2LE9 B;  3SSV A;  3FIA A;  3K1K A;  4JFG A;  4ORN A;  2OTG C;  4W6P A;  4ZBL A;  3FWB A;  2AWL A;  3DQM A;  4KF5 C;  5H87 A;  2ZMU A;  3TMR A;  5CSF A;  3CD1 A;  2H6V A;  1XMZ A;  1RFJ A;  2P71 A;  1XQM A;  4W76 A;  3RM1 A;  2JQ6 A;  2K2F A;  1QS7 A;  5KTY A;  2KOT A;  4YI9 A;  4Q7U A;  2M1K B;  4W6S A;  1PVA A;  3NT3 A;  1C07 A;  3P28 A;  3BUX B;  1U5I B;  1N65 A;  1NYA A;  3PJI A;  1CLM A;  3DQ3 A;  1KP5 A;  3BFH A;  4KW8 A;  4IK5 A;  1M46 A;  3CDN A;  3C1V A;  1KK7 Y;  1Q80 A;  3TS5 B;  4IK3 A;  3KO0 A;  4PHN A;  5DPH A;  4MRY A;  3UO9 A;  2LLS A;  1XFZ O;  1QIW A;  1JBZ A;  2QLG B;  5HZO A;  3HX4 A;  4M2O A;  1QXP A;  4JRB A;  2I94 A;  5AFP A;  5DY6 A;  2O24 A; 
#chains in the Genus database with same CATH homology
 1JWD A;  2L0P A;  1PSB A;  2O2B A;  3SSH A;  2NLN A;  3SIA A;  1SL9 A;  2IB5 A;  2QLI A;  1WY9 A;  2ZMW A;  2WOS A;  4LQT A;  5I2Q A;  1YHI A;  3O77 A;  2QPT A;  1YTZ C;  4KF5 A;  4I5J A;  1BG1 A;  4H3N A;  1FPW A;  1B8R A;  1XA5 A;  2A56 B;  1J1D A;  3EK4 A;  4W6R A;  4NDC A;  4YBH B;  5BTT B;  1M31 A;  4GOB A;  2K8M B;  2FL1 A;  4JGE A;  1F54 A;  2ZN9 A;  2V4E C;  1MWN A;  4W6F A;  4PE4 A;  1UP5 A;  1QVI Z;  4W6T A;  2VAD A;  2K0J A;  1M63 B;  4TZA A;  4XL5 A;  4Z4M A;  1F4Q A;  1SW8 A;  1MXL C;  1S6C A;  3HCM A;  2PXS A;  2TN4 A;  4W6A A;  2HET A;  3EVP A;  3M0W A;  5IBW A;  2LP2 A;  4MZL A;  4J8A A;  2M9G A;  3BXB A;  3M24 A;  2NXQ A;  3BX9 A;  4TNC A;  2WCE A;  2HF5 A;  2HQZ A;  1XK4 C;  3W1D A;  3DQH A;  4HQ8 A;  2JRF A;  1XO5 A;  4JQ0 D;  1K8U A;  1EL4 A;  1OXE A;  4XVP A;  2YFP A;  1XAE A;  1CB1 A;  4Q7R A;  2CTN A;  2OPO A;  1W7U A;  3PM8 A;  2KI6 D;  3U0N A;  2MAZ A;  4Q9X A;  2CNP A;  5TNC A;  3CFA A;  1MOU A;  3OHM B;  2NZ0 A;  1N2D A;  5HBD A;  4W7F A;  2LC5 A;  2KI4 C;  4LQU A;  5I2O A;  5HZT A;  1OOJ A;  2V4E A;  1NP8 A;  2KFH A;  2JT8 A;  5ER4 X;  3DQE A;  2HPS A;  1CDL A;  3A8R A;  4DS7 A;  2PMY A;  5LTR A;  3WCK A;  5F9G A;  4W77 A;  2AWK A;  3DVJ A;  4LJD A;  3CBE A;  1NCX A;  2AHA A;  1YUS A;  2Q57 A;  1EMA A;  1J7P A;  1BU3 A;  2ZO7 A;  5HZU A;  1GGZ A;  1QV0 A;  2BL0 B;  3IR8 A;  1VRK A;  1H4B A;  4EUL A;  2K2A A;  1IQ3 A;  3TZ1 A;  1K94 A;  2PAL A;  1PSR A;  3SIB A;  3SSK A;  2WCF A;  2G16 B;  4LJB A;  3ADF A;  1D1O A;  1XK4 A;  2KBM A;  3CS1 A;  2L4H A;  1Z1P A;  1Q4C A;  2CT9 A;  2A50 B;  2MRD A;  1MYW A;  1OMD A;  4W6U A;  5DTX A;  4EMQ A;  3SVR A;  1XA9 A;  5AQB B;  3BYA A;  2LMV A;  1QIV A;  4HRE E;  3LK0 A;  4M2Q A;  2F3Z A;  4Q7T A;  4NDB A;  4HE4 A;  1LA3 A;  1S6I A;  1NSH A;  3FWC A;  3SSY A;  2KHN A;  4OHS A;  4HQ9 A;  4OCI A;  3GJ2 A;  1K9P A;  1SCM C;  4OV2 A;  1QYQ A;  3DQA A;  2JTZ A;  5GQQ C;  4DXQ A;  3TMT A;  1JFK A;  1YX7 A;  1XYD A;  3ICB A;  5HGE A;  2LAN A;  1DJG A;  1HT9 A;  3I5H C;  5LK4 A;  5AER A;  3CGL A;  2CCM A;  1Y1A A;  3E5V A;  2DD9 A;  2F2O A;  2QLE A;  3I5G B;  2H61 C;  5CPV A;  2A47 A;  4YGD B;  3WXA A;  4OGS A;  3CB9 A;  2F2P A;  1S26 D;  3VRP A;  3VGO A;  3PJ7 A;  3BQ3 A;  2GX2 A;  3WNX B;  1ZGP A;  2HJO A;  1GGX A;  4D1E A;  3A8S A;  1SYM A;  2P6B B;  5JOL A;  2A46 A;  4P76 A;  1S6Z A;  2PSR A;  3CR2 A;  2K7O A;  2POX A;  5J3X A;  2GV5 A;  2VZX A;  3LS3 A;  4RTC A;  1CDN A;  4Q04 A;  4OY4 A;  1DGU A;  2FCD A;  1TN4 A;  4NQG A;  1RMO A;  1MUX A;  1Q73 A;  3QRX A;  2PVB A;  3SST A;  2LUX A;  1BF5 A;  1S6J A;  3CR4 X;  5HYD A;  4ZB1 A;  4J89 A;  4U2V A;  5DKR A;  3EKJ A;  2ZND A;  5PAL A;  1F71 A;  1XVJ A;  3TS5 C;  3IF7 A;  1DF0 B;  1A75 B;  2H5P A;  3LLE A;  1WDC B;  3TDU A;  5DPG A;  1QXT A;  4C0L A;  4W6O A;  1NCZ A;  4A4B A;  1SCV A;  4KEX A;  2H5R A;  2G9B A;  3H1R A;  2COL B;  1HUY A;  1S5G Z;  2JNF A;  2FCE A;  1RJV A;  4DXI A;  1YFP A;  1MHO A;  3LK1 A;  2PXW A;  3DPW A;  2JU0 A;  1UHK A;  4PE0 A;  1SL8 A;  2JZI A;  1TTX A;  4PPL A;  1IRJ A;  5DU0 A;  2G2S B;  2MHH A;  1CNP A;  1AJ5 A;  1IJ6 A;  4W6D A;  4MZJ A;  2EGD A;  1UUR A;  2Y0G A;  2G6Y A;  3CLN A;  4DXO A;  2L4I A;  2ZKM X;  2DOQ A;  5FYX A;  1U5I A;  2Z1O A;  1GQM A;  4M2P A;  1H8B A;  1EG4 A;  1NX2 A;  3GL4 A;  1Z1Q A;  1JUO A;  1Q4E A;  1WRZ A;  4UPG A;  3DPX A;  1QJT A;  1QLS A;  4PHM A;  3O6B A;  5F6T A;  4FQO A;  4XOW A;  1Q4B A;  2I2R E;  2ZFD A;  3DQC A;  2AWJ A;  3GJ1 A;  1MOV A;  2QZ0 A;  2QLG A;  5FVF A;  2CXJ A;  1XFW O;  4P2Y B;  1KQV A;  2KAV A;  2DDC A;  4OVN F;  2KAY A;  3M22 A;  1QAT A;  3ZTF A;  4KPI A;  1EMM A;  4W6C A;  1YJ2 A;  3GB3 A;  2LLT A;  5K89 A;  1OXF A;  3DVK A;  2A53 B;  4ZIN A;  1YRT B;  2M49 B;  1PAL A;  2HGY A;  4USL A;  1BR4 B;  4W7D A;  2QLH A;  1TCO B;  1JC2 A;  3CTN A;  2D8N A;  4PE7 A;  4DIR A;  3O78 A;  1TNX A;  3D0Y B;  4AQJ A;  3PLF B;  4W6N A;  2KYF A;  2DUI A;  5BQL A;  2KYC A;  1TOP A;  3RWT A;  3PAT A;  3OSR A;  5BTT A;  2L98 A;  2OKW A;  3LVD A;  1EJ3 A;  4OJ0 A;  1N0Y A;  1NX3 A;  1NPQ A;  3BUM B;  1V1G A;  2KBI A;  3GOF A;  3KEV A;  2GW3 A;  3U0M A;  2G6X A;  3SRY A;  3PAL A;  3SG4 A;  4N5X A;  3VIC A;  3RLZ A;  5I2L A;  5AEQ A;  3DQN A;  1J1E A;  2LAP A;  4W7E A;  4Z4K A;  1B8C A;  2H9W A;  1S36 A;  3KHE A;  2HRS A;  3EK7 A;  2E6W A;  3CFH A;  1YJF A;  5EB6 A;  3EVV A;  4WQ3 A;  2ZRS A;  2G6E A;  3DQU A;  4R6B A;  2Q4U A;  4HRG A;  1TNW A;  2BL0 C;  2MBX A;  4OKH A;  2LCP A;  1QLK A;  1YHH A;  1GJY A;  3NSL A;  1DMO A;  4ANJ A;  2LVI A;  3UG0 A;  1MR8 A;  1RTP 1;  1GL4 A;  2KSP A;  5I8N A;  4CPV A;  3BOW B;  3DQK A;  2LP3 A;  2G2B A;  1A29 A;  1A03 A;  3LF4 B;  2H8Q A;  3V3D A;  1ZGO A;  2Z6Z A;  1B9A A;  4XOV A;  2G3D B;  2NCP A;  2QU1 A;  2BKI B;  1W7S A;  4W72 A;  2WHT A;  1TNP A;  4U8D A;  5LTP A;  2DD7 A;  3SVO A;  1KCY A;  1B47 A;  1LVC D;  2MJW B;  2KNE A;  1JC1 A;  1H4U A;  3U8A A;  1REC A;  1ZMZ A;  3CR5 X;  5DRG A;  1JSA A;  5DQM A;  3AAJ A;  2A4J A;  1OMR A;  4R1E A;  4L9M A;  1L7Z A;  3I5G C;  4I5L B;  4XYN A;  4PHK A;  2JT0 A;  1Q4A A;  3SG3 A;  1WLZ A;  3OSQ A;  3GK1 A;  1KK8 B;  3OP0 A;  1YHG A;  3SG6 A;  4OR9 B;  4UTS A;  4HSZ A;  1B9C A;  1RMM A;  2JXL A;  4W6I A;  2K7C A;  1J7O A;  1LA0 A;  4CID A;  1F8H A;  2QAC A;  2VRG A;  2JXC A;  4WQ2 A;  1BOD A;  1CV7 A;  1CDM A;  4JF9 A;  1FF1 A;  1C4F A;  4DXP A;  1EMG A;  5DPI A;  5HKZ A;  1X02 A;  4KGE A;  1C7W A;  2PRU A;  3E5W A;  4MVF A;  2H5Q A;  4GUK A;  2HGD A;  3CGA A;  2EMN A;  1SK6 D;  3E3R A;  1W7T A;  1PVB A;  3DPZ A;  1BFP A;  1CFF A;  1EXR A;  2M97 A;  4LW5 A;  2YE1 A;  2JOJ A;  1YUT A;  1K9K A;  2OGR A;  1KFU S;  3LSA A;  2K7B A;  5KTG A;  2BTJ A;  1TIZ A;  1KFX S;  3SG5 A;  1WDC C;  4BY5 A;  2L2E A;  4EN1 A;  1HCJ A;  3O2P A;  1KFU L;  4GES B;  3ST2 A;  4PPK A;  1B7T Z;  1F0B A;  2QT2 A;  4L12 A;  1CFC A;  1DTL A;  1KFX L;  1Q4D A;  2MLF C;  3O4Y A;  1DJH A;  2O5G A;  2WUR A;  2KGB C;  1B8L A;  4YRU A;  3DQ5 A;  4GBA A;  4XJK B;  4YI8 A;  3DQ4 A;  3BXK A;  5HZS A;  2R2I A;  3LCP C;  2L50 A;  4EDS A;  3E5T A;  5EXC I;  1BT6 A;  4PDZ A;  1XFU O;  1RRX A;  1NIW A;  4ZCU A;  2EMD A;  1QVI Y;  5DPJ A;  3SVC A;  2EMO A;  3VRN A;  1UUS A;  3GEX A;  3DQ7 A;  3DF0 B;  1AVS A;  4W69 A;  4MBE A;  3LF3 A;  1YR5 A;  2WC8 A;  1QX5 B;  3BXA A;  2JPT A;  2ISD A;  3VRQ A;  3NSK A;  3I5F B;  4YGC B;  2WND A;  4DKM A;  1XFY O;  1EMC A;  1BMO A;  4DCK A;  2L5X B;  1DF0 A;  3VRO A;  3S05 A;  5DTZ A;  1J7Q A;  1A75 A;  3DQ2 A;  4CFR A;  1OMV A;  3TUY B;  3SJS A;  4IK9 A;  1QYF A;  1DJW A;  4W6L A;  1SNL A;  2F8P A;  4JWQ A;  4PPJ A;  1ZOT B;  3SG2 A;  4P1Q A;  4J88 A;  2JUL A;  3BXC A;  3PIB A;  4IK4 A;  2OTE A;  3ZUJ A;  3DQL A;  1UHI A;  1K2H A;  5JJG A;  1CMF A;  4MLW A;  4ZFS A;  2HQ8 A;  3SS0 A;  1FI6 A;  1NX1 A;  1PRW A;  3AI5 A;  3OX6 A;  4C0K A;  1YZW A;  2JAD A;  1QTX A;  3VHT A;  2AUC A;  2WSN A;  3NEZ A;  2RH7 A;  1G8I A;  1YRU B;  2LVV A;  1H6R A;  2SCP A;  3JVT B;  2B3P A;  3SV5 A;  4PCW A;  1WRL A;  3DD4 A;  1EMB A;  3DQ8 A;  4L1I A;  3ST4 A;  1F55 A;  1KK7 Z;  3DQI A;  4DXN A;  5HW9 A;  3SVN A;  3NF0 A;  2WOR A;  5D7F A;  2LHL A;  1EML A;  2EC6 B;  3G9A A;  4AOM A;  2LVK A;  4DRW A;  2H61 A;  2KQY A;  2BCA A;  2WIS A;  5ER5 A;  1DT7 B;  4HRH A;  4N1F A;  1EMK A;  2SAS A;  2DUG A;  2L51 A;  4GAO A;  1B7T Y;  2KQ6 A;  4N3D A;  3RWA A;  2F33 A;  1B4C A;  2GGM A;  4N1G A;  3JTD B;  1M45 A;  1DJX A;  4W6H A;  4ZF3 A;  4H48 A;  2BCB A;  2VVI A;  3SSL A;  1QAS A;  2IS9 A;  2OS8 B;  3AKA A;  2O29 A;  1G4Y R;  5FVG A;  5KU1 A;  4ZF4 A;  5AXI A;  1RMP A;  1DJI A;  3D0Y A;  3IP2 A;  1CLB A;  2H2K A;  4ICB A;  4QJ4 B;  5T3I A;  1TCF A;  1GGW A;  1JBA A;  3SVE A;  5CSJ A;  1FI5 A;  2BBM A;  1OQP A;  1NWD A;  4GGN A;  2OKY A;  3DQ9 A;  3U0K A;  2YE0 A;  3SVS A;  3ST0 A;  2JC2 A;  5KSZ A;  2LLU A;  2WIQ A;  4H3M A;  2LM5 A;  1ZAC A;  1KYR A;  1R6P A;  1ZFS A;  4W7A A;  3DQO A;  1QYO A;  3ZUL A;  1J7R A;  4CLN A;  4ORA B;  4EDO A;  2KFG A;  1KQM B;  1UHN A;  2Y5I A;  5FVI A;  1KK8 C;  2Q91 A;  3MSE B;  3K21 A;  1CMG A;  4YGA A;  2LMT A;  3CZT X;  3WHU B;  5B8I B;  1IH0 A;  3U0L A;  3BOW A;  4B30 B;  2ZN8 A;  3D10 A;  1IQ5 A;  1WLM A;  2CBL A;  1KWO C;  5H89 A;  4C0J A;  1Y1U A;  4A4C A;  2LVJ A;  2A48 A;  1K93 D;  4W73 A;  5EB7 A;  3SVD A;  1AJ4 A;  3P8U A;  4QJ3 B;  2BE6 A;  1EG3 A;  1JF0 A;  1SL7 A;  2K7D A;  4IL1 A;  3VK1 A;  3I5I B;  4YGE B;  4OQW A;  4KA9 A;  4GNK B;  3SG7 A;  3CFF A;  1LXF C;  1R2U A;  2BCX A;  2M7N A;  1OZO A;  4BY4 A;  1IGV A;  1QY3 A;  2HFC A;  1XFX O;  2FOT A;  1ODB A;  3PFV A;  4KW9 A;  1QV1 A;  4W75 A;  3A4U B;  2JT3 A;  5DTL A;  1S5G Y;  4XGY A;  2WCB A;  2ICR A;  3LVC A;  4I2Y A;  1C7V A;  1F4O A;  1W7J B;  4F0Z B;  4ORC B;  2Z6Y A;  1A2X A;  1IKU A;  1SR6 B;  2M1U A;  1CM1 A;  5G08 A;  1J55 A;  2EHB A;  1BLQ A;  1CFD A;  2A54 B;  2JNX A;  2G3O A;  3PSR A;  3AKO A;  4YGB B;  2BE4 A;  4HQC A;  1AUI B;  2F3Y A;  3BUO B;  1M39 A;  3PN7 C;  1LIN A;  4L13 A;  3LVA A;  1TNQ A;  3DQ6 A;  4ZIO A;  3U8P A;  2KGR A;  2M8U A;  1SBJ A;  1QX2 A;  2OJK A;  5CSN A;  1AK8 A;  3EKH A;  2G5Z B;  1K9U A;  3OB1 B;  4LJD C;  3H1O A;  3F45 A;  2VVJ A;  3I5F C;  5HLV A;  5CSI A;  2H5O A;  4JC2 A;  1FBV A;  4P5O E;  2OTG B;  2PAS A;  3H4S E;  2P4M A;  1F09 A;  3TUY C;  1ZGQ A;  2V53 A;  1W7I B;  2VVH A;  2Q6P A;  1NUB A;  1DJZ A;  4ZF5 A;  2M7L A;  1KYS A;  4ORB B;  5EHU A;  2JTT A;  1G7K A;  5FHV A;  3ST3 A;  3TDI A;  4DKN A;  1OXD A;  1Y6W A;  1AP4 A;  1JBY A;  1L2O C;  1K96 A;  3AKB A;  3SVB A;  5J2O A;  4XJK A;  1JF2 A;  4ETO A;  1KWO B;  2ZO6 A;  2WHS A;  2FZU A;  4WRI A;  1CLL A;  1BR1 B;  2WHU A;  1WRK A;  1Y0V H;  4R6D A;  3UFZ A;  2I7A A;  4JPZ B;  1QX7 A;  1ALV A;  2AMI A;  3KPX A;  3JVT C;  3ZWH A;  1V1F A;  2E30 A;  1XSS A;  2ZRT A;  1K90 D;  4CFQ A;  3IQQ A;  4W6G A;  3VRR A;  5BPJ A;  4PFE A;  4B5Y A;  1NX0 A;  3BUN B;  4DXM A;  1DJY A;  2KAX A;  3NXA A;  2KFF A;  4PHJ A;  3DF0 A;  1CDP A;  2AH8 A;  2DUF A;  4KGF A;  2Y1M A;  4I5K A;  3WLC A;  1YUU A;  4MN0 A;  2EC6 C;  3ZUF A;  4KW4 A;  1PUL A;  4PE1 A;  1SRA A;  2BKH B;  3KCS A;  2GX0 A;  1BJF A;  5DKN A;  3MGF A;  3LA1 A;  1OE9 B;  1RK9 A;  4GPL B;  4W7R A;  1E8A A;  1SKT A;  1F70 A;  3KF9 A;  1DVI A;  1RWY A;  2AAO A;  4W7X A;  3JTD C;  1MQ1 A;  2BBN A;  5DQB A;  2GW4 B;  5D69 A;  2BEC A;  2HQW A;  4QJ5 B;  4NWS A;  2GGZ A;  4RYW A;  3DQF A;  5DRF A;  1B1G A;  4HVF A;  2OS8 C;  3PN7 B;  4KAG A;  3DQD A;  4MRX A;  1SMG A;  3I19 A;  3W1C A;  2V4E B;  1JFJ A;  2LUC A;  1FW4 A;  2M0R A;  1ALW A;  2M29 A;  3AAK A;  5BT0 A;  1YVH A;  1IJ5 A;  2M3W A;  1HQV A;  2ARL A;  3NED A;  2IB6 A;  1LKJ A;  4NDD A;  1EME A;  3OX5 A;  2KI6 C;  2NCO A;  2RGI A;  4FTG A;  1KSM A;  2LV7 A;  1CFP A;  5HKW A;  4RYS A;  1YX8 A;  1OSA A;  1S1E A;  2Z6X A;  3U8C A;  2VAE A;  4GF6 B;  3GK2 A;  1MF8 B;  1CM4 A;  1PK0 D;  2IOV A;  4LJC A;  1ZUX A;  4GFT A;  5LTQ A;  1TRF A;  3SVU A;  1KQM C;  4MZK A;  2B3Q A;  2WSO A;  4GGF C;  3IQO A;  3NT9 A;  5EBJ A;  1GFL A;  1XFV O;  1L2O B;  1Y1X A;  4KF4 A;  1AHR A;  1DGV A;  3DVE A;  1IWQ A;  2JWW A;  5AAN A;  2FWQ A;  2HCG A;  3OB2 B;  5HKY A;  1UHJ A;  2C9I A;  3AI4 A;  5HLO A;  5DKQ A;  1BOC A;  5EXU A;  2C9J A;  4JEO A;  2KI4 B;  1A4P A;  3DQJ A;  4PAL A;  5H88 A;  3EK8 A;  2LMU A;  2Y4Q A;  1SPY A;  4MEW A;  1YVL A;  4AS8 A;  4W74 A;  3CD9 A;  3BUW B;  4IZN A;  4TZG A;  4Q9W A;  3I5I C;  1YUR A;  4W7C A;  2MLE C;  2OTB A;  1UHH A;  3OGO A;  3NSI A;  3EVR A;  2A52 B;  1MXE A;  5EJU A;  4W6J A;  5EXB A;  3DVM A;  2Y1N A;  3EVU A;  4MSP A;  2DDD A;  2LNK A;  1CTR A;  3GK4 X;  1SY9 A;  2AWM A;  4GGF A;  2K61 A;  3ED8 A;  3DQ1 A;  1ZUZ A;  2HPW A;  4H3L A;  1KYP A;  3LL8 B;  4W6M A;  4ZCV A;  1SR6 C;  1EH2 A;  2KDH A;  4IK8 A;  2DUE A;  1EMF A;  1G33 A;  1RM9 A;  4W6B A;  1S3P A;  3PJB A;  4W6K A;  4AR7 A;  1NCY A;  4I5N B;  3VHT B;  2QRF A;  2IE2 A;  2FJU B;  1K95 A;  2I18 A;  4B30 A;  1UIS A;  4E68 A;  1SCM B;  4H47 A;  2O60 A;  3FS7 A;  1JC0 A;  1KSO A;  3PJ5 A;  2YDZ A;  4AQI A;  1UWO A;  1CKK A;  2LHI A;  3NSO A;  3KCT A;  4IK1 A;  3SSP A;  1OZS A;  3I5H B;  2DUH A;  3CWG A;  2MA2 A;  5DTY A;  2ZNE A;  2HQK A;  3ZNI A;  3WHT B;  2B1U A;  1RRO A;  1IG5 A;  4BDU A;  4DUQ A;  3TDZ A;  3WLD A;  2LE9 B;  3SSV A;  3FIA A;  3K1K A;  4JFG A;  4ORN A;  2OTG C;  4W6P A;  4ZBL A;  3FWB A;  2AWL A;  3DQM A;  4KF5 C;  5H87 A;  2ZMU A;  3TMR A;  5CSF A;  3CD1 A;  2H6V A;  1XMZ A;  1RFJ A;  1XQM A;  4W76 A;  3RM1 A;  2JQ6 A;  2K2F A;  1QS7 A;  5KTY A;  2KOT A;  4YI9 A;  4Q7U A;  2M1K B;  4W6S A;  1PVA A;  3NT3 A;  1C07 A;  3P28 A;  3BUX B;  1U5I B;  1N65 A;  1NYA A;  1CLM A;  3DQ3 A;  1KP5 A;  4KW8 A;  4IK5 A;  1M46 A;  3C1V A;  1KK7 Y;  1Q80 A;  3TS5 B;  4IK3 A;  3KO0 A;  4PHN A;  5DPH A;  4MRY A;  2LLS A;  1XFZ O;  1QIW A;  1JBZ A;  2QLG B;  5HZO A;  3HX4 A;  4M2O A;  1QXP A;  4JRB A;  2I94 A;  5AFP A;  5DY6 A;  2O24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...