3SG8A

Crystal structure of aminoglycoside-2''-phosphotransferase type iva tobramycin complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
298
structure length
298
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Antibiotic-Bound Complexes of Aminoglycoside 2''-Phosphotransferase IVa Highlight the Diversity in Substrate Binding Modes among Aminoglycoside Kinases.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase/antibiotic
molecule keywords APH(2'')-Id
total genus 103
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3sg8A01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3sg8A02
1YI6A 2Q0BA 5CSWA 4X6RA 2W17A 4Q2AA 3PPZA 4RLKA 3BBTB 4XV3A 2VNWA 3CY3A 3R9DA 3PY0A 3AC3A 3GGFA 2X8EA 4X7QA 5FBOA 1XH7A 4DTKA 2PL0A 4ASXA 3CQUA 4BC6A 1UU8A 3OY3A 5TOZA 3LCOA 3JXWA 5EM5A 2VGPA 5HEZA 3DTWA 4FG9A 3HECA 4QYEA 3NYXA 2ZV9A 4AA5A 5CZHA 3CPBA 4OUCA 2IZSA 5L8JA 2HW7A 4QQ5A 3TL8A 3AXWA 2I0YA 4QPSA 2PSQA 2OH0E 2RFDA 5J5SA 3O2MA 4LRMA 2HY0A 3AMYA 3PIYA 4NZWB 1WBTA 3R1NA 2B52A 5D9HA 3RP9A 3JUHA 2PUUA 4I0RA 5FM3A 5HNIX 4CEGA 3ALOA 4F9YA 4L6QA 4JIAA 3A99A 2VWYA 3VS2A 3W0SA 1S9IA 2IWIA 1PXOA 3BGPA 4FNXA 2JDSA 2VD5A 4GJ2A 4IM0A 4AW0A 1WVYA 3ATTA 1XQZA 3KREA 4MQ2A 2ITUA 4HJOA 3EL8A 4XS2A 3BIZA 2X2LA 5IMEA 3V5QA 4E5AX 4YUQA 2UZLA 3OP5A 4LYNA 3FI3A 4CRLA 3EQCA 4GVAA 1OKZA 2R3JA 3ZRLA 5M06A 1LUFA 3OY1A 3LLAA 4JAJA 5AUXA 5EKNA 3Q5ZA 2XK9A 4JG6A 4DEHA 3UQFA 3NYNA 4G5JA 3H0ZA 4FTQA 2IZUA 2BKKA 5M4CA 1M2PA 1URCA 3Q32A 3EQFA 1VYZA 4GEOA 5CAOA 2JKOA 4ZSLA 3UZTA 3MTFA 3E93A 4R77A 5EI2A 4IX5A 4TZRA 5CENA 4CGAA 3OT3A 5BX0A 3TIZA 2HXLA 4FKQA 5JSMA 2WTWA 3CBLA 2YIYA 3QZGA 2WTCA 2PVJA 4M13A 3VJNA 5GINE 3R9NA 3G6GA 4KA3A 3TKIA 2CJMA 1UWJA 2UZOA 3DDPA 2VO7A 2XNEA 2VTTA 2BAJA 3KMWA 4KINA 3NVKI 3DB8A 4HPTE 4O84A 4D58A 3PIZA 3ZRKA 2PVNA 3V5JA 1Y6BA 2F57A 4FZDB 4FZ6A 5AEPA 4PTGA 1ZY4A 3PA3A 1XBAA 5AP6A 2W4JA 4EK6A 3WZUA 2QO9A 5HI2A 2O65A 3IW4A 4BCHA 2V5QA 4F7NA 3QQGA 4CRSA 4ZMEA 1O9UA 4FSYA 5DNRA 5JK3A 4M69B 3FLYA 2UVXA 4PWNA 3QD3A 1VEBA 2WTVA 4UZHA 4W4WA 3FZ1A 5CU4A 3QCXA 4F99A 4DEAA 3JY9A 3U87A 5CVHA 3UE4A 1JPAA 4F7LA 4I4FA 3B2TA 2XIRA 3LQ8A 4OT6A 1IAJA 2PY3A 4FSRA 3VHKA 3MWUA 3Q9ZA 3SC1A 4FV6A 4GU6A 4WO5A 4EBWA 2WU6A 4Y83A 3LMGA 3NSZA 2VNYA 4EUTA 3FZSA 4MXAA 2IJMA 2J7TA 4O82A 2EB3A 5AA8A 1M14A 5CSXA 4HVGA 3NLBA 5H2UA 3W2CA 2A4LA 4RRVA 4HVIA 2XM8A 1PXNA 3TYKA 2R3QA 4W8EA 3AD6A 5HGIA 5DHJA 2W1EA 1PMEA 4AZFA 4UEUA 3HDMA 3OEFX 4AOTA 3PRFA 1OIQA 3UOLA 4KBAA 2CMWA 2J51A 5GHVA 3EKKA 5E4HA 2IW9A 3UO5A 2QLQA 5GNKA 5A14A 3EHAA 4D5KA 4FSUA 3CTQA 4DG2E 5DIAA 3R9HA 3QQFA 2UVZA 4GIHA 3UJGA 4Y73A 3II5A 2H6DA 3PTGA 3V8TA 1SVEA 1ZYCA 3NIEA 4EBVA 1ZWSA 3PY1A 3CXWA 1W7HA 4QMQA 3F6XA 1H1WA 3EN5A 3PXRA 4JRNA 2XVDA 4MX9A 4EHGA 5KHXA 1LR4A 1V0OA 2DWBA 3NMUF 4BDJA 1ZOEA 1W0XC 1H07A 2I0VA 3PVUA 5KO1A 4FYOA 2XEZA 3IGGA 2NRYA 5ACBC 4QTCA 5LCJA 1LEWA 1ZMWA 2C6OA 4FUXA 3MIAA 2E9OA 2WTKC 3DXNA 4FGBA 3U9NA 3QQHA 2BAQA 3R7OA 4O6EA 1LPUA 2J5EA 4FTAA 2G1TA 4FUYA 5A4TA 2BRHA 1IA8A 1BUHA 3MY5A 2GDOA 2YWPA 1ERKA 2B0QA 3K54A 3MFTA 3RK7A 3GP0A 3S95A 5G1XA 4C34A 4IAZA 1JNKA 3RNIA 4DEGA 4M0ZA 4CKRA 3GU4A 1DI9A 5FTOA 4B7TA 1W84A 5CF6A 3EIDA 4MXZA 3U4UA 3UMXA 4C3RA 4QP8A 2QHMA 3ZBXA 4XHKB 4A4OA 2PE0A 5EI8A 4ASZA 2C6KA 2X0GA 4BCKA 4FT7A 3ANQA 2PMIA 2CHLA 4ENXA 3SW4A 5HTCA 5FXQA 3S1HA 2G01A 3MB6A 5DOSA 5KKRC 1GIHA 2R3LA 4TL0A 5IUIA 5BVWA 3ZSIA 3VBQA 3P0MA 3LHJA 1ZZ2A 3GOPA 1GIJA 2PULA 3NYOA 4JT3A 4EH6A 1FPUA 3BGZA 3FL5A 4IVDA 4PL5A 4RSSA 3FY0A 3PXYA 4YC8A 3HV3A 1VZOA 3DNDA 4PQNA 3M2WA 3VRYA 4IAFA 4KABA 3IQ7A 3A4PA 3DV3A 5A3XA 4BCQA 3OXIA 1L3RE 2R64A 3VO3A 3FLSA 3SDJA 5FQDC 3Q53A 3WZJA 4RJ3A 4FIEA 3G33A 3IGOA 3MY1A 5D11A 1YQJA 3PJ8A 3E5AA 5EDRA 4ENYA 4FKTA 4I1ZA 2EU9A 3LFBA 1BI8A 3AC4A 3FHIA 4GKHA 4AW1A 4L43A 4AN2A 2BRNA 1OKYA 3JS2A 4YJPA 4X3JA 3RKBA 4D55A 1J1CA 1OUYA 2JIVA 3BQCA 3VNTA 4JNWA 4CLJA 5IF1A 1F5QA 3SVVA 2BRBA 3CCNA 3FLZA 5JFXA 3KK9A 4AT3A 2PYWA 3JR1A 4HYSA 4J98A 4BHNA 4EYJA 3LFEA 5CU0A 3RHKA 3RJCA 4YLKA 4XG7A 1X8BA 5DVRA 1H26A 3A8WA 2BUJA 1MQBA 4G3FA 4R7HA 3DFCB 2CPKE 4JS8A 5IQBA 2WFYA 1QPJA 2YFXA 4FTTA 3RI1A 3R8VA 4ERWA 4HYUA 4XRLA 3CEKA 3W55A 3GI3A 1YVJA 4FEQA 2YIWA 3LFNA 4JX7A 3TDVA 2OH4A 3R00A 4E4MA 4YO4A 1GOLA 3NPCA 2SRCA 5KMMA 4JX3A 2OIDA 1PMUA 4IAKA 4ACMA 5BPYA 5DG5A 2CKOA 5HO8A 3NCGA 4J53A 4MVFA 5CAVA 2QO2A 4LGHA 4IB3A 4G6NA 2FB8A 1KOAA 3EL7A 3NZ0A 2UW7A 2BAKA 4UN0C 3UO6A 4QTBA 4FTKA 2WMTA 5EM8A 3W0NA 3QYWA 2WPAA 4U8ZA 5BMMA 4NCTC 3ZZEA 4IADA 3OZ6A 3UIXA 4BZDA 3SGCA 4IVCA 2XIXA 4NM0A 3U6HA 5J7HA 3QCQA 4O0SA 3T3VA 2XH5A 4D4VA 3RALA 3MGYA 3DU8A 3KVWA 4BBMA 4MNFA 3UC3A 4DH5A 5J9YA 2OJGA 3CKWA 4E6AA 5LWNA 4NJDA 3TNWA 3PLSA 2ERKA 1Q8UA 3DBQA 4O21A 4FIHA 3RAWA 1OL2A 4LV5A 1OKWA 5F94A 2WB8A 3LMIA 4IB0A 5JMSA 3ZFXA 3BEGA 3DY7A 1UVRA 3KXNA 3RAHA 4F6UA 5CANA 4ZLOA 3UVPA 2YCFA 5H8BA 5CEQA 5CT7A 3BHUA 3RPSA 3DXQA 2XCKA 5EQEA 3ZTXA 3UPZA 5G6VA 2NNWB 3AT4A 5HKMA 3ORKA 3DBCA 1OBGA 4WD5A 2IZTA 3NS9A 4XG4A 5E8ZA 5JFWA 2PPQA 2CNUA 3QXPA 4RX5A 3I4BA 3BBWA 5JFVA 3IOPA 3MV5A 4I6BA 1UKHA 4EH7A 4KKHA 3ZC5A 2X1NA 1IG1A 2VWZA 3FLWA 4G5PA 4ALUA 5CXZA 2W4KA 3KMUA 2JBPA 4GSBA 4AWIA 4EJNA 4CG9A 3W2OA 3KKVA 5HNBA 3RCJA 4YZCA 3HA6A 4IFCA 4PDSA 5CVFA 3HMOA 2WEIA 2Y4PA 2B7AA 5FEEA 2V0DA 3FZOA 4PV0A 4S2ZA 5I9UA 3TTIA 5IDPA 4W4VA 5DBXA 1ZYDA 5HIBA 1M7QA 5HE2A 2W4OA 4CFMA 4RQVA 4UYAA 4CFNA 4FMQA 5I9VA 5IQEA 4JLCA 4DFUA 2PZIA 5ETCA 1JKSA 2O2UA 4C0TA 3P7CA 4RT7A 3D83A 3TZ9A 4ANLA 2WQOA 2G9XA 5BUJA 3P08A 2J0KA 4KRCA 2GQSA 4RIWA 5ANOA 5A6OA 1B39A 3FMLA 2BHEA 4HYHA 3V5PA 3PRIA 4O7SA 4CFXA 3OXTA 4G3DA 3ACJA 1OL7A 3WIKA 4MNEA 2ITNA 3PJ2A 4L3JA 4EL9A 5M51A 2PZYA 3E7OA 2OI4X 3JYAA 1YXVA 2ITTA 2ZV2A 4XOYA 4AF3A 2W1DA 3QU0A 3OVVA 3DCVA 4ERKA 4TT7A 4MXXA 4DG3E 4U3ZA 4EOJA 1I44A 5DT0A 4FTLA 4ZTQA 3IG7A 4QMZA 3BYSA 1P14A 3GNIB 5EW3A 4QMOA 2HZ4A 3GC7A 2YCQA 3O8TA 1GZ8A 2QOBA 5AV1A 2WOTA 4HGLA 4WUNA 3KRRA 4E4XA 1YKRA 4D4RA 5IU2A 2QOFA 4PTEA 3ORXA 1GZKA 4ANQA 4CLIA 4I94A 5ANGA 4FIJA 4XG2A 4ZIMA 5C8MA 3P7BA 4HYIA 3BLQA 3PSBA 4GT5A 5BYZA 4ZXTA 3VBWA 3K5VA 4CFWA 1P4OA 3W8LA 4O2PA 2PUPA 5AUYA 3MESA 4MD8E 1YHVA 4E8AA 3BYVA 2XA4A 2VWBA 1LEZA 4KIOA 4AZTA 3LZBA 4IZAA 5C8KA 4FTNA 2JFMA 3DZQA 3NW7A 4WRGA 3QHRA 4WG4A 4E4NA 3ODZX 3QQJA 4AGDA 2W9ZB 3MFUA 3MVMA 2UW6A 4M68A 4WA9A 4Q9SA 1H1PA 4D0WA 4FT3A 4MBJA 4USFA 4RFZA 4Z9LA 3UPXA 2E9PA 3WYYA 3OWLA 2JKMA 1YI3A 4F64A 4L42A 4Z7HA 2WMRA 3VW8A 4EOOA 5E8VA 2XNOA 4GYIA 2XKEA 5HD4A 2ETRA 2XP2A 3UZPA 3FYKX 4ITHA 4K18A 4O0UA 3VC4A 5CEOA 2CN8A 4DTAA 4LRKA 5IZFA 4RJ8A 4O0RA 2W96B 3QTZA 4IE9A 4IW0A 5E1EA 4X21A 2CNVA 5H3QA 2QO7A 3VBVA 4LUEA 1FMKA 3TT0A 5JRSA 3QCSA 2GNFA 4NYEA 2V7OA 4RMZA 4E73A 4P5ZA 4RBLA 5EM6A 3T9IA 2JD5A 4UY9A 3Q4UA 1JKTA 3THBA 2GCDA 4L3LA 3V6SA 3UQCA 3ZHPC 3Q96A 5LMKC 4R7BA 3VS3A 1UNGA 3UIMA 3ET7A 4TY1A 4EHEA 4ZY4A 3F7WA 3UYSA 3HEGA 3TV6A 3WIGA 3V04A 3WE4A 4EZ7A 3H9FA 4IZ7A 1OMWA 3VVHA 4ARKA 4EH4A 2OJJA 4I4EA 4WUAA 2C6MA 2PK9A 3O17A 2WQMA 4FTUA 5CI6A 4AOJA 4U81A 3P78A 3VS1A 3ZLXA 4CQEA 2WU7A 4C62A 4EI4A 3W2RA 4RLLA 3F88A 3KXMA 5IQIA 1WVXA 3AC2A 3LCSA 3DK6A 3VBTA 5EW8A 2RFSA 2QCSA 4L01A 4U5JA 3KRWA 4ZSEA 4D28A 4IDTA 2PVKA 5EYCA 2IVUA 3UDBA 4JQ7A 1YI4A 4NTTA 4EC8A 2BR1A 4C36A 3O23A 4XV1A 2EVAA 1KV1A 3AC1A 5CF5A 1OIRA 4TNDA 5AAEA 5B2KA 5CF8A 3WZDA 4DFYA 2UZVA 4G34A 5LMKA 3EN6A 4U3YA 3OF0A 1PMVA 1YOMA 4JG7A 4QO9A 2PZRA 2ZJWA 3GC9A 5C1QB 3TNPC 2ITXA 1PXLA 4PMTA 4IAYA 3TTJA 4DLJA 3OC1A 3R0TA 4JBPA 2VX0A 3SAYA 3WF5A 3QA8A 4IX6A 5CWZA 4X2FA 4QTDA 5CASA 3OT8A 4NIFB 5AAGA 5ETAA 4H39A 5HTBA 4D9TA 2VTNA 2UW4A 3KU2A 4ANSA 4ORKA 3OUNB 4MK0A 4UX9A 2P4IA 3RM7A 4DGMA 1ZXEA 4QMLA 3OWPA 2R9SA 5M55A 1OL1A 2R3HA 4H3PA 2JEDA 4S34A 3W1FA 4CTBA 2HENA 4EUUA 4YZBA 3LFSA 3R2BA 5A4LA 4OW8A 5AV0A 4GVJA 5KMJA 2WIPA 5L6OA 4PY1A 2WEVA 3NUAA 4S32A 2XUUA 3Q9YA 5C03A 3QKKA 1CDKA 5CYIA 2BZHB 4C2WA 2YA9A 3MFSA 4JQ8A 5HVYA 3SOAA 4F9CA 1TQMA 3RWPA 1YHSA 3QHWA 4CFVA 4DEIA 1RJBA 4N6YA 3UOHA 4E4LA 3PE1A 4TWCA 1OZ1A 3FY2A 3KF7A 2PVMA 4QYYA 4NKSA 4Y8DA 4YBJA 3VUGA 2J50A 3WILA 5HIEA 3EWHA 5AV4A 3SD0A 1IRKA 2WMSA 5LVNA 3QRIA 3LVPA 3D94A 4IQ6A 4PNKA 3PZEA 3ENMA 4IACA 2BHHA 3CD3A 4FKOA 3SXFA 2Z7LA 3RCDA 2YM6A 4FI1A 2B4SB 3R71A 3NUSA 2PVHA 4U94A 2HY81 3O8PA 2GS2A 4HNIA 4L67A 3F82A 3GFEA 3MDYA 4CNHA 3G5DA 2UZTA 5IISA 4RZVA 4WRSA 3K5UA 1G3NA 3W32A 4BI2A 3KN6A 3PLAE 2ZYBA 3SW7A 5CU2A 5EM7A 4M3QA 4BTJA 2WMQA 3RHXA 2WTKB 3KCKA 3GOKA 2VN9A 3NCZA 4BB4A 2OJIA 2VTHA 4RJ7A 4XLVA 4QNAA 4FTIA 3UG2A 4E6CA 3EYHA 4IMYA 4QMWA 4ZLZA 3ZS5A 2RGPA 2QOCA 4BDEA 4JDJA 4YMJA 3ENHA 2I6LA 2YEXA 3OXZA 2BTSA 2CKEA 3C4ZA 3OCSA 2QR8A 2UW5A 1UU9A 3DQXA 4FNWA 3QTUA 1YHWA 4YJRA 2R3GA 4ZY6A 4WG5A 4KS8A 5LQFA 4G6OA 2X39A 4QP7A 4BVUA 4FL2A 4YJTA 5J1VA 3HZTA 5AAFA 3MJ2A 3R7IA 2Z2WA 1OECA 3BHHA 3TUCA 4Y72A 3LQ3A 3MPAA 3BYOA 3MVLA 4RIWB 5HU9A 4NSTA 2C6EA 2QU5A 3WF6A 3V6RA 4K77A 2E9NA 1Q3DA 2HAKA 3KGAA 4JBOA 5HLWA 2B54A 4XP0A 5KMOA 5BVFA 5KKRB 3D0EA 4K8AA 2QKWB 4GG5A 5DE2A 4EQCA 2YM8A 3A7IA 3VS7A 4YR8A 3F3VA 4QOXA 3DS6A 2XBJA 5CALA 3F69A 1ZRZA 2QHNA 3QC9A 2BIKB 4MWHA 3A60A 3VWAA 5BVKA 3TG1A 4NM7A 3TKHA 2FO0A 5DEWA 1REKA 3MPTA 4EZ5A 2GPHA 4D4YA 1XH6A 4AFJA 4EOMA 2B53A 4J96A 2OZAB 1SVHA 4I6QA 3FBVA 4FV5A 2C6DA 4RIXA 2VU3A 4DAWA 3KXHA 4FV2A 1JAMA 2RG6A 4II5A 4IZYA 3TZ7A 2OZAA 3V5WA 2C47A 4YZNA 1PJKA 1U54B 4CTCA 2X2KA 3GENA 3I1AA 3UOJA 2QG5A 4FV1A 4OBPA 1UU7A 1SVGA 3HA8A 3RINA 4G16A 4AG8A 1Q97A 3QQUA 4KSQA 3ZSHA 2X9EA 3E7VA 4RFMA 2DYLA 3BGQA 3ANRA 3MS9A 1Q8TA 3HMNA 4O96A 4CMOA 4BCNA 3P1AA 4FKPA 2ITZA 4X2KA 3IK3A 5K5NA 2Y6OA 3DZOA 2ZV8A 1NXKA 5EQPA 4EOLA 4AA4A 3HAVA 4GCJA 5AV2A 2AYPA 4MD9E 4D5HA 3HMMA 2WKMA 3HUBA 3NAYA 3NX8A 2PMNX 5E8UA 4O91A 3H10A 1FBNA 4B99A 1PW2A 3HV5A 4M15A 2XIZA 4OTQA 4DH7A 2ETKA 3BYMA 1GJOA 4RIYA 4DINA 4I0SA 1Z57A 2VO3A 5CSVA 1M52A 5EG3A 3ORTA 5TF9A 4O0TA 2OW3A 5KZ0A 2YM7A 4J95A 4R5SA 3MPMA 4XH6A 4Z3VA 5HLNA 2JDTA 2C6IA 2C1BA 5T6KA 3UP7A 1OBDA 2R3PA 1TQIA 1H01A 2JDRA 3S3IA 4ZK5A 1O6KA 3LFQA 5IG1A 3MH1A 4NWMA 4C02A 3WE8A 4FODA 3MH0A 2R7BA 3N4TA 4FSWA 5K4IA 2WXVA 3EOCA 2UVYA 1KWPA 2YN8A 4YSJA 4AXAA 5J9LA 4ZEGA 4OTHA 3HRBA 1PYEA 4FKUA 4N70A 3BWFA 4CMUA 1QMZA 2I1MA 3KFAA 2PZPA 2QR7A 5JQ5A 2CCIA 4A07A 4DCAA 5IH5A 1SNUA 3P9JA 3ZM4A 4O0VA 3MA6A 5TKDA 2WMBA 2Y6MA 5C9CA 2FVDA 3FXZA 5I9XA 3V5LA 3F3WA 2YM4A 2VX3A 3FMMA 4EC9A 3HMPA 3FDNA 3D5XA 2C30A 3KVXA 4KB8A 3TNQB 4F6WA 1PXIA 2X7OA 3A8XA 4FTCA 4O0XA 4BCFA 3G15A 4KS7A 2PTKA 3G6HA 3WARA 1JBPE 3OG7A 3IW5A 2CKPA 4YZDA 4ANBA 5IDNA 5CF4A 4HZSA 4E1ZA 5HBJA 1YRPA 3EYGA 3TV4A 4H3BA 2CGXA 4PX6A 5K3YA 4MQ1A 4C4HA 4FVPA 3EZVA 3WF8A 3QD2B 3SRVA 3IO7A 3R22A 3L1SA 5IUGA 2FSMX 1KE5A 3Q4TA 3D7TA 2RFNA 3L8PA 3LJ1A 1JKKA 3CPCA 1U46A 3IDPA 4DFBA 4ONAA 3HDNA 4NCTA 3F3TA 4RJ6A 3R8MA 4U45A 3KY2A 4ITIA 4CD0A 5BMSA 5DR9A 5DRDA 2O3PA 2BDJA 2IZRA 4EK3A 4A7CA 3NUNA 2GSFA 2HYYA 3W0MA 4BR3A 4FX3A 2XK4A 3FL4A 1BMKA 3R1YA 4JVGA 4KRDA 4U9AA 4ZJJA 3DK7A 5TO8A 3LFFA 4D9UA 2ACXA 2YHVA 4Q5EA 4DT8A 5A46A 4FG7A 2HZ0A 4O83A 3QX2A 4K6ZA 3D5UA 2PE2A 4ZY5A 4CCUA 3VBXA 4KKEA 3PVWA 3T8OA 2BMCA 2H8HA 3ORPA 3MVHA 2Q83A 5IH4A 5FLFA 4L53A 5CZIA 3NIZA 3BU5A 4BI0A 4EK8A 5I9WA 3ACKA 3HV4A 2Q0NA 3WBLA 2ITYA 4DGLC 2VUWA 5LVOA 2PVFA 3QKLA 1GNGA 2W1IA 3PDTA 3PWDA 4ALVA 4C35A 3GBZA 1J1BA 1BL6A 4FVQA 2WTDA 3RK9A 2ZMDA 2NO3A 3V51A 1OIUA 3GEQA 3GT8A 1H24A 3PG1A 2ZV7A 3DJ5A 2QONA 4JOAA 1XH4A 2E2BA 2HWOA 4LRJA 3A7JA 4GKIA 3SX9A 3TNIA 3W0OA 5C26A 3HUCA 4FSZA 3DB6A 2XYNA 3OOGA 3NR9A 4IB1A 5AP5A 4KD1A 1Q61A 5FRIA 2X8DA 2XK8A 5DGZA 3VS6A 2UW3A 5I5ZA 2C4GA 3AGMA 3QZFA 4BZOA 2GFSA 4RWJA 4V0GB 1M17A 2WTJA 3QRKA 5DWRA 5LMAA 3UNJA 5AIKA 2QOHA 4WNOA 4JJRA 3W16A 5J95A 4GIIA 4XG6A 3EH9A 4RJ5A 5GIOE 1JOWB 4F0FA 3G0FA 5EYKA 3ZZWA 3W0QA 1Q62A 4ACHA 4YTIA 4MXCA 3CTHA 1FMOE 3FV8A 1F0QA 5CEMA 3ETAA 3DBEA 3ID6C 1WCCA 3AD4A 4RA4A 5DEYA 5DLSA 4QQTA 5C8NA 3EZRA 2R3OA 4ZP5A 3FQSA 2GS6A 2OXDA 3EFWA 4JIKA 5HESA 3FWQA 4YZ9A 3VJOA 4EOQA 4NW6A 4PNIA 3BHVA 4U41A 1XWSA 3QLFA 4EKKA 5L2IA 1WBVA 1JSUA 2GQGA 3LE6A 4FKVA 2XM9A 4QP2A 4AGUA 2ITPA 4O7YA 4YJNA 5FG8A 1BX6A 5HBHA 3OCTA 1ZY5A 3DKFA 4L52A 4LQMA 3R02A 5J9ZA 5DR6A 3QLGA 2F49A 2YM3A 2GFCA 2BFYA 4FL1A 3CP9A 5CVGA 4JR3A 2ZMCA 5C4KA 3V8WA 4ZZMA 1HCKA 2ONLA 4BDCA 3VUMA 2CLXA 4FV3A 3CGFA 4J97A 2XF0A 5FTQA 5LXMA 4OTRA 3EFKA 2JLDA 2W1GA 5AIRA 5FM2A 4C58A 2IG7A 1KE6A 3KEXA 4QMSA 1AD5A 3D2KA 2GHMA 5F4NA 5EYDA 4MXOA 5LOHA 4I5CA 2YJSA 1MRYA 2B1PA 2C0TA 3C4FA 4O7RA 3S2PA 2OIBA 3ORLA 3E8EA 1PHKA 2YWVA 1NY3A 3FI8A 5E8XA 5F1ZA 4NH1A 2X4FA 2FSTX 4AZWA 1Y6AA 2OGVA 2WD1A 5LJJA 3PSCA 3GUBA 2GNIA 4WOVA 4RG0A 3S4QA 2YDIA 5E8YA 5BYLA 2XS0A 3PA5A 1UWHA 5JKGA 4MBIA 1DI8A 1V1KA 5JRQA 1JQHA 3CD8A 1V0PA 4TWPA 4BDAA 4DEDA 2QG7A 5E8TA 4P4CA 1W8CA 5HE1A 3HV7A 3FKLA 3A61A 4RC4A 4IVAA 3UNZA 3R01A 4MKCA 2QC6A 3GCVA 3QGWA 4HOKA 2VTPA 4AGCA 2W7XA 2YCSA 3DNEA 2AC5A 4EOIA 2R7IA 5IA4A 1YWNA 3PE2A 1H25A 4OGRA 3D15A 2X6EA 5FEDA 2F7EE 3LM0A 4HGEA 2F4JA 3FYJX 2F2CB 3FXXA 5L6WL 4E5BA 3GCQA 4IJ9A 4FNZA 4YO6A 5EFQA 1JWHA 4NM3A 4CV8A 3KN5A 2YERA 1XH8A 2F9GA 4OTFA 2I7QA 3ZLSA 1H1SA 4FZ7A 4FA2A 4DYMA 4Q5HA 1STCE 4TYEA 2RFEA 4YURA 3ZUUA 2OFUA 1QPCA 3MTLA 4X2NA 3ZMMA 4AN9A 3MH2A 3UOKA 1O6YA 3F3UA 4YC3A 5JT2A 4U42A 4RVKA 3QUPA 1AGWA 1H0VA 2ONLC 4F08A 2W5BA 3CGOA 4FIGA 4NT4A 3QRTA 4LMUA 4EQMA 4RIYB 3SG9A 3ZFMA 4EQUA 1WBWA 3BE9A 1GZNA 4FT0A 5E90A 3FQEA 4PTCA 2E9VA 4NM5A 4AP7A 1VR2A 1OL5A 3ZUTA 5AP2A 1RDQE 2YAAA 4HCTA 2B9FA 3LCTA 5IQAA 4DLIA 4F7JA 2GNGA 4H58A 4WIHA 5HCXA 3CTJA 4I23A 4A9YA 3JPVA 2BZJA 4BDDA 2C3KA 4BF2A 5HX8A 4BIDA 4IEBA 5FXRA 3NVMB 3G90X 4FV7A 3C1XA 5BVDA 1PXKA 3ULIA 3ZDIA 2JFLA 4KIPA 5HE3A 3R1SA 3C13A 3TI1A 5AP4A 3D4QA 3DA6A 5L2WA 2YM5A 2OZOA 3EQPA 3KRJA 5JZNA 4UWCA 1WBOA 1IA9A 2YIXA 3OOMA 5H8GA 4CFFA 2O63A 3KXGA 5KMIA 5BVEA 3PXQA 4XG9A 3RAKA 4YZMA 1DAYA 3AT2A 4RIXB 2XNGA 5J87A 4GMYA 1IR3A 3PP0A 1YXSA 4PMSA 3I7CA 3BKBA 2WQBA 3G51A 4QYGA 4BDIA 3QRUA 3PP1A 4ZTLA 3DLZA 1U5QA 2Y4IB 3EQIA 5AP1A 1XBBA 3C4EA 3F9NA 5D41A 4CMTA 3PXZA 3ATSA 3C9WA 5AM6A 3A62A 4FKLA 4JAIA 1J3HA 5FDXA 4A9RA 4BCGA 3FI4A 3QRJA 4C38A 4AOIA 3E3BX 3VUIA 5IA0A 4G1WA 5B7VA 4U98A 4QMXA 4QP3A 4FC0A 3ERKA 2PHKA 4DC2A 2REIA 4YJOA 3RGFA 3OHTA 3R21A 4P90A 1P5EA 3OTUA 3DKOA 1NVQA 2H34A 3IONA 4H36A 4BI1A 5IA1A 3UTOA 3CLYA 2VTMA 3L8SA 4Y5HA 3RPOA 4L44A 4BICA 4F0GA 4JBQA 4GYGA 3WZEA 1UNHA 5E8SA 3QXOA 4I41A 2HWPA 4L46A 5DR2A 3ZLWA 1Y91A 4J99A 2OXXA 4QMVA 3F3ZA 1PRYA 2I0EA 3TJCA 4TNBA 3PFQA 5AUTA 5KMNA 4NW5A 2AC3A 2HIWA 2ESMA 4J52A 3MVJA 4BIEA 1E9HA 4FV4A 5T3QA 1GIIA 4RWKA 4M0YA 2A27A 3MSSA 3Q2MA 4PP7A 5FGKA 2JDOA 4QMTA 2RL5A 4ZLYA 3POZA 2R3KA 2W5AA 2J90A 3AT3A 3Q9WA 3QALE 4M97A 4QP9A 5FD2A 3VF8A 4CT2A 4QQJA 3R8PA 5AFVA 3E8DA 3EJ1A 3SKCA 2A2AA 5K5XA 4BDKA 2FUMA 2OFVA 4J8MA 1R1WA 1IEPA 4XP3A 3KA0A 3PZHA 5GJDA 3NNVA 5CSHA 5JH6A 3O7LD 3IKAA 3E63A 2IVTA 4MWIA 3OW3A 4BGGA 4MH7A 3TV7A 1CMKE 4C4GA 2W1CA 4HVHA 3N4VA 3PUPA 3SQQA 3VAPA 5HIDA 5EDQA 4FSQA 5CEIA 4DGGA 4MEDA 4W4XA 5M08A 4GV1A 1Q8WA 3K3JA 4CT1A 4O22A 4O7NA 2VV9A 3D2IA 4AE9A 4D2RA 2X7GA 3O71A 4C7TA 5KBRA 1SZMA 2WELA 4BTFA 2QLUA 4AT4A 4GFMA 3UNKA 2W1HA 2JIIA 1REJA 4JQEA 1NA7A 2UUEA 5CEKA 3QA0A 4G9RA 4NKAA 2XJ1A 4BKJA 4HZRA 2HCKA 2F7ZE 3PPJA 4V05A 3OWJA 1YOLA 4YLLA 2VTJA 3VHEA 4I5PA 3ZO4A 3HMIA 4FEUA 4LUDA 1M7NA 1OPKA 4R3PA 4YBKA 4DBXA 1UV5A 2BILB 5J1WA 4O7OA 3Q9XA 2Y0AA 1SYKA 2GNHA 4RPVA 1NW1A 4K9YA 1BI7A 3C51A 2G2FA 3NYVA 4JXFA 3OW4A 4FT5A 3I6WA 4CG8A 4GFGA 5HICA 3R28A 3E3PA 3Q3BA 4O7WA 2R3RA 4YTHA 5EOLA 4IAIA 3MB7A 2CGVA 3L8VA 3NAXA 4G31A 1R0PA 4GUEA 2WOUA 4XBUA 5AJQA 3DFAA 5DI1A 4ZTHA 3R7EA 4A4LA 1Y8GA 4DT9A 4F6SA 3QGYA 4FKWA 2Y9QA 4I22A 4PRJA 4RIOA 5E8WA 3TM0A 1JVPP 2W0JA 3EQGA 4F09A 5HO7A 3OROA 4CVAA 4DTBA 3GU7A 3TIYA 1PKDA 3AG9A 3N51A 4N4SA 4CV9A 2J6MA 5EHYA 3LFDA 2B9JA 5EH0A 2BFXA 5L6PA 3C5UA 3B8QA 4O86A 3DKGA 2JGZA 1Q8YA 2JKKA 2XIKA 3EQDA 3NEWA 4I21A 5EOBA 2A0CX 5ICPA 3HX4A 5HORA 1QCFA 2C5YA 2OF4A 4FKJA 4OBQA 5A6NA 4EWHA 3OTVA 1Y8YA 2GMXA 3HKOA 3F7ZA 4XLIA 4OLIA 3ZEPA 4YSMA 3VIDA 2CGWA 4FK6A 2Z7SA 3FQHA 1UA2A 2R3NA 2XK3A 4B0GA 3HGKA 3ZOSA 5L2TA 1L8TA 4KAOA 4RC3A 4RWLA 1W82A 2FGIA 4M14A 2ZDUA 4PMPA 5L8LA 2OWBA 4FKGA 4R6VA 5TR6A 1OKVA 4KNBA 4XX9A 4ZSAA 1LP4A 2HXQA 4X3FC 5IEXA 3JVRA 5DH3A 2R0UA 2PVLA 3F61A 4ID7A 3QUDA 3RZBA 1E1VA 2JKQA 3UP2A 4UB7A 3QD0A 3QTIA 5KMKA 4ZTMA 5FXSA 4AS0A 1XKKA 3HRFA 2QOKA 1ZYSA 4HGTA 3I7BA 4CZTA 3IDCA 4RZWA 5LVLA 3GFWA 4LL0A 3ZYAA 4O0WA 5AUZA 1OL6A 4BZNA 4B9DA 3LIJA 2PE1A 3QKMA 3DT1A 3RK5A 3D5WA 4W4YA 4C3PA 4E6DA 2Z02A 1A9UA 3Q5IA 5E1SA 1Z5MA 5M44A 4MF1A 4YNEA 3C50A 2DUVA 1OPLA 4K33A 3WF9A 2QQ7A 3R6XA 2OO8X 3ULZA 2YDKA 1PMNA 4DA5A 3RPRA 3F66A 3H9OA 2IN6A 5FTGA 2W1FA 1G5SA 4DCEA 2XKDA 3KCFA 2YZAA 5A4EA 3AD5A 4JRVA 3U6IA 4IFGA 3RWQA 4JG8A 2JAMA 3AGLA 3A7GA 2BPMA 4G17A 4ASEA 4B8LA 5FBNC 4F9BA 3RVGA 3ZDUA 4GUBA 3A4OX 5E91A 3LFAA 3EKNA 2YZLA 4DITA 1ZMUA 4OT5A 5LARA 2JITA 1FOTA 2XJ2A 3MJ1A 2W06A 4AUAA 1IASA 4GRBA 2QVSE 3HRCA 5GJFA 4EH5A 2YABA 2I40A 5ITAA 2PZ5A 3K2LA 4BY9E 2GNJA 5CLPA 3DBDA 3DKCA 4OTDA 1JLUE 4XV9A 4HPUE 3PXKA 4MTAA 4QQCA 1Q3WA 2ZOQA 4S33A 5AM7A 5A4QA 2I0HA 2PVRA 4N57A 4GS6A 3KMMA 4DFZE 3LLTA 4LMNA 3DLSA 1W83A 3F2NA 5IMXA 3AC5A 2R3IA 2X7FA 3R1QA 4YJQA 1O6LA 4XBRA 3AC8A 2IVVA 3KRLA 3ZLYA 4GT4A 2BKZA 2ZM1A 4QYHA 5EDPA 3RTPA 5A9UA 4IH8A 4QP4A 4U0IA 4YJVA 1XH9A 4IX4A 1PYXA 4E20A 4F1MA 3VF9A 3Q2JA 2ZM3A 3PA4A 1Q5KA 4KKGA 4BYJA 5IA3A 2OG8A 4V0GA 3PVBA 1OPJA 1YWRA 2WMWA 3I6UA 3HVCA 5HNGA 2OLCA 4FICA 4GG7A 3FAAA 4I93A 4AFEA 3LCDA 4IJPA 3RM6A 1R78A 4EJ7A 1ZOGA 4YNOA 1U59A 1ZLTA 5M56A 5T68A 1H4LA 4XOZA 3Q4CA 5ETIA 5HG9A 4AACA 5DFPA 4YU2A 3LAUA 1H28A 3PG3A 3WYXA 4C61A 2OJFE 3C5IA 5J8IA 1DM2A 4GK3A 4IZ5A 4DHFA 3O96A 2PUNA 4Q9ZA 1BLXA 3ZC6A 4U44A 2R3FA 3LQ5A 2EXCX 4GK4A 2VWWA 2YIQA 4O7LA 3VS5A 1XBCA 4ZMFA 2C6TA 5DA3A 2ITOA 4ANMA 1PXMA 4GL9A 4DGOA 4TKSA 3L9MA 4X2JA 5ETFA 5L8KA 4S30A 2YDJA 4TWOA 2QNJA 2BZIB 3FZTA 5I4NA 3HYHA 1Q99A 2JAVA 1GAGA 2JBOA 4O7VA 1E1XA 4PUZA 4FK3A 4FV9A 4FR4A 3I81A 4EHVA 5KX8A 1WFCA 3ITZA 2C3JA 3FPQA 4C4IA 4EONA 2V22A 5FEQA 5CAUA 1FGKA 3R9OA 5D7AA 3LXNA 4DFXE 3FMJA 1J91A 3CQEA 4L45A 5AP0A 4TWNA 4ASDA 3G9LX 2JIUA 4M67A 2OF2A 4QMPA 3NUXA 4APCA 3H9RA 2VTLA 1XJDA 3IECA 3NNWA 4D4SA 4EH9A 3ORMA 5IUHA 1YDSE 3GXLA 4YPDA 1OITA 5GJGA 1WMKA 3WF7A 3QTQA 4IWOA 5LCKA 4EOPA 2B55A 2YAKA 2R2PA 3FKOA 4G9CA 1Q41A 2VWVA 4C4EA 4C33A 3O7LB 2J9MA 4R7IA 1Q4LA 2C1AA 3EFJA 3EQRA 3VN9A 5AUWA 5ANIA 4BBEA 1U5RA 3HP2A 3ZUVA 2XKFA 3N4UA 4RVLA 2QOQA 3W8QA 2E9UA 3HNGA 3QTXA 3B2WA 2HZIA 2J0LA 2VTQA 2PMOX 4F70A 3FMDA 3OUKA 3NW6A 1TKIA 1JKLA 4PF4A 4J71A 1ZYJA 4F0IA 3BWJA 4L7FA 4G6LA 3QBNA 2O64A 3BQRA 3EN9A 4NL0A 3U4WA 3TCPA 2G15A 2VGOA 4F65A 5LWMA 4FZAB 5AADA 2ZDTA 2X6DA 5ANJA 2BALA 3F5UA 3ALNA 4AW2A 4EH8A 4R1YA 5C01A 5LVMA 1QPEA 1YOJA 4HCVA 3QFVA 4RX9A 3UVRA 4GK2A 3TN8A 2C5XA 3LKMA 5GIPE 2VTSA 3FLQA 2HK5A 4GJ3A 4YPSA 5JEBA 5HQ0A 1A48A 3C0GA 4MXYA 5KE0A 2XEYA 3N9XA 2A19B 4R78A 4F4PA 5ACKA 5EHOA 3COHA 5M4FA 2P0CA 3UGCA 2JDVA 3BPRA 5JGAA 4FTRA 5D1JA 5KMLA 1CKIA 3EN7A 3Q52A 3U8WA 2OICA 5JQ8A 3SG8A 4YP8A 3WOWA 3IW7A 5A54A 3O8UA 4AQCA 2P55A 2R3MA 4CSVA 4TTHB 4U43A 2FSLX 4UXLA 3RPVA 3QWKA 3GQLA 3FUPA 5HVJA 4K1BA 1M2RA 4FEXA 4FNYA 5KBQA 1TQPA 1NVSA 4FEVA 3QWJA 4USDA 1WBNA 3H0YA 3AOXA 5M53A 3SA0A 1EH4A 3R7VA 4TXCA 3C7QA 3P7AA 3ZM9A 1P2AA 2BVAA 3VULA 2CCHA 4IDVA 3H3CA 1XO2B 1AQ1A 1PY5A 2J5FA 4EYMA 5CX9A 3MY0A 4H1JA 2FYSA 4QPAA 4YTCA 4XEYA 5JZJA 2UV2A 3ZO1A 3DTCA 4XCUA 2EUFB 4GH2A 4EH2A 3KULB 5CQWA 5EK7A 3DAKA 4L68A 5AX9A 3Q4ZA 3U9CA 4U7ZA 4IAAA 3R04A 5CI7A 4BDHA 5AA9A 4IM2A 4WNMA 2VWIA 3LMHA 1GY3A 2V7AA 4ACCA 1MQ4A 2P2IA 1K9AA 4WBOA 5CEPA 2GQRA 3A7HA 4O0YA 2OBJA 4CCBA 4U40A 4ACDA 4DH1A 5B2MA 3U51A 4XYFA 1VJYA 2X81A 4Z55A 2WIHA 5BQ0A 3D7TB 4ZOGA 5M4IA 2XYUA 3QTRA 4I6FA 3QTSA 4JR7A 5EKOA 5D7VA 2VAGA 4LOOA 4AZEA 4TW9A 4UXQA 4BCJA 4DGNA 1I09A 4M7IA 4MHAA 2BDFA 3F5XA 5HCZA 2IW6A 3BHYA 3I60A 2X9FA 2GU8A 2QI8A 3GCPA 5JGBA 5K9IA 4GW8A 5IEYA 4QMMA 4D1SA 3R9RA 3G0EA 5BNJA 2XJ0A 4QMYA 4ZSGA 3O50A 3ZEWA 4DE4A 4ZS4A 3QZIA 3IW6A 4FIIA 3VQHA 1J7UA 3FZPA 5IPJA 4IC7A 3H30A 1QL6A 4G2FA 4FTOA 4LGGA 3S00A 2NRUA 2C5VA 4ZZOA 1YXUA 4FV0A 4MCVA 3DPKA 4RVMA 3FJQE 4WZYA 4IWQA 2GTNA 1YXTA 2F7XE 2UW8A 4H3QA 2O8YA 4WKQA 4K11A 4QP1A 5CAPA 4R3RA 1RE8A 4RFYA 2GHLA 3F5PA 3NUYA 3BELA 4MBLA 1FVVA 2GS7A 3FMKA 4YC6A 4BBFA 2WTIA 4KSPA 4BRXA 3FXWA 5FDPA 1H1RA 1UNLA 5ANKA 1YDTE 3R8UA 5HLPA 3QL8A 4N0SA 2ITWA 4IBMA 4UZDA 4FIFA 2J4ZA 5E92A 4TYGA 4FKRA 4F63A 5CNNA 3ROCA 4ACGA 4OR5A 3R73A 4U79A 5KHWA 4QMUA 4JDKA 4CKJA 4EKLA 2ZM4A 3DK3A 3MW1A 4JL9A 3VS0A 2V55A 2UZDA 1WAKA 1SM2A 2H96A 3UG1A 3HAMA 4R1VA 4BTMA 5JGDA 5AX3A 4K2RA 4IWPA 1MRUA 4LI5A 2V62A 1BYGA 3HP5A 5KNJA 4C4FA 2VX1A 1JSVA 1H1QA 3BV2A 5DPVA 4AA0A 4L8MA 3I0OA 5M4UA 1KUTA 4I0TA 3C4WA 5HCYA 4F1OA 1FINA 1WBSA 4RA5A 4HVSA 5HG7A 2OU7A 4JDIA 2F2UA 4NTSA 5ANEA 3T9TA 3OBJA 3MBLA 3VW6A 4QRCA 4I5MA 4IM3A 2XK7A 3COMA 3MH3A 5IEVA 2YIRA 4BIBA 3DGKA 4TPTA 3KC3A 3TZMA 4MYGA 5IQDA 5F95A 5EI6A 1WVWA 3LXLA 3UQGA 5CXHA 3PY3A 4QTAA 3DXPA 4O81A 2EB2A 2ITVA 2J0JA 5IQGA 4TRLA 3DOGA 4YLJA 3LFCA 3D9VA 4C59A 4I5HA 4D2SA 3CJGA 3BU6A 4OBOA 5BUEA 1OM1A 3DAJA 3UBDA 4BCOA 3L9LA 3AMAA 2VO6A 1OVEA 2WAJA 3ZCLA 1UU3A 4UWBA 3W0PA 2RF9A 2CSNA 2WMXA 3JVSA 1FVTA 1Q8ZA 3CS9A 1YWVA 3DAEA 3GC0A 3PPKA 3R30A 4NK9A 4E5WA 3FC1X 4LFIA 3QTWA 4YJSA 3VQUA 3F2AA 5HVKA 3LJ0A 1CKPA 4WSYA 4TYIA 2XMYA 2Z8CA 4GFOA 1T45A 1U54A 5EYMA 4XG8A 2VO0A 3U54A 5E7RA 5HD7A 2UZNA 4FOBA 4E7WA 2PMLX 3FEGA 4ITJA 3ZH8A 3FZRA 4S31A 3GVUA 3ORIA 2CDZA 2ITQA 4PDOA 2WGJA 4XUFA 3UMWA 3ZONA 2OKRA 4KBCA 4AE6A 2XNNA 3FKNA 3FI2A 2IO6A 3L8XA 3WZKA 3GCUA 4F1TA 5TT7A 3SHEA 1WBPA 5I9ZA 2G2HA 3M1SA 2X8IA 1RQQA 3QQKA 4UALA 2XK6A 4LM5A 4E6QA 5IQHA 3GU5A 3ZXTA 1KE8A 2DQ7X 2ETMA 3BLHA 2PUIA 2FSOX 5B2LA 2QODA 1ND4A 3D7ZA 3ORNA 2WZJA 3KB7A 2B9HA 1PXJA 3QZHA 4O7ZA 3UZRA 4BHZA 4DFLA 3M42A 4YGAA 1DS5A 5HHWA 2P2HA 5IA5A 3SXSA 2BZKB 5LVPA 4L00A 3LCKA 3VRZA 4IC8A 3PWYA 1CM8A 1OIYA 4O38A 3FPMA 3REPA 5FUTA 3TNHA 2BTRA 4RX8A 4BCIA 5I0BA 3IPHA 4FV8A 4JDHA 5CT0A 4Y85A 1RW8A 4ZTNA 1KE7A 3LW0A 1J7LA 4I24A 4MAOA 4F9WA 2WNTA 3BU3A 4A9SA 5AUUA 5JFSA 4BDBA 3RPYA 4QYFA 2CLQA 4B4LA 5CSPA 1S9JA 4IANA 1ZOHA 3CSVA 2CGUA 3QYZA 4N6ZA 3KQ7A 2IW8A 3VUKA 3C4XA 3AMBA 3CJFA 4PDPA 4C3FA 4AT5A 4EEVA 2XNBA 4FGRA 1B6CB 3VUHA 4EOKA 4FVRA 5M09A 1W98A 4MD7E 5CY3A 4DG0E 3BCEA 1WZYA 2YCRA 2Z60A 3IDBA 4FKIA 3SXRA 3E62A 3NNXA 4R3CA 3R7YA 3V8SA 4PP9A 4RC2A 4LOQA 3W0RA 4FYNA 4K0YA 5L2SA 1JSTA 4EORA 4USEA 4RWIA 3U55A 4D1XA 4HNFA 4NUSA 4IIRA 3NRMA 4RVTA 4DN5A 5IQFA 5H8EA 3U6JA 4C37A 4PL4A 3E87A 4O27B 2VWUA 4E93A 4EWQA 2UZEA 1B38A 3GU6A 3K3IA 4QNYA 3ZO3A 5AWMA 3TUBA 2P3GX 2QOIA 2VTOA 2VTIA 1G8SA 4X2GA 2CNQA 3IS5A 3OMVA 3OD6X 2J0IA 4FOCA 3FLNC 3RAIA 3DJ6A 5IQCA 4Y46A 3R83A 3IOKA 3NW5A 2QD9A 2XRWA 4J8NA 4PL3A 5AUVA 3FMEA 1ZMVA 4YJUA 1MUOA 1ZARA 4FTJA 1URWA 3CY2A 3LXKA 2HZNA 2P33A 5HG5A 4AAAA 4D0XA 2HOGA 3E64A 1QPDA 3EQHA 3UIUA 4EZ3A 4ZJIA 3C0HA 5EQYA 2W1ZA 4IWDA 1H0WA 3BV3A 3D5VA 2BDWA 3PXFA 4FSTA 2GHGA 3A2CA 4U80A 5AMNA 3KXXA 2RG5A 4LOPA 5M57A 2CN5A 3MN3A 1CKJA 3ODYX 4IX3A 4W8DA 1SMHA 3EMGA 4LV8A 4PDYA 3FSFA 2VTRA 4AX8A 1PKGA 4A9TA 5CAQA 2AUHA 3BX5A 2Y8OA 3P4KA 2IVSA 4DEEA 4CFUA 4V04A 5HBEA 2YJRA 5D10A 4ZAUA 2H9VA 3PYYA 2C5OA 1PF8A 2G2IA 4M12A 4HVDA 1XH5A 2VTAA 3OCBA 4WHZA 3O0GA 4O6LA 5H9BA 3SLSA 4R5YA 1F3MC 2YACA 2WMAA 5CU3A 3W2PA 4XNEA 2XNPA 1BL7A 4TN6A 3Q6UA 4A4XA 2UW0A 2RKUA 4WG3A 3UVQA 3ZBFA 4UBAA 2Y4IC 5JN2A 2PVYA 4L9IA 1ZAOA 4X0MA 4Z7GA 3V5TA 1OGUA 4FSMA 2BRGA 1KOBA 3EFLA 3NWWA 4BTKA 4NFMA 3QC4A 4BCPA 3VBYA 3KK8A 1H08A 4DF3A 1OUKA 3TJDA 3L9PA 4WT6A 3C0IA 3HLLA 4YHJA 4BDFA 4A06A 3Q04A 2C5NA 3MIYA 4FE2A 2VWXA 3GQIA 1GZOA 4J1RA 4F9AA 2W5HA 4OTIA 3SRVB 4PMMA 2ZVAA 3POOA 4QT1A 2UZWE 3NUUA 4RQKA 2OXYA 4L7SA 4OTWA 1FQ1B 2NP8A 3E88A 5HZNA 2BCJA 2C69A 2GTMA 2QOLA 4U6RA 4KBKA 3NUPA 4RX7A 4ZS0A 1R39A 3KF4A 3SV0A 1Y57A 2R0IA 3BYUA 4FTMA 2NPQA 2J2IB 1FGIA 2QU6A 2ZB1A 3CIKA 3ZU7A 3E8CA 3P23A 5FP6A 4P2KA 2X4ZA 1J7IA 1FVRA 4M8TA 3GU8A 4Z16A 4DH3A 4FKSA 2JC6A 4FT9A 4YHTA 3BRBA 3QCYA 4LL5A 4G3GA 1CSNA 2LAVA 2KULA 1CTPE 4NU1A 4TYHB 3MI9A 3FMNA 3I5NA 5DT4A 3M11A 1KV2A 5DRBA 2CKQA 2OSCA 3JY0A 1SNXA 3BZ3A 3GB2A 3E8NA 4H1MA 3TXOA 4ZSJA 3DQWA 3QX4A 2ZAZA 4DBNA 4Y95A 2C68A 3COIA 2WHBA 4I92A 5FP5A 3LOKA 4P7EA 1H00A 1OB3A 2WQEA 4X6QC 3W10A 3C4CA 4O7TA 3TACA 5CNOA 1MRVA 4GU9A 2IPXA 3NDMA 4JBVA 1T46A 2Z7QA 1PXPA 5B0XA 4RGJA 4L3PA 5HX6A 3ZXZA 3SOCA 2HELA 2XZSA 3BI6A 3EN4A 4KWPA 3BHTA 4CZUA 1R0EA 4HW7A 3BLRA 1YXXA 1APME 3R2YA 2XNMA 1KSWA 2Y7JA 3QUEA 2R5TA 3UC4A 2VZ6A 4EH3A 4I20A 1MP8A 1XHAA 4AU8A 3FHRA 1G8AA 3OCGA 3TUDA 2XCHA 5CU6A 3PJ3A 3OFMA 4YHFA 2ERZE 2UZUE 3W18A 3ZRMA 3EQBA 5BUIA 4WBBB 3W2QA 3CE3A 1M2QA 3DBFA 3HV6A 3QF9A 4MNEB 4BN1A 3COKA 2XIYA 1UKIA 5E9EA 3WI6A 4ZZNA 4E26A 3BE2A 3KL8A 4ALWA 1R3CA 4XG3A 4O2ZA 3VUDA 3QD4A 1P4FA 4FBXA 1IAHA 4FSNA 5BVNA 4FZFB 5D12A 4DFNA 4ZTSA 3L9NA 3D14A 3H4JA 4UYNA 3V3VA 4A9UA 1YDRE 3B8RA 2C6LA 4I6HA 4C2VA 3ZO2A 5BYYA 4I3ZA 5ANDA 3LXPA 3KRXA 4HGSA 2WQNA 1K2PA 2WMUA 4TYHA 4XP2A 5C4LA 3BEAA 4YTFA 4DEBA 3R8ZA 3W2SA 3MFRA 4IHPA 5CS6A 3UYTA 3ZFYA 4XMOA 3OS3A 2X2MA 4F7SA 4APPA 4O7PA 3UO4A 4HCUA 4AW5A 5BVOA 2ZB0A 3FSKA 3QAME 3KULA 4G3CA 3PIXA 4UV0A 4FG8A 4QTEA 3MYGA 4BGQA 3DDQA 3NGAA 3F5GA 3LPBA 3I79A 2GNLA 5CTPA 2OK1A 4RJ4A 4X3FB 1Q24A 4XJ0A 5EW9A 3TZ8A 3ROYA 4AZSA 2OJ9A 2YISA 1DAWA 2A1AB 1Z9XA 4H05A 5IA2A 2R4BA 4X3FA 2PWLA 3NNUA 3F2RA 4AN3A 3W33A 3ELJA 3CQWA 4CKIA 2B9IA 3OEZA 1HCLA 4GT3A 3S0OA 2BRMA 3T3UA 4EHZA 4NFNA 1HOWA 4BYIA 5HE0A 5A4CA 2VRXA 1K3AA 3R63A 4NJ3A 4EOSA 3E92A 3P5KA 2EWAA 2UW9A 4BCMA 4KIQA 4U97A 5HG8A 3A7FA 3CKXA 3FMHA 3P86A 4V01A 3PSDA 1V0BA 2J0MB 2C0IA 4TYJA 2KTYA 4IVBA 1H27A 3Q6WA 1U4DA 3IW8A 2WMVA 1ZZLA 2O5KA 1TVOA 4WNPA 3PJ1A 3Q60A 5L3AA 4XRJA 3G9NA 3MA3A 4WNKA 2LGCA 3TKUA 2EXMA 4FEWA 4CXAA 3TDWA 3HL7A 4BGHA 4ZJVA 3AQVA 5HU3A 3UODA 2PU8A 4Y5QA 4EK5A 3I5ZA 5AP3A 2YITA 3FC2A 1YW2A 3GC8A 4OTGA 2W9FB 1XR1A 3CC6A 2W05A 1BKXA 2XRUA 4P5QA 4AGWA 2BIYA 4DH8A 5KUPA 2C3LA 3LM5A 4JI9A 4M84A 4B8MA 5LMBA 2QOOA 1ATPE 2QURA 3DJ7A 2UZBA 4AZVA 3ZSGA 3KXZA 2W99B 4ZTRA 5M07A 2XBAA 2XKCA 3GCSA 4D1ZA 2FA2A 4XV2A 3OBGA 4QP6A 1NT2A 3PJCA 5KCVA 5IH6A 4QMNA 2FH9A 5CQUA 5EHLA 5KZIA 3O51A 5C27A 3UIBA 5DYJA 5K4JA 5I9YA 3G2FA 2DS1A 3R7UA 3VS4A 5DN3A 3R8LA 2XB7A 3CR0A 2RIOA 4FL3A 2C0OA 3I0QA 1OI9A 2O0UA 5F20A 3RMFA 5AP7A 3OWKA 1NVRA 4J7BA 5AV3A 4EK4A 3P79A 3EB0A 4LG4A 2C3IB 3LJ2A 2QKRA 3ORZA 1H8FA 4B6LA 4KUJA 1A06A 4UWYA 3TEIA 4BDGA 4IB5A 4G3EA 2HW6A 1KE9A 5DT3A 2BROA 3PVGA 2OIQA 3QQLA 4C4JA 5F9EA 1VYWA 3FE3A 2WO6A 3V01A 2Z7RA 3TWJA
chains in the Genus database with same CATH superfamily
1YI6A 2Q0BA 5CSWA 4X6RA 2W17A 4Q2AA 2XALA 3PPZA 4RLKA 3BBTB 4XV3A 2VNWA 3CY3A 3R9DA 3PY0A 4BJJB 3AC3A 3GGFA 2X8EA 4X7QA 5FBOA 1XH7A 4DTKA 2PL0A 4ASXA 3CQUA 4BC6A 1UU8A 3OY3A 5TOZA 3LCOA 3JXWA 5EM5A 2VGPA 5HEZA 3DTWA 4FG9A 3HECA 4QYEA 3NYXA 2ZV9A 4AA5A 5CZHA 3CPBA 4OUCA 2IZSA 5L8JA 2HW7A 4QQ5A 3TL8A 3AXWA 2I0YA 4QPSA 2PSQA 2OH0E 2RFDA 5J5SA 3O2MA 4LRMA 2HY0A 3AMYA 3PIYA 4NZWB 1WBTA 3R1NA 2B52A 5D9HA 3RP9A 3JUHA 2PUUA 4I0RA 5FM3A 5HNIX 4CEGA 3ALOA 4F9YA 4L6QA 4JIAA 3A99A 2VWYA 3VS2A 3W0SA 1S9IA 2IWIA 1PXOA 3BGPA 4FNXA 2JDSA 2VD5A 4GJ2A 4IM0A 4AW0A 1WVYA 3ATTA 1XQZA 3KREA 4MQ2A 2ITUA 4HJOA 3EL8A 4XS2A 3BIZA 2X2LA 5IMEA 3V5QA 4E5AX 4YUQA 2UZLA 3OP5A 4LYNA 3FI3A 4CRLA 3EQCA 4GVAA 1OKZA 2R3JA 3ZRLA 5M06A 1LUFA 3OY1A 3LLAA 4JAJA 5AUXA 5EKNA 3Q5ZA 2XK9A 4JG6A 4DEHA 3UQFA 3NYNA 4G5JA 3H0ZA 4FTQA 2IZUA 2BKKA 5M4CA 1M2PA 1URCA 3Q32A 3EQFA 1VYZA 4GEOA 5CAOA 2JKOA 4ZSLA 3UZTA 3MTFA 3E93A 4R77A 5EI2A 4IX5A 4TZRA 5CENA 4CGAA 3OT3A 5BX0A 4LDTA 3TIZA 2HXLA 4FKQA 5JSMA 2WTWA 3CBLA 2YIYA 3QZGA 2WTCA 2PVJA 4M13A 3VJNA 5GINE 3R9NA 3G6GA 4KA3A 3TKIA 2CJMA 1UWJA 2UZOA 3DDPA 2VO7A 2XNEA 2VTTA 2BAJA 3KMWA 4KINA 3NVKI 3DB8A 4HPTE 4O84A 4D58A 3PIZA 3ZRKA 2PVNA 3V5JA 1Y6BA 2F57A 4FZDB 4FZ6A 5AEPA 4PTGA 1ZY4A 3PA3A 1XBAA 5AP6A 2W4JA 4EK6A 3WZUA 2QO9A 5HI2A 2O65A 3IW4A 4BCHA 2V5QA 4F7NA 3QQGA 4CRSA 4ZMEA 1O9UA 4FSYA 5DNRA 3P5JC 5JK3A 3AKLA 3FLYA 2UVXA 4M69B 3QD3A 1VEBA 2WTVA 4PWNA 4UZHA 3FZ1A 4W4WA 5CU4A 3QCXA 4F99A 4DEAA 3JY9A 3U87A 5CVHA 3UE4A 1JPAA 4F7LA 4I4FA 3B2TA 2XIRA 3LQ8A 4OT6A 1IAJA 2PY3A 4FSRA 3VHKA 3MWUA 3Q9ZA 3SC1A 4FV6A 4GU6A 4WO5A 4EBWA 2WU6A 4Y83A 3LMGA 3NSZA 2VNYA 4EUTA 3FZSA 4MXAA 2IJMA 2J7TA 4O82A 2EB3A 5AA8A 1M14A 5CSXA 4HVGA 3NLBA 5H2UA 3W2CA 2A4LA 4RRVA 4HVIA 2XM8A 1PXNA 3TYKA 2R3QA 4W8EA 3AD6A 5HGIA 5DHJA 2W1EA 1PMEA 4AZFA 4UEUA 3HDMA 3OEFX 4AOTA 3PRFA 1OIQA 3UOLA 4KBAA 2CMWA 2J51A 5GHVA 3EKKA 5E4HA 2IW9A 3UO5A 2QLQA 5GNKA 5A14A 3EHAA 4D5KA 4FSUA 3CTQA 4DG2E 5DIAA 3R9HA 3QQFA 2UVZA 4GIHA 3UJGA 4Y73A 3AKJA 3II5A 2H6DA 3PTGA 3V8TA 1SVEA 1ZYCA 3NIEA 4EBVA 1ZWSA 3PY1A 3CXWA 1W7HA 4QMQA 3F6XA 1H1WA 3EN5A 3PXRA 4JRNA 2XVDA 4MX9A 4EHGA 5KHXA 3VONA 1LR4A 1V0OA 2DWBA 3NMUF 4BDJA 1ZOEA 1W0XC 1H07A 2I0VA 3PVUA 5KO1A 3UDTA 4FYOA 2XEZA 3IGGA 2NRYA 5ACBC 4QTCA 4F78A 5LCJA 1LEWA 1ZMWA 2C6OA 4FUXA 3MIAA 2ZFYA 2E9OA 2WTKC 3DXNA 4FGBA 3U9NA 3QQHA 2BAQA 2NYAA 3R7OA 4O6EA 1LPUA 2J5EA 4FTAA 2G1TA 4FUYA 5A4TA 2BRHA 1IA8A 1BUHA 3MY5A 2GDOA 2YWPA 1ERKA 2B0QA 3K54A 3MFTA 3RK7A 3GP0A 3S95A 5G1XA 4C34A 4IAZA 1JNKA 3RNIA 4DEGA 4M0ZA 4CKRA 3GU4A 1DI9A 5FTOA 1ST0A 4B7TA 1W84A 5CF6A 3EIDA 4MXZA 3U4UA 3UMXA 4C3RA 4QP8A 2QHMA 3ZBXA 4XHKB 4A4OA 2PE0A 5EI8A 4ASZA 2C6KA 2X0GA 4AXEA 4FT7A 3ANQA 2PMIA 2CHLA 4BCKA 3SW4A 4ENXA 5HTCA 5FXQA 3S1HA 2G01A 3MB6A 5DOSA 5KKRC 1GIHA 2R3LA 4TL0A 5IUIA 5BVWA 3ZSIA 3VBQA 3P0MA 3LHJA 1ZZ2A 3GOPA 1GIJA 2PULA 3NYOA 4JT3A 4EH6A 1FPUA 3BGZA 3FL5A 4IVDA 4PL5A 4RSSA 3FY0A 3PXYA 4YC8A 3HV3A 1VZOA 3DNDA 4PQNA 3M2WA 3VRYA 4IAFA 4KABA 3IQ7A 3A4PA 3DV3A 5A3XA 4BCQA 3OXIA 1L3RE 2R64A 3VO3A 3FLSA 3SDJA 5FQDC 3Q53A 3WZJA 4RJ3A 4FIEA 3G33A 3IGOA 3MY1A 5D11A 1YQJA 3PJ8A 3E5AA 5EDRA 4ENYA 4FKTA 4I1ZA 2EU9A 3LFBA 1BI8A 3AC4A 3FHIA 4GKHA 4AW1A 4L43A 4AN2A 2BRNA 1OKYA 3JS2A 4YJPA 4X3JA 3RKBA 4D55A 1J1CA 1OUYA 2JIVA 3BQCA 3VNTA 4JNWA 4CLJA 4DHIB 1F5QA 5IF1A 3SVVA 2BRBA 3CCNA 3FLZA 5JFXA 3KK9A 4AT3A 2PYWA 3JR1A 4HYSA 4J98A 4BHNA 4EYJA 3LFEA 5CU0A 3RHKA 3RJCA 4YLKA 4XG7A 1X8BA 5DVRA 1H26A 3A8WA 2BUJA 1MQBA 4G3FA 4R7HA 3DFCB 2CPKE 4JS8A 5IQBA 2WFYA 1QPJA 2YFXA 4FTTA 3RI1A 3R8VA 4ERWA 4HYUA 4XRLA 3CEKA 3W55A 3GI3A 1YVJA 4FEQA 2YIWA 3LFNA 4JX7A 3TDVA 2OH4A 3R00A 4E4MA 4YO4A 1GOLA 3NPCA 2SRCA 5KMMA 4JX3A 2OIDA 1PMUA 4IAKA 4ACMA 5BPYA 5DG5A 2CKOA 5HO8A 3NCGA 4J53A 4MVFA 5CAVA 2QO2A 4LGHA 4IB3A 4G6NA 2FB8A 1KOAA 3EL7A 3NZ0A 2UW7A 3NFGB 2BAKA 4UN0C 3UO6A 4QTBA 4FTKA 2WMTA 5EM8A 3W0NA 3QYWA 2WPAA 4U8ZA 5BMMA 4NCTC 3ZZEA 4IADA 3OZ6A 3UIXA 4BZDA 3SGCA 4IVCA 4AXFA 2XIXA 4NM0A 3U6HA 5J7HA 3QCQA 4O0SA 3T3VA 2XH5A 4D4VA 3RALA 2AEGA 3MGYA 3DU8A 3KVWA 4BBMA 4MNFA 3UC3A 4DH5A 5J9YA 2OJGA 3CKWA 4E6AA 5LWNA 4NJDA 3TNWA 3PLSA 4DDIA 2ERKA 1Q8UA 3DBQA 4O21A 4FIHA 3RAWA 1OL2A 4LV5A 1OKWA 5F94A 2WB8A 3LMIA 4IB0A 5JMSA 3ZFXA 3BEGA 3DY7A 1UVRA 3KXNA 3RAHA 4F6UA 5CANA 4ZLOA 3UVPA 2YCFA 5H8BA 5CEQA 5CT7A 3BHUA 3RPSA 3DXQA 2XCKA 5EQEA 3ZTXA 3UPZA 5G6VA 2NNWB 3AT4A 5HKMA 3BL9A 3ORKA 3DBCA 1OBGA 4WD5A 2IZTA 3NS9A 4XG4A 5E8ZA 5JFWA 2PPQA 2CNUA 3QXPA 4RX5A 3I4BA 3BBWA 5JFVA 3IOPA 3MV5A 4I6BA 1UKHA 4EH7A 4KKHA 3ZC5A 2X1NA 1IG1A 2VWZA 3FLWA 4G5PA 4ALUA 5CXZA 2W4KA 3KMUA 2JBPA 4GSBA 4AWIA 4EJNA 4CG9A 3W2OA 3KKVA 5HNBA 3RCJA 4AXCA 4YZCA 3HA6A 4IFCA 4PDSA 5CVFA 3HMOA 2WEIA 2Y4PA 2B7AA 5FEEA 2V0DA 3FZOA 4PV0A 4S2ZA 5I9UA 3TTIA 5IDPA 4W4VA 5DBXA 1ZYDA 5HIBA 1M7QA 5HE2A 2W4OA 4CFMA 4RQVA 4UYAA 4CFNA 4FMQA 5I9VA 5IQEA 4JLCA 4DFUA 2PZIA 5ETCA 1JKSA 4DDGA 2O2UA 4C0TA 3P7CA 4RT7A 3D83A 3TZ9A 4ANLA 2WQOA 2G9XA 5BUJA 3P08A 2J0KA 4KRCA 2GQSA 4RIWA 5ANOA 5A6OA 1B39A 3FMLA 2BHEA 4HYHA 3V5PA 3PRIA 4O7SA 1ZYLA 4CFXA 3OXTA 4G3DA 3ACJA 1OL7A 3WIKA 4MNEA 2ITNA 3PJ2A 4L3JA 4EL9A 5M51A 2PZYA 3E7OA 2OI4X 3JYAA 1YXVA 2ITTA 2ZV2A 4XOYA 4AF3A 2W1DA 3QU0A 3OVVA 3DCVA 4ERKA 4TT7A 4MXXA 4DG3E 4U3ZA 4EOJA 1I44A 5DT0A 4FTLA 4ZTQA 3IG7A 4QMZA 3BYSA 1P14A 3GNIB 5EW3A 4QMOA 2HZ4A 3GC7A 2YCQA 3O8TA 1GZ8A 2QOBA 5AV1A 2WOTA 4HGLA 4WUNA 3KRRA 4E4XA 1YKRA 4D4RA 5IU2A 2QOFA 4PTEA 3ORXA 1GZKA 4ANQA 4CLIA 4I94A 5ANGA 4FIJA 4XG2A 4ZIMA 5C8MA 3P7BA 4HYIA 3BLQA 3PSBA 4GT5A 5BYZA 4ZXTA 3VBWA 3K5VA 4CFWA 1P4OA 3W8LA 3RNYA 4O2PA 2PUPA 5AUYA 3MESA 4MD8E 1YHVA 4E8AA 3BYVA 2XA4A 2VWBA 1LEZA 4KIOA 4AZTA 3LZBA 4IZAA 5C8KA 4FTNA 2JFMA 3DZQA 3NW7A 4WRGA 3QHRA 4WG4A 4E4NA 3ODZX 3QQJA 4AGDA 2W9ZB 3MFUA 3MVMA 2UW6A 4M68A 4WA9A 4Q9SA 1H1PA 4D0WA 4FT3A 4MBJA 4USFA 4RFZA 4Z9LA 3UPXA 2E9PA 3WYYA 4QEBA 4I6LA 3OWLA 2JKMA 1YI3A 4F64A 4L42A 4Z7HA 2WMRA 3VW8A 4EOOA 5E8VA 2XNOA 4GYIA 2XKEA 5HD4A 2ETRA 2XP2A 3UZPA 3FYKX 4ITHA 4K18A 4O0UA 3VC4A 5CEOA 2CN8A 4DTAA 4LRKA 5IZFA 4RJ8A 4O0RA 2W96B 3QTZA 4IE9A 4IW0A 5E1EA 4X21A 2CNVA 5H3QA 2QO7A 3VBVA 4LUEA 1FMKA 3TT0A 5JRSA 3QCSA 2GNFA 4NYEA 2V7OA 4RMZA 4E73A 4P5ZA 4RBLA 5EM6A 3T9IA 2JD5A 4UY9A 3Q4UA 1JKTA 3THBA 2GCDA 4L3LA 3V6SA 3UQCA 3ZHPC 3Q96A 5LMKC 4R7BA 3VS3A 1UNGA 3UIMA 3ET7A 4TY1A 4EHEA 4ZY4A 3F7WA 3UYSA 3HEGA 3TV6A 3WIGA 3V04A 3WE4A 4EZ7A 3H9FA 4IZ7A 1OMWA 3VVHA 4ARKA 4EH4A 2OJJA 4I4EA 4WUAA 2C6MA 2PK9A 3O17A 2WQMA 4FTUA 5CI6A 4AOJA 4U81A 3P78A 3VS1A 3ZLXA 4CQEA 2WU7A 4C62A 4EI4A 3W2RA 4RLLA 3F88A 3KXMA 5IQIA 1WVXA 3AC2A 3LCSA 3DK6A 3VBTA 5EW8A 2RFSA 2QCSA 4L01A 4U5JA 3KRWA 4ZSEA 4D28A 4IDTA 2PVKA 5EYCA 2IVUA 3UDBA 4JQ7A 1YI4A 4NTTA 4EC8A 2BR1A 4C36A 3O23A 4XV1A 2EVAA 1KV1A 3AC1A 5CF5A 1OIRA 4TNDA 5AAEA 5B2KA 5CF8A 3WZDA 4DFYA 2UZVA 4G34A 5LMKA 3EN6A 4U3YA 3OF0A 1PMVA 1YOMA 4JG7A 4QO9A 2PZRA 2ZJWA 3GC9A 5C1QB 3TNPC 2ITXA 1PXLA 4PMTA 4IAYA 3TTJA 4DLJA 3OC1A 3R0TA 4JBPA 2VX0A 3SAYA 3WF5A 3QA8A 4IX6A 5CWZA 4X2FA 4QTDA 5CASA 3OT8A 4NIFB 5AAGA 5ETAA 4H39A 5HTBA 4D9TA 2VTNA 2UW4A 3KU2A 4ANSA 4ORKA 3OUNB 4MK0A 4UX9A 2P4IA 3RM7A 4DGMA 1ZXEA 4QMLA 3OWPA 2R9SA 5M55A 1OL1A 2R3HA 4H3PA 2JEDA 4S34A 3W1FA 4CTBA 2HENA 4EUUA 4YZBA 3LFSA 3R2BA 5A4LA 4OW8A 5AV0A 4GVJA 5KMJA 2WIPA 5L6OA 4PY1A 2WEVA 3NUAA 4S32A 2XUUA 3Q9YA 5C03A 3QKKA 1CDKA 5CYIA 2BZHB 4C2WA 2YA9A 3MFSA 4JQ8A 5HVYA 3SOAA 4F9CA 1TQMA 3RWPA 1YHSA 3QHWA 4CFVA 4DEIA 1RJBA 4N6YA 3UOHA 4E4LA 3PE1A 4TWCA 1OZ1A 3FY2A 3KF7A 2PVMA 4QYYA 4NKSA 4Y8DA 4YBJA 3VUGA 2J50A 3WILA 5HIEA 3EWHA 5AV4A 3SD0A 1IRKA 2WMSA 5LVNA 3QRIA 3LVPA 3D94A 4IQ6A 4PNKA 3PZEA 3ENMA 4IACA 2BHHA 3CD3A 4FKOA 3SXFA 2Z7LA 3RCDA 2YM6A 4FI1A 2B4SB 3R71A 3NUSA 2PVHA 4U94A 2HY81 3O8PA 2GS2A 4HNIA 4L67A 3F82A 3GFEA 3MDYA 4CNHA 3G5DA 2UZTA 5IISA 4RZVA 4WRSA 3K5UA 1G3NA 3W32A 4BI2A 3KN6A 3PLAE 2ZYBA 3SW7A 5CU2A 5EM7A 4M3QA 4BTJA 2WMQA 3RHXA 2WTKB 3KCKA 3GOKA 2VN9A 3NCZA 4BB4A 2OJIA 2VTHA 4RJ7A 4XLVA 4QNAA 4FTIA 3UG2A 4E6CA 3EYHA 4IMYA 4QMWA 4ZLZA 3ZS5A 2RGPA 2QOCA 4BDEA 4JDJA 4YMJA 3ENHA 2I6LA 2YEXA 3OXZA 2BTSA 2CKEA 3C4ZA 3OCSA 2QR8A 2UW5A 1UU9A 3DQXA 4FNWA 3QTUA 1YHWA 4YJRA 2R3GA 4ZY6A 4WG5A 4KS8A 5LQFA 4G6OA 2X39A 4QP7A 4BVUA 4FL2A 4YJTA 5J1VA 3HZTA 5AAFA 3MJ2A 3R7IA 2Z2WA 1OECA 3BHHA 3TUCA 4Y72A 3LQ3A 3MPAA 3BYOA 3MVLA 4RIWB 5HU9A 4NSTA 2C6EA 2QU5A 3WF6A 3V6RA 4K77A 2E9NA 1Q3DA 2HAKA 3KGAA 4JBOA 5HLWA 2B54A 4XP0A 5KMOA 5BVFA 5KKRB 3D0EA 4K8AA 2QKWB 4GG5A 5DE2A 4EQCA 2YM8A 3A7IA 3VS7A 4YR8A 3F3VA 4QOXA 3DS6A 2XBJA 5CALA 3F69A 1ZRZA 2QHNA 3QC9A 2BIKB 4MWHA 3A60A 3VWAA 5BVKA 3TG1A 4NM7A 3TKHA 2FO0A 5DEWA 1REKA 3MPTA 4EZ5A 2GPHA 4D4YA 1XH6A 4AFJA 4EOMA 2B53A 4J96A 2OZAB 1SVHA 4I6QA 3FBVA 4FV5A 2C6DA 4RIXA 2VU3A 4DAWA 3KXHA 4FV2A 1JAMA 2RG6A 4II5A 4IZYA 3TZ7A 2OZAA 3V5WA 2C47A 4YZNA 1PJKA 1U54B 4CTCA 2X2KA 3GENA 3I1AA 3UOJA 2QG5A 4FV1A 4OBPA 1UU7A 1SVGA 3HA8A 3RINA 4G16A 4AG8A 1Q97A 3QQUA 4KSQA 3ZSHA 2X9EA 3E7VA 4FJVA 4RFMA 2DYLA 3BGQA 3ANRA 3MS9A 1Q8TA 3HMNA 4O96A 4CMOA 4BCNA 3P1AA 4FKPA 2ITZA 4X2KA 3IK3A 5K5NA 2Y6OA 3DZOA 2ZV8A 1NXKA 5EQPA 4EOLA 4AA4A 3HAVA 4GCJA 5AV2A 2AYPA 4MD9E 4D5HA 3HMMA 2WKMA 3HUBA 3NAYA 3NX8A 2PMNX 5E8UA 4O91A 5BV3A 3H10A 1FBNA 4B99A 1PW2A 3HV5A 4M15A 2XIZA 4OTQA 4DH7A 2ETKA 3BYMA 1GJOA 3NFFB 4RIYA 4DINA 4I0SA 1Z57A 2VO3A 5CSVA 1M52A 5EG3A 3ORTA 1XMLA 4O0TA 2OW3A 5KZ0A 2YM7A 4J95A 4R5SA 3MPMA 4XH6A 4Z3VA 5HLNA 2JDTA 2C6IA 2C1BA 5T6KA 3UP7A 1OBDA 2R3PA 1TQIA 1H01A 2JDRA 3S3IA 4ZK5A 1O6KA 3LFQA 5IG1A 3MH1A 4NWMA 4C02A 3WE8A 4FODA 3MH0A 2R7BA 3N4TA 4FSWA 5K4IA 1TFFA 2WXVA 3EOCA 2UVYA 1KWPA 2YN8A 4YSJA 4AXAA 5J9LA 4ZEGA 4OTHA 3HRBA 1PYEA 4FKUA 4N70A 3BWFA 4CMUA 1ST4A 1QMZA 2I1MA 3KFAA 2PZPA 2QR7A 5JQ5A 2CCIA 4A07A 4DCAA 5IH5A 1SNUA 3P9JA 3ZM4A 4O0VA 3MA6A 5TKDA 2WMBA 2Y6MA 5C9CA 2FVDA 3FXZA 5I9XA 3V5LA 3F3WA 2YM4A 2VX3A 3FMMA 4EC9A 3HMPA 3FDNA 3D5XA 2C30A 3KVXA 4KB8A 3TNQB 4F6WA 1PXIA 2X7OA 3A8XA 4FTCA 4O0XA 4BCFA 3G15A 4KS7A 2PTKA 3G6HA 3WARA 1JBPE 3OG7A 3IW5A 2CKPA 4YZDA 4ANBA 5IDNA 5CF4A 4HZSA 4E1ZA 5HBJA 1YRPA 3EYGA 3TV4A 4H3BA 2CGXA 4PX6A 5K3YA 4MQ1A 4C4HA 4FVPA 3EZVA 3WF8A 3QD2B 3SRVA 3IO7A 3R22A 3L1SA 5IUGA 2FSMX 1KE5A 3Q4TA 3D7TA 2RFNA 3L8PA 3LJ1A 1JKKA 3CPCA 1U46A 3IDPA 4DFBA 4ONAA 3HDNA 4NCTA 3F3TA 4RJ6A 3R8MA 4U45A 3KY2A 4ITIA 4CD0A 5BMSA 5DR9A 5DRDA 2O3PA 2BDJA 2IZRA 4EK3A 4A7CA 3NUNA 2GSFA 2HYYA 3W0MA 4BR3A 4FX3A 2XK4A 3FL4A 1BMKA 3R1YA 4JVGA 4KRDA 4U9AA 4ZJJA 3DK7A 5TO8A 3LFFA 4D9UA 2ACXA 2YHVA 4Q5EA 4DT8A 5A46A 4FG7A 2HZ0A 4O83A 3QX2A 4K6ZA 3D5UA 2PE2A 4ZY5A 4CCUA 3VBXA 4KKEA 3PVWA 3AKKA 2BMCA 3T8OA 2H8HA 3ORPA 3MVHA 2Q83A 5IH4A 5FLFA 4L53A 5CZIA 3NIZA 3BU5A 4BI0A 4EK8A 5I9WA 3ACKA 3HV4A 2Q0NA 3WBLA 2ITYA 4DGLC 2VUWA 5LVOA 2PVFA 3QKLA 1GNGA 2W1IA 3PDTA 3PWDA 4ALVA 4C35A 3GBZA 1J1BA 1BL6A 4FVQA 2WTDA 3RK9A 2ZMDA 2NO3A 3V51A 1OIUA 3GEQA 3GT8A 1H24A 3PG1A 2ZV7A 3DJ5A 2XANA 2QONA 4JOAA 1XH4A 2E2BA 2HWOA 4LRJA 3A7JA 4GKIA 3SX9A 3TNIA 3W0OA 5C26A 3HUCA 4FSZA 3DB6A 2XYNA 3OOGA 3NR9A 4IB1A 5AP5A 4KD1A 1Q61A 5FRIA 2X8DA 2XK8A 5DGZA 3VS6A 2UW3A 5I5ZA 2C4GA 3AGMA 3QZFA 4BZOA 2GFSA 4RWJA 4V0GB 1M17A 2WTJA 3QRKA 5DWRA 5LMAA 3UNJA 5AIKA 2QOHA 4WNOA 4JJRA 3W16A 5J95A 4GIIA 4XG6A 3EH9A 4RJ5A 5GIOE 1JOWB 4F0FA 3G0FA 5EYKA 3ZZWA 3W0QA 1Q62A 4ACHA 4YTIA 4MXCA 3CTHA 1FMOE 3FV8A 1F0QA 5CEMA 3ETAA 3DBEA 3ID6C 1WCCA 3AD4A 4RA4A 5DEYA 5DLSA 4QQTA 5C8NA 3EZRA 2R3OA 4ZP5A 3FQSA 2GS6A 2OXDA 3EFWA 4JIKA 5HESA 3FWQA 4YZ9A 3VJOA 4EOQA 4NW6A 4PNIA 3BHVA 4U41A 1XWSA 3PUFC 3QLFA 4EKKA 5L2IA 1WBVA 1JSUA 2GQGA 3LE6A 4FKVA 2XM9A 4QP2A 4AGUA 2ITPA 4O7YA 4YJNA 5FG8A 1BX6A 5HBHA 3OCTA 1ZY5A 3DKFA 4L52A 4LQMA 3R02A 5J9ZA 5DR6A 3QLGA 2F49A 2YM3A 2GFCA 2BFYA 4FL1A 3CP9A 5CVGA 4JR3A 2ZMCA 5C4KA 3V8WA 4ZZMA 1HCKA 2ONLA 4BDCA 3VUMA 2CLXA 4FV3A 3CGFA 4J97A 2XF0A 5FTQA 5LXMA 4OTRA 3EFKA 2JLDA 2W1GA 5AIRA 5FM2A 4C58A 2IG7A 1KE6A 3KEXA 4QMSA 1AD5A 3D2KA 2GHMA 5F4NA 5EYDA 4MXOA 5LOHA 3TMOA 4I5CA 2YJSA 1MRYA 2B1PA 2C0TA 3C4FA 4O7RA 3S2PA 2OIBA 3ORLA 3E8EA 1PHKA 2YWVA 1NY3A 3FI8A 5E8XA 5F1ZA 4NH1A 2X4FA 2FSTX 4AZWA 1Y6AA 2OGVA 2WD1A 5LJJA 3PSCA 3GUBA 2GNIA 4WOVA 4RG0A 3S4QA 2YDIA 5E8YA 5BYLA 2XS0A 3PA5A 1UWHA 5JKGA 4MBIA 1DI8A 1V1KA 5JRQA 1JQHA 3CD8A 1V0PA 4TWPA 4BDAA 4DEDA 2QG7A 5E8TA 4P4CA 1W8CA 5HE1A 3HV7A 3FKLA 3A61A 4RC4A 4IVAA 3UNZA 3R01A 4MKCA 2QC6A 3GCVA 3QGWA 4HOKA 2VTPA 4AGCA 2W7XA 2YCSA 3DNEA 2AC5A 4EOIA 2R7IA 5IA4A 1YWNA 3PE2A 1H25A 3KIOC 3D15A 2X6EA 4OGRA 2F7EE 3LM0A 4HGEA 5FEDA 2F4JA 3FYJX 2F2CB 3FXXA 5L6WL 4E5BA 3GCQA 4IJ9A 4FNZA 4YO6A 5EFQA 1JWHA 4NM3A 4CV8A 3KN5A 2YERA 1XH8A 2F9GA 4OTFA 2I7QA 3ZLSA 1H1SA 4FZ7A 4FA2A 4DYMA 4Q5HA 1STCE 4TYEA 2RFEA 4YURA 3ZUUA 2OFUA 1QPCA 3MTLA 4X2NA 3ZMMA 4AN9A 3MH2A 3UOKA 1O6YA 3F3UA 4YC3A 5JT2A 4U42A 4RVKA 3QUPA 4AXDA 1AGWA 1H0VA 2ONLC 4F08A 2W5BA 3CGOA 4FIGA 4NT4A 3QRTA 4LMUA 4EQMA 4RIYB 3SG9A 3ZFMA 4EQUA 1WBWA 3BE9A 1GZNA 4FT0A 5E90A 3FQEA 4PTCA 4JMQA 2E9VA 4NM5A 4AP7A 1VR2A 1OL5A 3ZUTA 5AP2A 1RDQE 2YAAA 4HCTA 2B9FA 3LCTA 5IQAA 4DLIA 4F7JA 2GNGA 4H58A 4WIHA 5HCXA 3CTJA 4I23A 4A9YA 3JPVA 2BZJA 1VLRA 4BDDA 2C3KA 4BF2A 5HX8A 4BIDA 4IEBA 5FXRA 3NVMB 3G90X 4FV7A 3C1XA 5BVDA 1PXKA 3ULIA 3ZDIA 2JFLA 4KIPA 5HE3A 3R1SA 3C13A 3TI1A 5AP4A 3D4QA 3DA6A 5L2WA 2YM5A 2OZOA 3EQPA 3KRJA 5JZNA 4UWCA 1WBOA 1IA9A 2YIXA 3OOMA 5H8GA 4CFFA 2O63A 3KXGA 5KMIA 5BVEA 3PXQA 4XG9A 3RAKA 4YZMA 1DAYA 3AT2A 4RIXB 2XNGA 5J87A 4GMYA 1IR3A 3PP0A 1YXSA 4PMSA 3I7CA 3BKBA 2WQBA 3G51A 4QYGA 4BDIA 3QRUA 3PP1A 4ZTLA 3DLZA 1U5QA 2Y4IB 3EQIA 5AP1A 1XBBA 3C4EA 3F9NA 5D41A 4CMTA 3PXZA 3ATSA 3C9WA 5AM6A 3A62A 4FKLA 4JAIA 1J3HA 5FDXA 4A9RA 4BCGA 3FI4A 3QRJA 4C38A 4AOIA 3E3BX 3VUIA 5IA0A 4G1WA 5B7VA 4U98A 4QMXA 4QP3A 4FC0A 3ERKA 2PHKA 4DC2A 2REIA 4YJOA 3RGFA 3OHTA 3R21A 4P90A 1P5EA 3OTUA 3DKOA 1NVQA 2H34A 3IONA 4H36A 4BI1A 5IA1A 3UTOA 3CLYA 2VTMA 3L8SA 4Y5HA 3RPOA 4L44A 4BICA 4F0GA 4JBQA 4GYGA 3WZEA 1UNHA 1XMMA 5E8SA 3QXOA 4I41A 2HWPA 4L46A 5DR2A 3ZLWA 1Y91A 4J99A 2OXXA 4QMVA 3F3ZA 1PRYA 2I0EA 3TJCA 4TNBA 3PFQA 5AUTA 5KMNA 4NW5A 2AC3A 2HIWA 2ESMA 4J52A 3MVJA 4BIEA 1E9HA 4FV4A 5T3QA 1GIIA 4RWKA 4M0YA 2A27A 3MSSA