3SG8A

Crystal structure of aminoglycoside-2''-phosphotransferase type iva tobramycin complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
298
structure length
298
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APH(2'')-Id
publication title Crystal Structures of Antibiotic-Bound Complexes of Aminoglycoside 2''-Phosphotransferase IVa Highlight the Diversity in Substrate Binding Modes among Aminoglycoside Kinases.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase/antibiotic
total genus 103
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3sg8A01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3sg8A02
5ETFA 4UYAA 1RJBA 4EWHA 5CF5A 1X8BA 4TNBA 2PMIA 2W1HA 4K8AA 4X6QC 4Z7GA 4AP7A 1BUHA 2YM3A 3MA3A 4RGJA 4U40A 2R9SA 4FV6A 4EZ3A 3OBGA 5JSMA 2FH9A 3V8WA 3O0GA 4WKQA 3KFAA 4FT5A 5DIAA 3QA0A 4EORA 1PXLA 4BI0A 3NUAA 2QG5A 4DFLA 3DLZA 2YDIA 3ORLA 2E9OA 4A07A 2J9MA 5AP5A 4J53A 5C4LA 3MJ2A 5BYYA 3GXLA 4JRVA 4EOJA 3W0RA 1NT2A 2PE2A 4YZ9A 4IAZA 1LEWA 5CEPA 3QLGA 3FPQA 4MBLA 3FXWA 4OR5A 4DH7A 3SXRA 1P14A 2Y7JA 3LM0A 5ACBC 4EH3A 5B2LA 3DNDA 4XG8A 4KKHA 1UV5A 5ETIA 5AADA 3G51A 3LFDA 2IG7A 3R1SA 1A06A 4FVQA 2XNOA 3D14A 3RTPA 4D4RA 4L8MA 4UY9A 3W55A 3EHAA 2EXMA 3GC9A 5AUUA 1K3AA 3NDMA 4RA5A 4FG9A 5M4CA 1WBTA 1XQZA 3DBCA 5EM6A 3NYOA 3E3BX 5CXHA 1PMUA 2OK1A 4AW0A 4EYMA 3ET7A 3QUDA 3BV3A 5EDRA 3RAHA 4EK6A 4DEHA 4O7WA 2XCHA 4HCUA 3W16A 2C1BA 2W1DA 2ZV9A 5HBJA 2XK6A 2OFVA 5LOHA 4I24A 3HUBA 3OXTA 3PJ3A 5BVDA 2R5TA 3AC3A 3C50A 3WF6A 2JBOA 3GNIB 5K9IA 3FLZA 3HECA 2PZ5A 5DT3A 3KKVA 2BMCA 2HELA 3PP0A 3NUYA 5IDNA 5J95A 2HAKA 5JFXA 4CVAA 4QPSA 5IA5A 3BHHA 4PL5A 2XA4A 3VJOA 3KRLA 4P90A 4IAYA 4NTSA 2VTHA 1ZY5A 3V5TA 3LFAA 3NMUF 3QQFA 5EHOA 2QOKA 3LCDA 5DT0A 1W98A 3MB7A 4WNKA 2XNEA 4FKJA 4B0GA 4EI4A 4FZFB 4BCIA 3ZDIA 5BPYA 1VR2A 4K77A 4APPA 1B39A 2GS6A 5BVOA 2UZBA 3VS1A 5M4IA 4TWCA 3AC8A 1ZMWA 2O2UA 2YWVA 3HMMA 4DEIA 3ORMA 2AC3A 2PE0A 5DEWA 5E8YA 4E26A 3ZMMA 1OL6A 4ZTLA 1IRKA 3MY5A 3OWKA 3SVVA 3TCPA 5LVNA 4I92A 4BYJA 4TYIA 3WF7A 3NIEA 4YBKA 4YZCA 2CKEA 4XP2A 4EK3A 3FAAA 3EN9A 4JG6A 4QMYA 4EK5A 2YCQA 2YWPA 4Z55A 1W84A 4YHFA 4C3PA 4DH5A 5JKGA 3POOA 2J50A 1WBOA 1UU9A 2GHMA 2YCFA 3OHTA 4RFMA 4C2WA 5D41A 1BI7A 2Z8CA 3HMOA 3FMKA 3UOHA 3BBTB 3TV7A 4FV7A 3ID6C 5J9LA 2X1NA 2X9FA 3UQFA 4XMOA 4X7QA 4MXXA 4DGMA 3DKCA 3Q5ZA 2PZRA 4EH9A 4CZTA 2EVAA 3KVWA 2WMBA 3AD6A 2WQEA 2VV9A 3COIA 2G1TA 4FKIA 4WRSA 3WZDA 2HY0A 1OGUA 3RPYA 4XBUA 3SXFA 4NCTC 2BRMA 5BYZA 3CCNA 5CU3A 2HK5A 4RIWB 5HHWA 4CLJA 3AOXA 4RFZA 3GCSA 1VEBA 1O6KA 2CN8A 5GJDA 1DAWA 4FSRA 4RC3A 5IDPA 3KY2A 1DM2A 1JAMA 4FKVA 3OXIA 3W2SA 3R9OA 3W8LA 4F1MA 1XJDA 1R39A 3A2CA 4MD7E 4MXAA 5DI1A 3K3IA 3OCBA 3QAME 3DPKA 2FB8A 3MBLA 3BI6A 4EKLA 1SNUA 2R64A 1WBPA 4NKAA 1R0EA 2JKKA 4ENXA 3F3UA 3UZTA 3LFCA 3AC2A 4L6QA 4FTMA 5BUIA 5HTCA 4FEWA 3GC0A 5KO1A 4R3PA 3WE4A 3UOJA 4YTCA 5DBXA 3LJ2A 4QYGA 3VS3A 3ENHA 3DBFA 3LIJA 3NCZA 2WIPA 2QLQA 4PRJA 4O22A 2Z7LA 3PJ1A 5DNRA 1MUOA 3AT2A 5HIDA 2GHLA 2GMXA 1JNKA 1ATPE 1ZMVA 3PA4A 3ZRKA 4RJ7A 3MIAA 3LQ5A 1ZZ2A 2VWIA 2R3RA 1R0PA 4IAFA 3ZLSA 4WG4A 4FYOA 2VUWA 5H2UA 1LUFA 2GQRA 1S9JA 4FKRA 3W18A 5KMIA 4LMUA 5D1JA 3DK7A 4GU6A 4J99A 5HO8A 4C0TA 1XR1A 2PE1A 3AT3A 4M15A 4WOVA 3BWFA 3RWQA 3G6GA 2C3JA 3UOLA 3LFBA 1Q8UA 4GMYA 2JDVA 3T3UA 2B1PA 4W4WA 2OJIA 4TYHA 3V04A 3UC4A 1O9UA 3EN7A 4UEUA 3PE1A 5A4TA 1MRVA 2HENA 3EQDA 4YO4A 4R6VA 3A4OX 5A6NA 3RM6A 2C30A 3FMLA 2YM4A 3FMEA 4O96A 3FEGA 1Y57A 4AOTA 2ZMCA 2V55A 3P5KA 5IG1A 5HLPA 5AA8A 4RIXB 4CT1A 5DHJA 2EB3A 5ANKA 1TVOA 2X81A 4CFUA 4M0ZA 4RVLA 2ITXA 4QMWA 4C38A 4DTBA 4RRVA 3NUSA 2BVAA 5IA4A 5FRIA 4EJ7A 2IVTA 5EOLA 4GG5A 3VUMA 4Z7HA 1H07A 4XS2A 5LMKA 4AGCA 1WVXA 3R22A 4KIPA 1OIRA 4P5ZA 2OKRA 3LFNA 4B6LA 4M7IA 4KBCA 2JEDA 4C7TA 3EQRA 3B8QA 2OGVA 4BI2A 1Q24A 5C1QB 2XJ1A 5HO7A 2IO6A 2B4SB 4EONA 2GNJA 4HPTE 3G5DA 3H10A 3QKKA 4KWPA 3PIYA 3R7EA 4CRSA 5CASA 3VS6A 1H1SA 1JSVA 2HXLA 4U5JA 4XX9A 3UJGA 4YJPA 3UDBA 2A2AA 2OSCA 3PSDA 3HMNA 4E1ZA 4FV9A 4YTFA 3F5GA 4IX6A 4DGGA 2YM8A 1E1XA 4JDHA 5C8MA 4FSZA 2UZOA 5E4HA 3AC5A 3VHEA 4U9AA 4C4GA 3IGOA 3LCTA 4YGAA 3RAKA 4M0YA 3EWHA 1R3CA 1VZOA 3TV4A 4E5AX 4C34A 4F6UA 3DAEA 2A27A 4AA4A 5M4FA 4PMSA 5L6PA 4YPDA 4H1MA 3RNIA 1J1CA 2C47A 2UZDA 5E91A 3ORNA 4E4LA 3F66A 5B2KA 3E93A 4FKTA 4ITHA 4ZSGA 4A4LA 1W82A 5CVHA 2PVYA 2CMWA 3F5PA 3OCTA 2W1CA 3OC1A 2JAVA 4U3ZA 4BCKA 2W7XA 1PYXA 4MQ2A 4AT5A 3FC1X 4L3LA 3W2CA 2C6DA 5JZJA 3CPBA 1URWA 4E73A 3F2AA 3MY0A 4GSBA 4AAAA 5BMMA 4O0RA 4NJDA 1P2AA 2YISA 3PXFA 5CZHA 3EFKA 3QUPA 3FZPA 2G2IA 5FEEA 3JY0A 5TT7A 4CD0A 5IU2A 4D9TA 4AZFA 3OW4A 3OOGA 2XK8A 2XUUA 3DAKA 2OFUA 2VWYA 4JRNA 4K33A 4XRLA 5KMJA 1NXKA 4M8TA 2XNMA 3BQCA 3H9FA 4OTDA 2Y8OA 4M69B 4ALUA 3ZHPC 5JQ5A 1PXNA 3WILA 2NPQA 3R1NA 4U94A 1M2RA 5AX3A 5LQFA 3UC3A 4R5YA 4G31A 4TWOA 4IFGA 3CJFA 4OGRA 1FVTA 2PVJA 3FL5A 4N57A 2W5HA 1U5RA 3GFEA 3HEGA 1V0PA 2IW6A 4JX7A 1GOLA 4O6EA 4PNIA 3Q5IA 1H08A 4O2PA 3NUXA 3OXZA 3L8PA 3FKOA 2HOGA 1LP4A 4XP0A 3U4WA 2V62A 2XF0A 3DDPA 4JIKA 2CN5A 4L42A 3PUPA 3GC7A 2X7GA 2ONLC 2YITA 5EDPA 4FNYA 3D7TB 3TJDA 3Q32A 2X7FA 2C6KA 3GU8A 4I94A 5AIKA 3KCFA 4YJVA 3V5WA 1PXJA 4I0TA 3BEAA 1Y8GA 5FTQA 3MTFA 2GQGA 3E7VA 3U87A 2VO7A 4E20A 4IVDA 4EH4A 5JFSA 4IE9A 3WOWA 3FLQA 5A14A 5CU0A 3KL8A 5AM6A 1YVJA 2OXDA 3MWUA 3FI3A 1JQHA 5D10A 1VYWA 4BHNA 1JKTA 3R8VA 4IZYA 3MGYA 4IANA 5CZIA 1XWSA 5IA3A 1LEZA 2C3KA 3LFQA 3OY1A 4BDGA 1XBCA 3TG1A 2VWBA 3U6HA 5ETAA 2H34A 3DJ6A 3BU3A 2FUMA 4X3JA 2IJMA 4DG2E 1V0BA 3W2PA 4F70A 3UO5A 5C8NA 4MXCA 4RZVA 4EHGA 4FUXA 2E9UA 2WMUA 4QMUA 4APCA 1Q97A 4FTAA 4H3PA 3KXGA 3WI6A 3P7AA 5GNKA 5J1WA 5HE2A 2BTSA 4W4YA 5HCYA 4TRLA 4RA4A 2OIDA 5L8JA 3R73A 4G3GA 4BKJA 4DBNA 5L6OA 3E63A 3FPMA 4C4FA 5KUPA 2VO0A 4XG4A 4MNEB 4IVBA 3QCSA 2PL0A 4M68A 5FDPA 3LLAA 5JN2A 2HYYA 4FA2A 2ZOQA 3IK3A 2VTNA 5TF9A 3R8LA 5IQDA 4RZWA 5LVOA 4YLLA 5A4EA 3QCXA 3MVMA 4PY1A 3W0QA 3NYXA 4O83A 4TTHB 3I81A 2O64A 4O0XA 4NFNA 5HVYA 4PTEA 3UBDA 5J9ZA 4FICA 4TW9A 4H3QA 3DXQA 3R7UA 1Q61A 3TNQB 4H1JA 4MXYA 4YSMA 5EI8A 1OPKA 4FTOA 3W32A 3LVPA 2XH5A 2W0JA 3NNXA 1J7LA 3LFEA 4M14A 1YQJA 3FYJX 3WIGA 4QP8A 2J0IA 4G3FA 4D0XA 5LVLA 3U6IA 2YHVA 4ANSA 1K9AA 3ZOSA 2H8HA 3ZSGA 1MQ4A 2BKKA 2CNQA 2WMAA 3R8PA 3RPRA 4DEAA 4C2VA 3R1QA 4CEGA 4RJ4A 3U55A 3FKLA 4E4MA 3BHYA 2CKOA 2QNJA 5HE1A 2QU5A 3BQRA 4M84A 4FVPA 5GIPE 3AMAA 3QQJA 5HESA 4I21A 4X2FA 1O6YA 4HYSA 4ZS4A 5IA0A 5FXSA 4NM7A 3GP0A 4CFNA 1M7NA 3HDNA 5CEQA 3NGAA 1OMWA 4MX9A 3R7YA 2PUPA 3R7VA 3TNPC 3F5XA 4L7SA 2WQOA 1Q4LA 2GNHA 2BAJA 4GU9A 4HGTA 1YI4A 4CFXA 3FLNC 4KNBA 5M53A 4Z9LA 3E7OA 2UV2A 2JAMA 2WTKB 3R6XA 4XEYA 4NU1A 5CSVA 5F1ZA 3IECA 4UALA 1FGKA 5IEXA 2C68A 5DN3A 4JAIA 3LXNA 5DYJA 4YO6A 2X8IA 5JFWA 1BMKA 1KE5A 1UWHA 4GT5A 5FEQA 1Q99A 2PVNA 3QYWA 5IF1A 3TM0A 2ZVAA 3PRFA 4G5PA 3CTHA 3ALOA 3KK9A 5G1XA 2XK9A 3C13A 2ITTA 4BIDA 5LWNA 4FT3A 3UNZA 3THBA 4G3EA 3PLAE 4GYGA 4FSYA 5DRDA 3GT8A 4BZOA 4LL0A 1J7UA 2OU7A 2WMXA 2QKRA 3F82A 2UZTA 3SW7A 2XKEA 2XRUA 2Z7SA 3EZRA 4O86A 4Q5EA 2QO2A 4FKSA 4BDKA 5IUGA 2CHLA 3FMDA 5CS6A 2QOFA 3U51A 3TUCA 1QMZA 3HA6A 4S32A 3NAXA 4X2JA 1URCA 4ZSJA 4BZNA 3W10A 2G9XA 3PJCA 4WG5A 4FTLA 4ASEA 4OTQA 3VUKA 3L1SA 1FMKA 4A9SA 3IG7A 4DH3A 5I9YA 3CXWA 4UYNA 2CDZA 3P86A 3QQKA 4TYGA 4BCFA 4FTKA 4I5PA 4ORKA 4P7EA 4QMLA 4LOPA 5CSHA 2B9JA 3FWQA 4UZHA 3TKUA 4G6NA 3IPHA 1HCLA 1J7IA 4AWIA 5CANA 2ITVA 4CZUA 4L53A 5E8XA 3UP2A 5HZNA 4FTNA 4XJ0A 3LCSA 3QALE 3PG1A 4ITJA 5M06A 4JL9A 4YPSA 3D5VA 4I5CA 3LJ1A 3Q9XA 5K4JA 2WFYA 3N4VA 1H1PA 1VYZA 4WUAA 2VTIA 3AXWA 5CVFA 3S95A 3ZFYA 4Q2AA 2YDKA 4CMUA 3G0FA 3QZHA 3L8SA 2JFLA 4G34A 5H3QA 2X2KA 4WIHA 4EWQA 3KULA 4G6LA 5D7AA 4F1OA 4FK3A 3VO3A 3TXOA 3QTSA 4Q9ZA 2YM7A 5AP2A 3GCVA 4W8DA 5HNGA 3KMMA 3D4QA 3ZYAA 3O17A 2WTIA 5AV0A 4DFZE 3BYVA 4LV8A 5B0XA 4L46A 2ZB0A 4ZMFA 2H9VA 2YIQA 3DCVA 2H96A 3A7FA 2OBJA 1DI9A 4OTWA 3ZFMA 4QP6A 1ZYSA 2BRHA 2EB2A 1SVGA 3OS3A 3BLRA 3OT8A 1F0QA 2JIVA 2EXCX 3P7CA 2V5QA 4L45A 3GVUA 4WUNA 4RFYA 1SNXA 3A60A 4RPVA 5M57A 2XM9A 1YOLA 2HZ0A 3A7IA 2V22A 5JGBA 2FYSA 4AT4A 5EKOA 4QTAA 2XIZA 3AD4A 4R1VA 3LXLA 1YDSE 5BYLA 2OZAB 4ZZMA 1PHKA 3NRMA 2B55A 2VO6A 2DUVA 3KN6A 4L9IA 4YLJA 4FL3A 2C1AA 3F7WA 4A06A 4AN3A 1JLUE 4F7LA 4CKRA 4QTBA 4FIHA 2GCDA 2QO9A 4KBAA 5AP6A 4ZSLA 4X3FB 4CCBA 5AV1A 4RQVA 3QTZA 3COKA 3Q04A 4I41A 3MESA 5LMBA 4HGEA 1FVVA 1H27A 2IZRA 4NUSA 3QXOA 2R3MA 2OF4A 3BGQA 5JEBA 4CFWA 1MRUA 3LXKA 4R77A 2X2LA 4F4PA 5IPJA 3FMMA 5FBOA 4OTFA 5D11A 3RPSA 3BGZA 4PMMA 4YURA 5DR6A 2XP2A 1ZY4A 3NUUA 3QUEA 4FL1A 3V5PA 5LWMA 4O7YA 3COMA 4FKGA 5K5NA 3W0MA 4IWQA 1YXVA 4O27B 5CAPA 4AFJA 4D55A 5IH6A 1GIHA 3A4PA 4AGDA 4BYIA 1W83A 5IH5A 1FBNA 5L2SA 4I5HA 5EHYA 3QKMA 3RAIA 4ANQA 2G2FA 4U80A 4BCQA 2RFNA 4LL5A 2W99B 4HZRA 4QMTA 3DTWA 3ORZA 3SQQA 4BVUA 4D4SA 4IW0A 1SMHA 3Q96A 1P4OA 3TKHA 4DEGA 2IVUA 2W5AA 4RMZA 4E4NA 5CU6A 4YTHA 2XBJA 3QHWA 1W8CA 5HTBA 1BKXA 5FDXA 4CKJA 3MW1A 4U44A 4XOYA 3B2TA 3DB6A 3CSVA 3CGOA 4K1BA 3ZBFA 4BICA 2VTJA 3EL8A 4QOXA 4QTDA 4EZ7A 3Q9YA 3PZHA 2VU3A 4NH1A 1JWHA 4LGHA 2J51A 4IWOA 4QMXA 3R9NA 3PVGA 2QR8A 1IAJA 3AGLA 5JZNA 1AD5A 3IONA 2LAVA 5L2IA 3L9PA 3VBXA 4UV0A 4V0GB 3R7OA 3MH3A 3RINA 3KA0A 3O8TA 3VBWA 4C61A 2UW9A 3ROCA 1ZMUA 2YFXA 1H28A 2XNNA 3JVRA 1XHAA 4IAIA 5TKDA 5HD7A 4X2KA 4EKKA 1UNHA 3MY1A 1V1KA 4DFYA 1Y6BA 4PDYA 3HV4A 2WXVA 4S2ZA 3H9OA 5EYKA 4ZTQA 1OPJA 4QP2A 4R1YA 5IMXA 5HX8A 4GJ2A 3GU4A 5FEDA 4JAJA 4GUEA 3UVPA 3C4XA 2CKPA 3MI9A 3WF8A 2GNGA 4O91A 1XBAA 1YI3A 4FTIA 1OB3A 1GAGA 2C6TA 2A1AB 4G1WA 4FZ7A 1XH5A 3DB8A 3W33A 1FQ1B 3DXPA 2IW8A 2VTPA 3E8NA 1MQBA 3VRZA 3MVJA 2VWVA 3S1HA 4FIJA 2E9PA 3CQEA 4J96A 2P2HA 3BHUA 3F3VA 5EQYA 2FSOX 3ULZA 4F08A 4BRXA 2DQ7X 3DBDA 5KKRC 4FBXA 3UO4A 3PIZA 3F61A 4KABA 4D28A 4CG8A 4K6ZA 4TXCA 3L8XA 4ZSEA 5AAEA 2X39A 3BHVA 4J71A 1CKPA 3ZLXA 4QNYA 4XLVA 3C9WA 3OFMA 4FODA 5CXZA 4JX3A 4LV5A 2PUNA 2J90A 3LCKA 4KRDA 4QMSA 3RAWA 3VF8A 2ERKA 2GFSA 2PY3A 2ZV2A 2LGCA 4FV5A 4WO5A 3NWWA 3OROA 2BRGA 3TZ8A 4EJNA 2WO6A 3QD0A 4USFA 3GOKA 3FQEA 4LM5A 4FZDB 2AYPA 3A99A 3BBWA 3UIMA 4F9CA 4CQEA 4D4VA 5HU9A 2GS2A 3BLQA 2C69A 2JBPA 1M17A 5EK7A 2WQNA 1PMEA 4FV4A 4K18A 4KBKA 3R9HA 3Q2JA 3QQHA 1B38A 4XYFA 4R78A 2Z2WA 3LLTA 2RKUA 4FIGA 5KZIA 5KE0A 3AG9A 5T68A 1PMVA 4YSJA 4R5SA 5AP7A 1TQPA 3RVGA 3RK5A 4ZSAA 4RC2A 4IEBA 2WEIA 4FIIA 5DA3A 3LFFA 4WRGA 3HAVA 2YIYA 3FKNA 4NTTA 3W0NA 4MBJA 5HX6A 3HDMA 4NM5A 2J0LA 5D7VA 2HWOA 2WMSA 2XIXA 3IO7A 4USDA 4EK4A 5HG9A 4TT7A 1PMNA 2PZYA 2XVDA 3BYMA 5JFVA 3ZUTA 3HRCA 5M55A 4DF3A 3HUCA 3FLSA 3C0HA 1CDKA 2OIBA 3U9CA 1BI8A 4GH2A 3CS9A 1H0WA 2VNYA 2XCKA 5IUIA 4F1TA 4I4FA 4FSUA 2VTLA 3RHKA 3EOCA 3KRWA 4MK0A 5AMNA 4J8MA 4RVTA 1FOTA 1U54A 1S9IA 2PUIA 4PP9A 5ANEA 1O6LA 4AG8A 3SAYA 3ZXTA 4YJOA 5M51A 1FPUA 3IGGA 5E90A 5EW3A 4BDDA 2CGXA 2C6LA 4EOOA 3BEGA 3DV3A 5E8TA 2PMNX 4FOCA 3AMBA 2QQ7A 3MB6A 4MTAA 3QQGA 3SKCA 4B4LA 4EUUA 4DEBA 5AWMA 2Y0AA 3PRIA 4DT9A 1OM1A 1RW8A 2ZM4A 4USEA 4YLKA 3ZC6A 3UVRA 5E9EA 2X4ZA 3TWJA 5C9CA 4BCNA 4EOLA 2DWBA 3U54A 4GS6A 4EQCA 4AZSA 4TWNA 2C0OA 1FMOE 3Q6UA 3RK9A 5C03A 2Z7QA 2BALA 1YXTA 4ITIA 3UGCA 1Z57A 2R3HA 3LQ3A 2B53A 4EH2A 2WEVA 4IWPA 2UW5A 5CT7A 5AUXA 4YC6A 4E7WA 4FV2A 4RWJA 3S2PA 4EZ5A 4FSWA 3VW6A 4WT6A 3KRRA 3HL7A 4DTAA 4OUCA 3FMJA 4EOIA 3LPBA 3TUBA 1OKWA 3UQCA 3HAMA 4KINA 4EQUA 4ONAA 3FE3A 3QF9A 2HW7A 4BCOA 4F9BA 4KIOA 1WVYA 4BB4A 5KX8A 3FZTA 4W4VA 2F9GA 2VWUA 5L3AA 4YZNA 4QP4A 1UU3A 4J7BA 4N6ZA 2O63A 2Y4PA 3CKWA 4NT4A 4RVMA 4UXLA 5EOBA 3TNHA 4EHZA 4ZZOA 5J7HA 3F5UA 2GHGA 5EM5A 3VS5A 2ETKA 3CR0A 4OTRA 3UNJA 2VTAA 2WPAA 5ANDA 2VTQA 2OO8X 3GQIA 4MD9E 5GHVA 4O7LA 4C3RA 1WBWA 4XG2A 3MH2A 2UZWE 1GIJA 3MN3A 3Q3BA 3BU5A 4NW6A 4PX6A 2P3GX 1IASA 2QLUA 1M14A 3Q2MA 4ZY6A 4YNOA 2CGVA 3UMXA 1Z9XA 4RX5A 5FP6A 4AGUA 3QTRA 5ANIA 4O7OA 4I0RA 2CCHA 4O21A 3EQGA 3ZXZA 2EUFB 2P55A 3O8UA 4FSMA 4F9AA 4M97A 4L00A 5DLSA 4GIIA 3QTXA 5BVNA 5EKNA 4BC6A 1H1RA 2RFSA 3GCPA 3PWDA 3IW4A 2FSTX 4IZAA 4N0SA 4OW8A 4XP3A 3CC6A 4YJNA 5CU2A 4X2NA 5D9HA 3V5JA 3LXPA 3BE9A 2ZM3A 1KV1A 3VS4A 3Q9WA 5DR2A 4CTBA 5I5ZA 3A62A 2BHEA 5KNJA 2YIRA 4IX4A 4JBQA 1H26A 4EC9A 1IAHA 3G90X 4MWIA 4QMPA 3DZOA 2VTRA 3UYSA 3BIZA 4FEVA 4YHTA 4NCTA 2HZIA 3HRFA 4TL0A 4BTJA 4HOKA 1KE7A 3DQXA 4FT9A 1QPDA 3W2QA 5DT4A 4LQMA 3Q4ZA 1ND4A 2ITUA 3BU6A 3E87A 3PDTA 3PSBA 2J0MB 4D5KA 4FVRA 4F0IA 3PPKA 3QD3A 3EFLA 3OY3A 4O6LA 3OT3A 2WKMA 3R8ZA 4WG3A 3NIZA 2F7EE 2ZV7A 3CPCA 3R01A 2VTSA 3ORIA 5CALA 4JOAA 5BVEA 2F49A 3NX8A 3PE2A 5CAVA 2C5YA 2QI8A 2PZIA 5M09A 2PZPA 3LQ8A 3ZU7A 3AQVA 5JH6A 4EL9A 4M3QA 3FL4A 4G9CA 4P5QA 4F0FA 1UNGA 3D94A 4JDJA 3QL8A 4G6OA 2Z7RA 3PYYA 4HVGA 3TZ9A 5AV3A 3PVBA 3PY0A 2VTMA 2WMRA 4I6QA 4JBVA 4UWBA 3EQFA 1KE9A 2XS0A 3SHEA 5L2WA 2R3QA 4PMTA 4RIYA 1A9UA 5HIBA 4D1SA 4HW7A 4U45A 3W0OA 3P4KA 3RPOA 4XV3A 4DN5A 5E8WA 4ZIMA 1H4LA 4IACA 4YJUA 1MP8A 3RKBA 1ERKA 3TTJA 4XG3A 5J5SA 4FSQA 5I9ZA 4NWMA 5M44A 4FKLA 1IA9A 5HVJA 1BX6A 2SRCA 2WMTA 4MD8E 2WZJA 2R3NA 3SXSA 4EH5A 4FIEA 4GK2A 4CMOA 2JFMA 1WBVA 4GFOA 4GV1A 3GQLA 2X6DA 3QTWA 2PSQA 4YZMA 5C8KA 2JKQA 4GFGA 2PVMA 5AUTA 1YXUA 4O7NA 4CSVA 5CEKA 3C5UA 3DQWA 3DDQA 4FIFA 4RJ6A 3I79A 3I4BA 4O84A 3VUHA 3R04A 3VBYA 4I22A 3CD3A 3QTQA 2ZV8A 2Q0NA 5B7VA 2WTKC 3R02A 2PULA 4ANLA 5M56A 3NUNA 2WU6A 4MXOA 3JXWA 4WBOA 4FNWA 3NAYA 2HZNA 3M42A 5LMAA 2ITQA 1GZKA 5CVGA 4PP7A 3RGFA 2QU6A 3Q4UA 2XYUA 4GFMA 2NRUA 4TYHB 4YMJA 4CCUA 4WBBB 1OZ1A 4MF1A 5EW9A 3UOKA 3V01A 2GDOA 1CKIA 2UZUE 3DKOA 3HX4A 5GJFA 3U9NA 4A9UA 2CJMA 4OT6A 3LZBA 4DG3E 3O96A 4X6RA 1ZYDA 3RI1A 2VGOA 2R3OA 3E8EA 5DWRA 4O7PA 3KXHA 4FKQA 4L3PA 4OBOA 4PUZA 3DOGA 5EFQA 2VWXA 4DEDA 4UWYA 4YR8A 3OTVA 4IZ5A 2W1EA 2W9ZB 1UVRA 4RIOA 3TT0A 1PY5A 3ZRMA 2P2IA 5FTGA 3G9LX 1PJKA 4ZP5A 2J4ZA 3VS7A 1DS5A 3PXYA 5DE2A 2FA2A 1JVPP 2JDSA 3F2NA 2XBAA 4DC2A 4ZS0A 2BDJA 2W4KA 2WMQA 4IM0A 3WF9A 2OJFE 3LKMA 5EYDA 2ITZA 4EOSA 2WIHA 4GJ3A 2IVSA 2PU8A 3P23A 3BYOA 5AV2A 2RG6A 4IM2A 3MFSA 4LRJA 2WD1A 3W0SA 3JS2A 5CI7A 4JQ7A 5HG7A 3ITZA 1REKA 4X21A 4J1RA 4FV0A 2CGUA 4F09A 3BYSA 3Q52A 4NW5A 1Q41A 3OVVA 3PY1A 1L8TA 3KN5A 3QC4A 3SX9A 3CQUA 3ORPA 4QMQA 4EH7A 1HOWA 4HCTA 1QCFA 2Q83A 1MRYA 5HG8A 4FE2A 3D5UA 4M67A 3R83A 4G3DA 2AC5A 2PTKA 5HCXA 3QRIA 4QYYA 3UVQA 3GEQA 5L8KA 5DEYA 4LYNA 4PWNA 2ZMDA 2BRNA 3ZONA 2HIWA 4BDCA 5HCZA 4WNOA 4QP1A 1LPUA 1QPJA 4FR4A 1Q62A 2BZHB 2OXXA 4IQ6A 4JG7A 1PKDA 3OWPA 4XOZA 2ONLA 4RJ3A 3FY0A 4XV9A 2XM8A 5AAFA 3OUKA 2JKOA 3R63A 1TQMA 2XRWA 2ITWA 5E7RA 3HLLA 4ZOGA 4PTCA 2R3GA 3DS6A 4K9YA 3QC9A 3IW8A 5IQGA 5FXQA 2O0UA 2JC6A 2BFXA 2YCSA 2FSMX 3FHIA 3F9NA 3ULIA 3QD4A 4TYJA 5BX0A 1F3MC 2OJJA 5AM7A 4PF4A 4U98A 2CNVA 3LJ0A 3IOKA 3OMVA 4E4XA 5FD2A 1KOBA 4I6HA 4IJ9A 5H9BA 5CQWA 2NRYA 4X3FC 1CM8A 3G2FA 3Q4TA 4XBRA 4E6QA 2IZSA 4RVKA 4M13A 3HNGA 2CKQA 3DK3A 3CE3A 3V6SA 5KBRA 2HW6A 4DLJA 4S33A 1JKKA 3U8WA 2Z02A 3OD6X 3R2YA 2XB7A 5IQIA 3CY2A 3L9MA 2UW0A 4B8MA 4S30A 4BCHA 3C4WA 3DFAA 2C0TA 4FGBA 4F64A 4R7IA 1H24A 5KMLA 3G6HA 4QQCA 4Y85A 3S3IA 3ORKA 3ANRA 2F2UA 3GCQA 5M4UA 4RJ5A 4J52A 3MIYA 4TPTA 2QD9A 3C0IA 5KKRB 2IPXA 1XKKA 1JSUA 2YA9A 4V04A 5A4QA 2B54A 2J5FA 4Y73A 1ZWSA 4RX9A 2W06A 3QHRA 2G2HA 4QQ5A 2B7AA 4PMPA 4ZLOA 5BNJA 1APME 5T3QA 3F88A 2WQBA 1H00A 4IBMA 2JDTA 2UW3A 1OIUA 5HI2A 3ZRLA 2WB8A 2VWZA 3GGFA 4FMQA 3ZEPA 3PFQA 3ODYX 4OTIA 2RIOA 2OZAA 4IB1A 4K2RA 4NFMA 4FL2A 2YACA 5IEYA 3OOMA 3GU6A 5DG5A 4AU8A 4ZLZA 2B9FA 1U59A 4G5JA 3QLFA 5CYIA 5H8EA 2FSLX 3CEKA 4EQMA 4TKSA 1ZXEA 4FEXA 3C1XA 2VGPA 1UKIA 4CTCA 3CY3A 4U8ZA 4C58A 2GS7A 4U81A 1PXIA 1TKIA 2YZLA 4YTIA 3TYKA 4AW5A 4ZZNA 2OH0E 1CTPE 3CP9A 1XH7A 2CLQA 4D2SA 1IG1A 2QOOA 3DY7A 2XK4A 3NW7A 4N4SA 4RT7A 3PTGA 5AFVA 4JDKA 4AZTA 4H3BA 3UE4A 4FNZA 5CEIA 4AQCA 4ZXTA 1Z5MA 3IS5A 1IR3A 3FI2A 2ESMA 5EDQA 2QC6A 2VN9A 4ZK5A 3FLYA 4F7SA 2WELA 1OL5A 3FZSA 4P4CA 4ALVA 3RHXA 2C5OA 3GB2A 2JKMA 3VN9A 3WIKA 5J1VA 2BZJA 5M08A 2CNUA 1J3HA 3FQSA 4KKEA 3SC1A 5AP1A 4I23A 1UWJA 4V01A 2BCJA 3OWLA 3R28A 4KS7A 5ETCA 3R0TA 3ZUUA 4MEDA 5HIEA 3SW4A 3MH0A 3F3ZA 3W2RA 3ZM4A 2BTRA 5A9UA 5CENA 5BVWA 4OTHA 1P4FA 2YDJA 3RP9A 3DZQA 5FP5A 2R3KA 4Y95A 3TUDA 1WMKA 4F7JA 2P0CA 2PMLX 1BL7A 4FI1A 4ASZA 4DA5A 4YNEA 1WFCA 4C4JA 3C4CA 4ZY5A 2C5VA 2OF2A 4FV8A 2YAKA 4WNMA 4ASDA 5HD4A 1XH4A 4BDIA 4DAWA 1PRYA 4G3CA 4QMZA 3I6WA 1OL1A 5E8SA 4IM3A 2QVSE 2Y4IB 5LCJA 3BLHA 3CTJA 3R7IA 1Q8WA 3UIBA 2OJGA 2X9EA 5FGKA 4EBWA 2XKCA 4U43A 4QMNA 4G16A 1WAKA 3MSSA 3UIXA 2W1GA 1Q3WA 2CCIA 3F3WA 5ANJA 2VAGA 3O51A 4ZTHA 4AACA 2Y9QA 3FC2A 3CTQA 5HBEA 3C51A 3SRVA 4ACGA 3VUDA 3G9NA 5L6WL 2G15A 1YWNA 3D2KA 3OEFX 4YC3A 2QODA 3CD8A 3FHRA 3V3VA 4HZSA 4RLKA 4TWPA 3F6XA 1YWRA 4ZY4A 3COHA 3F2RA 3FJQE 4RWKA 4QYEA 2YM5A 4KAOA 4J97A 3SD0A 3VUIA 3ZUVA 4QNAA 1XO2B 4EUTA 4PQNA 4FKPA 3UODA 4L43A 4JBPA 4AE6A 3PXRA 4CKIA 4EK8A 2VD5A 3A61A 4II5A 4RX7A 2XIYA 2I0HA 2YABA 2RFEA 3GC8A 3K5VA 3O23A 2G01A 3ORXA 3PG3A 4PTGA 5GJGA 5CSXA 4ZMEA 2KULA 4GIHA 2UW7A 4DFUA 4LG4A 4BTMA 3CBLA 3QA8A 3HA8A 4JS8A 5HBHA 4BDHA 3K2LA 2OLCA 1FVRA 1GZNA 5TR6A 3HGKA 4JVGA 4I93A 3R9RA 3KXMA 4FTUA 3SOCA 4L3JA 3U6JA 3H9RA 3QWJA 2VX1A 2WTDA 1SZMA 3QZGA 5LARA 4LMNA 2QHMA 4CMTA 3T9TA 2QHNA 4FNXA 2QKWB 5L2TA 4U97A 5AX9A 1AGWA 1OITA 1OL2A 4IX3A 1E1VA 4QQJA 4EOKA 2YJRA 4FTTA 1KOAA 3HV7A 1QPCA 3DAJA 3UQGA 4FSTA 4KIQA 3UG2A 3I5NA 3OBJA 3BHTA 2V7OA 4HPUE 3ZLWA 1G3NA 3GENA 4CFVA 1G5SA 2JIUA 3IOPA 1W7HA 3FSFA 1GJOA 4F65A 2XNGA 4MXZA 2PK9A 4FV3A 5JQ8A 4BI1A 4XRJA 2OG8A 1YOMA 3DJ5A 4KSQA 3SG9A 5EM8A 2R3FA 3VC4A 3L8VA 2GNLA 3AC1A 3KULB 3FUPA 2I0YA 1WCCA 4MNFA 4AA5A 1YHVA 3AC4A 4X2GA 3R9DA 4DFXE 4AS0A 1YWVA 4IVCA 3EH9A 3POZA 3HP5A 1KE6A 2YCRA 2QOCA 2QOBA 2R3LA 3E92A 2OIQA 3EQIA 3R21A 3LM5A 4EOMA 4AOIA 3RMFA 4HVDA 2XKDA 2C4GA 3DXNA 5I9XA 3O2MA 4EEVA 4YJRA 2PVKA 3F3TA 3V8TA 4ACDA 4B7TA 2PVLA 3EFJA 4DH1A 1UU7A 5DH3A 3H0ZA 3NVMB 4KB8A 4O7SA 4C4HA 5ANGA 4ZTSA 5G6VA 3DBQA 5I9WA 2CPKE 4CV8A 2WGJA 3EZVA 4IADA 3OWJA 3ROYA 1GIIA 2W1ZA 1JKLA 3OCSA 3RWPA 5JK3A 4GK3A 4LUEA 3TZ7A 4MYGA 2NNWB 2OICA 3R30A 5HKMA 2I7QA 4HYUA 1U46A 3AT4A 3FDNA 1H25A 4ZEGA 2B52A 3C5IA 5HU3A 4E6AA 3NUPA 4C35A 4RWIA 5CTPA 3LE6A 5AAGA 3UPZA 5FM2A 4AZWA 5BVFA 5DR9A 4V05A 5EYCA 3C4EA 3M11A 2BDFA 2ZB1A 4IB0A 3R8UA 1BLXA 2QR7A 3ZH8A 4XV2A 4YU2A 3PPJA 4DLIA 2BIYA 1EH4A 4YJTA 3AMYA 2BAQA 1OBDA 3D5WA 2VO3A 3NLBA 4FX3A 4O0WA 5C01A 4F99A 3QCYA 4K0YA 4DGNA 2PVFA 2C0IA 5DPVA 5E1SA 2A19B 2J5EA 4FKOA 5JRQA 4HNIA 3DGKA 2X4FA 1WBNA 4OLIA 1M52A 3I6UA 3UZPA 3BCEA 3KVXA 3BZ3A 4FKWA 4HVHA 4NL0A 2BFYA 2BPMA 4YHJA 1H0VA 3ETAA 2XZSA 4N70A 3R8MA 4B9DA 4QQTA 4BCMA 3KF4A 1PXMA 4FC0A 1B6CB 4LOQA 5LJJA 3HVCA 4U6RA 3W2OA 3ODZX 3ATTA 1Y8YA 3CIKA 2JITA 3EYGA 1H01A 3IW5A 5C4KA 3QRKA 4OBQA 4RIWA 5IQAA 4C33A 5I9UA 2ERZE 4E6DA 2ZYBA 1NY3A 4FYNA 4O0TA 4QP9A 3WE8A 4C59A 1UU8A 5CX9A 3MTLA 5CNOA 3IQ7A 1YRPA 4J98A 2UVXA 2UW4A 1M7QA 5CSWA 4DGOA 4DITA 1TQIA 2WU7A 5JMSA 5F9EA 5EH0A 3D2IA 3EB0A 4ZTRA 5CT0A 4DEEA 2WTJA 2ZAZA 3C7QA 3NYNA 4D58A 4G17A 3OEZA 3ANQA 4I5MA 3ZZEA 2QURA 4OBPA 5DOSA 5BUEA 2B9HA 2VX3A 3KEXA 2RL5A 4MHAA 4MVFA 4U79A 1W0XC 3QYZA 4BTKA 1H8FA 5I4NA 4GRBA 3FV8A 2YIWA 3TN8A 4G2FA 2WOTA 3RCJA 5KHXA 3KRXA 5FTOA 4EOQA 2Q0BA 2UW8A 1STCE 2VTTA 4YBJA 2F7XE 3Q4CA 3IDBA 4DGLC 2HCKA 1DAYA 5TOZA 5AA9A 3K3JA 3MFRA 1XH9A 2W1IA 3PY3A 3EIDA 2C6OA 4IC8A 3FZRA 3D83A 3F69A 3F7ZA 4JNWA 5EI2A 3TIYA 4EH8A 2XKFA 3GOPA 3ZFXA 2VRXA 2YN8A 3P1AA 2YM6A 3NCGA 5KMMA 2V0DA 3O50A 5IH4A 2XEYA 3LFSA 3V6RA 4FKUA 3SOAA 4RSSA 2X0GA 3BV2A 4O7VA 4D9UA 5F20A 2ETMA 4R3CA 2PUUA 5IQBA 4BCGA 2A4LA 2WAJA 3ZSHA 3V51A 3R71A 2WTWA 3MVLA 3PVUA 2WHBA 1RQQA 4H58A 4IHPA 4RIXA 3GBZA 2ZDUA 3PIXA 5KCVA 4F9YA 3AGMA 4TY1A 3TDWA 3V8SA 1ZOGA 2ITYA 2UZNA 5LCKA 1GNGA 2Y6OA 3HMPA 4FV1A 1ZYCA 2J7TA 4XG7A 4OT5A 2PHKA 3SDJA 4DINA 3ALNA 1QL6A 3L9LA 3QZFA 4UN0C 4D0WA 5LVMA 4YZBA 3UO6A 3SA0A 3DFCB 3FI4A 4ZJJA 4QPAA 4HVSA 5BMSA 4BDFA 4Z3VA 2WTCA 5EM7A 5HICA 5HGIA 2R7BA 2FO0A 3VIDA 3WZJA 3DA6A 4LRMA 3ZO1A 5A3XA 4LOOA 5CAQA 1RE8A 4C3FA 3DBEA 2I0VA 4FG8A 4AA0A 4EH6A 4F6SA 3E3PA 4BCPA 2DYLA 4JBOA 3E62A 4N6YA 5HE0A 3QQLA 3NS9A 2BRBA 4ARKA 4AFEA 2BAKA 3QQUA 3ZLYA 4JI9A 3I7BA 3MA6A 2XIKA 2BIKB 3E88A 4F7NA 2RF9A 5J87A 1OECA 4DHFA 5E8VA 4GYIA 4A4OA 5BQ0A 1NW1A 4XNEA 3ZO3A 1RDQE 5CF8A 2I6LA 4DFBA 1XH8A 4JXFA 5F95A 2JGZA 2P4IA 5KHWA 3WYYA 4JDIA 2KTYA 3OUNB 2BROA 2VNWA 2XYNA 4L44A 4BGQA 5ITAA 2FVDA 1HCKA 2JDRA 2X8DA 5H8GA 2B9IA 2XMYA 4PL3A 3PA5A 5C27A 2ITPA 4GL9A 4AW2A 3I60A 3FQHA 3DK6A 3N4TA 4MWHA 1GY3A 3I1AA 4UX9A 4QP7A 5LMKC 2C5NA 3WARA 5CEMA 4YZDA 3ACKA 4Y46A 1GZOA 4KD1A 3RCDA 2F57A 1PW2A 1G8AA 1GZ8A 1U54B 3D0EA 4HCVA 3VQHA 4D2RA 5CF4A 3VUGA 2OJ9A 3IW7A 3LAUA 3W0PA 4ERKA 2I40A 3U4UA 5KMOA 3RM7A 4EHVA 2OWBA 3LMGA 5AV4A 4HYIA 1UKHA 2WOUA 3HRBA 3PWYA 5AIRA 1PKGA 3GFWA 4BDAA 2H6DA 2OZOA 3QTIA 2GSFA 4RBLA 4RJ8A 5T6KA 2FGIA 2RGPA 4RWLA 5CEOA 3QFVA 4ZTNA 2VWWA 3EQCA 3VBVA 3M2WA 1JBPE 1YXXA 4RG0A 2UVZA 4JQEA 4YC8A 3ZC5A 3W8QA 4DCEA 3VS2A 3VWAA 1E9HA 3JUHA 1YDTE 3D15A 4LUDA 3NW6A 2R3IA 3NPCA 3VNTA 4IAKA 4E5BA 3LHJA 2CSNA 3QRUA 4NIFB 5A4CA 2ZDTA 1OKZA 2W9FB 2YEXA 1YOJA 3CLYA 3TACA 3VQUA 4C4EA 4MAOA 4FUYA 4QT1A 2CGWA 2REIA 1SM2A 2C5XA 1KWPA 3D7TA 5HNIX 4A9RA 5EHLA 4E8AA 5HNBA 2OXYA 5K3YA 4HJOA 4J95A 1M2PA 3N9XA 5HQ0A 4XHKB 3PXQA 4KRCA 3DU8A 4L52A 5D12A 3MV5A 4FZAB 5FQDC 4DT8A 2R2PA 2GFCA 3H30A 1VJYA 3P78A 1KE8A 3VVHA 2UZVA 4WD5A 2JD5A 1I09A 4FZ6A 3QZIA 4CV9A 1OUYA 2XK3A 4RQKA 5E1EA 3WYXA 3KB7A 2UUEA 4Z16A 4O82A 1ZRZA 2JDOA 4UXQA 5EI6A 5ICPA 3AD5A 4RC4A 4C02A 5HLWA 2F4JA 4O7TA 3ZEWA 1PXKA 1SYKA 2O3PA 3BX5A 3UIUA 4AXAA 2NP8A 4XCUA 4C36A 4H05A 3ZTXA 3O7LB 1P5EA 2B0QA 3PZEA 2C6EA 3KREA 2IW9A 2R0IA 2YERA 3ELJA 4GCJA 3QX2A 3CGFA 2I0EA 4BN1A 4C37A 3QBNA 2BR1A 4IIRA 3CQWA 4JIAA 1KSWA 5AJQA 2Z60A 2UW6A 2YZAA 4TNDA 5DGZA 3GCUA 4HNFA 5IUHA 3NSZA 3PXZA 4FTRA 1UA2A 4DFNA 3OP5A 2VX0A 2WTVA 5E92A 4UZDA 2GPHA 3JPVA 3QRJA 4IFCA 2GQSA 5IQCA 3FSKA 3BGPA 4LRKA 3VF9A 3VW8A 4AUAA 1FGIA 5HORA 2QONA 1J1BA 1U4DA 3KMWA 4ZLYA 4Y83A 4MNEA 3VS0A 4U7ZA 3TJCA 5IMEA 4XV1A 3P7BA 4BBMA 3NNWA 3GUBA 4IWDA 3ZO4A 5K5XA 2Y6MA 5FM3A 5A46A 3A7HA 2AUHA 4O0UA 4GK4A 3WZKA 4AN9A 4MQ1A 5JGAA 4O81A 5A4LA 2XIRA 5EQPA 2YAAA 4KSPA 4E93A 3BWJA 4DG0E 3C4ZA 3EN5A 4NSTA 4XUFA 4AGWA 3PLSA 4F6WA 3Q53A 4FEUA 1OL7A 2J6MA 4PNKA 3FZOA 4PV0A 4R7HA 4U41A 2RFDA 4EC8A 1R78A 2XEZA 3D7ZA 1PXOA 3JR1A 3TDVA 2W5BA 2OH4A 3A7JA 4GVAA 4Y8DA 4I6BA 4CGAA 4E5WA 3Q9ZA 4CXAA 3A8WA 2WMWA 4HYHA 3VULA 1OKVA 3TNWA 2RG5A 1YW2A 3BELA 4NYEA 1IEPA 5AP3A 2ETRA 4BY9E 3TZMA 5EG3A 4GEOA 4BDJA 3B2WA 3I0QA 4Y72A 4IB3A 1WZYA 1T46A 5IQHA 1PYEA 1Y6AA 4HVIA 4X0MA 5I9VA 2QCSA 3MJ1A 3MDYA 1F5QA 3LOKA 4IDTA 2DS1A 4JR3A 4AN2A 3PPZA 2F2CB 5LVPA 3HP2A 3DLSA 3EL7A 3BPRA 4BBFA 4BDBA 4D1XA 5JT2A 4O38A 3NZ0A 1SVEA 4H36A 4WNPA 2GTNA 2GU8A 3RK7A 2ITNA 4RIYB 1DI8A 3SG8A 4GKHA 2JIIA 3MH1A 2GTMA 1A48A 2WQMA 1U5QA 3KXZA 4RX8A 4TZRA 4CFMA 4DH8A 3KMUA 4JJRA 2XJ0A 3EN6A 3OF0A 3EQHA 5FUTA 4JLCA 2E9NA 2GNIA 4ANMA 4AX8A 2IWIA 2WNTA 2XNBA 1WVWA 3ORTA 3DKGA 5A6OA 4BDEA 3FYKX 4DCAA 3GU7A 3P79A 4M12A 4ZAUA 2Y4IC 2W17A 1YHSA 2QOQA 2QOHA 4B99A 1LR4A 4DBXA 3NEWA 3D5XA 3G15A 3EJ1A 3HZTA 3BRBA 1ZYJA 3D9VA 3FI8A 3PSCA 3A8XA 5AEPA 2P33A 4FOBA 2ITOA 4Y5QA 3SGCA 5K4IA 1NA7A 3UTOA 5BVKA 3LCOA 4BF2A 5FLFA 3UMWA 3TI1A 1XH6A 4L67A 4ZTMA 2R3PA 4GVJA 3NW5A 2IZUA 3NNVA 4MH7A 5AUYA 4W8EA 4NK9A 2UVYA 3EFWA 3LMIA 2J2IB 3V5LA 1NVRA 3UZRA 4D4YA 3QRTA 2W05A 3UYTA 3ATSA 4I20A 1G8SA 4JG8A 4CT2A 3UNKA 4WHZA 4CNHA 3JY9A 4FEQA 2BZIB 2QOIA 5B2MA 2EU9A 5CWZA 4GG7A 5E8UA 4NM3A 4Q5HA 4QTCA 1OBGA 3PVWA 3EKNA 3MPAA 4D5HA 4QMVA 4NJ3A 4F0GA 5L8LA 4EYJA 5CLPA 3I0OA 3FXZA 3T9IA 3PXKA 3T8OA 2C6MA 2OW3A 5DFPA 3S4QA 3TKIA 1J91A 1OIQA 2BDWA 1REJA 3B8RA 3BYUA 4TYEA 3UG1A 5CSPA 4ID7A 3IDCA 5KZ0A 4D1ZA 4I1ZA 1OPLA 1OKYA 3BE2A 4F63A 4XG6A 5IA1A 5J8IA 5HE3A 4YJQA 1JPAA 4QYFA 3H0YA 5C26A 2ZJWA 2HXQA 4G9RA 5ACKA 2W4OA 3KQ7A 3DJ7A 1ZAOA 2PWLA 5CAOA 4IAAA 4BBEA 3O71A 4P2KA 4Y5HA 1NVSA 2J0JA 3A7GA 3M1SA 4FT0A 5CQUA 2PVHA 5KMKA 4IX5A 1CKJA 3MFUA 5ANOA 5F4NA 1ZLTA 5IZFA 3ENMA 3PJ8A 4LGGA 3HYHA 3IDPA 2J0KA 2HZ4A 3PP1A 3KGAA 3QKLA 3MPTA 3DT1A 5AUWA 5AUZA 3TEIA 3I7CA 3II5A 3Q6WA 5F94A 3UPXA 3S0OA 4X3FA 4U0IA 1ZOEA 1JSTA 4XH6A 4IZ7A 4ASXA 1CMKE 4PDSA 1V0OA 3MFTA 1AQ1A 3IW6A 1L3RE 1YI6A 5EQEA 4XLIA 4QTEA 1R1WA 1BL6A 3KCKA 4I4EA 3RPVA 3Q60A 3ZZWA 3H3CA 4DTKA 4CG9A 1BYGA 5HEZA 2R3JA 3QGYA 2E2BA 1FINA 4OTGA 5AP4A 4IH8A 1QPEA 3EMGA 4QMMA 4WSYA 3FBVA 4I0SA 3HV6A 1PXPA 5CNNA 4KS8A 4B8LA 1Y91A 2O5KA 3WF5A 4C4IA 5DRBA 1Q8YA 4GW8A 3O7LD 3UP7A 4HGLA 4DE4A 3QU0A 2BILB 2BUJA 2O8YA 3MPMA 4PL4A 3RZBA 2CLXA 1H1QA 4FT7A 4K11A 4KKGA 2EWAA 3I5ZA 3ZM9A 4BGGA 1YXSA 2A0CX 5IISA 3KXNA 1UNLA 4GKIA 2XK7A 3HMIA 3TNIA 1OIYA 3N51A 4A9YA 4YUQA 2X8EA 5KMNA 4FSNA 5FG8A 2X7OA 1NVQA 3DKFA 5M07A 2NO3A 2I1MA 3L9NA 2UZEA 2UZLA 2PMOX 1CSNA 2IN6A 1Q3DA 3E5AA 4AE9A 3C0GA 4A4XA 4QP3A 4NZWB 4A9TA 3G33A 3V5QA 2HWPA 3FXXA 5JRSA 2R4BA 4ENYA 4R3RA 4WZYA 4AOJA 2W96B 5FXRA 3RJCA 3ZO2A 4O7ZA 3KXXA 4TN6A 4BZDA 5IA2A 4CLIA 2V7AA 2XJ2A 4WA9A 5JGDA 1ZARA 3QTUA 3P9JA 4L68A 4ANBA 4AZVA 3ERKA 3NNUA 4ERWA 4IMYA 2JLDA 4MBIA 4V0GA 4ACMA 4JT3A 3GI3A 4NKSA 3S00A 4I3ZA 3WZUA 3DNEA 3PA3A 4IC7A 1M2QA 4BHZA 3MS9A 4AZEA 4GT3A 4C62A 3OW3A 4AT3A 3VHKA 3TTIA 1H1WA 4S31A 2VTOA 4U42A 2BKZA 4YP8A 3VAPA 3SV0A 3VBQA 2O65A 4UB7A 3GU5A 3PJ2A 3NYVA 1IA8A 5IQFA 4H39A 5J9YA 1I44A 4CFFA 4FTQA 4JQ8A 5CI6A 5KBQA 2OI4X 4MCVA 5GINE 1OI9A 3RALA 3SLSA 3OG7A 3LW0A 4QMOA 4KUJA 4ALWA 4Q9SA 5LXMA 4L01A 4JR7A 2R0UA 4QRCA 4FG7A 4HGSA 2QO7A 3BKBA 4FGRA 4F9WA 3FMHA 3P0MA 1YKRA 4PDPA 4R7BA 4BCJA 3EYHA 2YJSA 5IQEA 4FTCA 1K2PA 3KK8A 5CF6A 3KC3A 3O8PA 2F7ZE 4LI5A 1ZOHA 2QOLA 2R7IA 3R1YA 4YJSA 5HG5A 5CU4A 3ACJA 3QGWA 4EBVA 4BIEA 2QG7A 3EQBA 3OZ6A 4GT4A 2E9VA 3H4JA 5H8BA 5E8ZA 3KF7A 4EHEA 2C6IA 1JKSA 4U3YA 5GIOE 4O0SA 4NM0A 1YHWA 4IJPA 3E64A 3QX4A 2BHHA 4KA3A 3FMNA 4J8NA 3ZS5A 3FY2A 5HVKA 1SVHA 3FZ1A 3E8CA 4DYMA 5I0BA 4UBAA 3R2BA 3KU2A 3N4UA 5EYMA 3E8DA 3ZBXA 1YDRE 2VZ6A 3OTUA 4E6CA 3NR9A 4O0VA 4RLLA 3HV3A 3FLWA 5TO8A 3G0EA 4I6FA 3MYGA 3T3VA 3WZEA 4AW1A 1OVEA 1OUKA 5FBNC 4BGHA 4O0YA 4BR3A 3TL8A 3LMHA 3JYAA 2ACXA 1Q5KA 1XBBA 5BUJA 2PPQA 3W1FA 3KRJA 3EQPA 1PF8A 4IVAA 4XG9A 3TV6A 2IVVA 4UWCA 1JOWB 4QYHA 1KUTA 5DVRA 4O2ZA 2X6EA 3P08A 2ZM1A 2C3IB 3QXPA 5AUVA 1ZZLA 5IEVA 5A54A 4A7CA 2X2MA 3QCQA 4QO9A 3ZSIA 5HLNA 4ACHA 4BIBA 2W4JA 2PVRA 2C3LA 3EKKA 4IDVA 3VBTA 3R00A 2HY81 3QD2B 3CKXA 4W4XA 4O7RA 1Q8ZA 2BZKB 1Q8TA 3HKOA 3K5UA 4L7FA 2W1FA 3HV5A 3JVSA 5AP0A 4AF3A 1T45A 2IZTA 3ZDUA 2WMVA 3CJGA 3REPA 3IKAA 3C4FA 1WBSA 2YIXA 4FTJA 3ZCLA 4ZJIA 3EN4A 4BTFA 3WBLA 1KV2A 4EOPA 4ZJVA 3MVHA 5EW8A 3K54A 3QWKA 3NVKI 2PYWA 3SRVB 3TIZA 3OCGA 2GNFA 5CY3A 3VRYA 4CRLA 4FK6A 4MKCA 3DTCA 5CAUA 4S34A 3VJNA 4IB5A 2XNPA 4ACCA 4LFIA 4GUBA 4PDOA
chains in the Genus database with same CATH superfamily
5ETFA 4UYAA 1RJBA 4EWHA 5CF5A 1X8BA 4TNBA 2PMIA 2W1HA 4K8AA 4X6QC 4Z7GA 4AP7A 1BUHA 2YM3A 3MA3A 4RGJA 4U40A 2R9SA 4FV6A 4EZ3A 3OBGA 5JSMA 2FH9A 3V8WA 3O0GA 4WKQA 3KFAA 4FT5A 5DIAA 3QA0A 4EORA 1PXLA 4BI0A 4AQKA 3NUAA 2QG5A 4DFLA 3DLZA 2YDIA 3ORLA 2E9OA 4A07A 2J9MA 5AP5A 4J53A 5C4LA 3MJ2A 5BYYA 3GXLA 4JRVA 3W0RA 4BJJA 4EOJA 1NT2A 2PE2A 4YZ9A 4IAZA 1LEWA 5CEPA 3QLGA 3FPQA 4MBLA 3FXWA 4OR5A 4DH7A 3SXRA 1P14A 2Y7JA 3LM0A 5ACBC 4EH3A 5B2LA 3DNDA 4XG8A 4KKHA 1UV5A 5ETIA 5AADA 3G51A 3LFDA 2IG7A 3R1SA 3AKLA 1A06A 4FVQA 2XNOA 3D14A 3RTPA 4D4RA 4L8MA 4UY9A 3W55A 3EHAA 2EXMA 3GC9A 5AUUA 1K3AA 3NDMA 4RA5A 4FG9A 5M4CA 1WBTA 1XQZA 3DBCA 5EM6A 3NYOA 3E3BX 5CXHA 1PMUA 2OK1A 4AW0A 4EYMA 3ET7A 3QUDA 3BV3A 5EDRA 3RAHA 4EK6A 4DEHA 4O7WA 2XCHA 4HCUA 3W16A 2C1BA 2W1DA 2ZV9A 5HBJA 2XK6A 2OFVA 5LOHA 4I24A 3HUBA 3OXTA 3PJ3A 5BVDA 2R5TA 3AC3A 3C50A 3WF6A 2JBOA 3GNIB 5K9IA 3FLZA 3HECA 2PZ5A 5DT3A 3KKVA 2BMCA 2HELA 3PP0A 3NUYA 5IDNA 5J95A 2HAKA 5JFXA 4CVAA 4QPSA 5IA5A 3BL9A 3BHHA 4PL5A 2XA4A 3VJOA 3KRLA 4P90A 4IAYA 4NTSA 2VTHA 1ZY5A 3V5TA 3LFAA 3NMUF 3QQFA 5EHOA 2QOKA 3LCDA 5DT0A 1W98A 3MB7A 4WNKA 2XNEA 4FKJA 4B0GA 4EI4A 4FZFB 4BCIA 3ZDIA 5BPYA 1VR2A 4K77A 4APPA 1B39A 2GS6A 5BVOA 2UZBA 3VS1A 5M4IA 4TWCA 3AC8A 1ZMWA 2O2UA 2YWVA 3HMMA 4DEIA 3ORMA 2AC3A 2PE0A 5DEWA 5E8YA 4E26A 3ZMMA 1OL6A 4ZTLA 1IRKA 3MY5A 3OWKA 3SVVA 3TCPA 5LVNA 4I92A 4BYJA 4TYIA 3WF7A 3NIEA 4YBKA 4YZCA 2CKEA 4XP2A 4EK3A 3FAAA 3EN9A 4JG6A 4QMYA 4EK5A 2YCQA 2YWPA 4Z55A 1W84A 4YHFA 4C3PA 4DH5A 5JKGA 3POOA 2J50A 1WBOA 1UU9A 2GHMA 2YCFA 3OHTA 4RFMA 4C2WA 5D41A 1BI7A 2Z8CA 3HMOA 3FMKA 3UOHA 3BBTB 3TV7A 4FV7A 3ID6C 5J9LA 2X1NA 2X9FA 3UQFA 4XMOA 4X7QA 4MXXA 4DGMA 3DKCA 3Q5ZA 4FJVA 2PZRA 4EH9A 4CZTA 2EVAA 3KVWA 2WMBA 3AD6A 2WQEA 2VV9A 3COIA 2G1TA 4FKIA 4WRSA 3WZDA 2HY0A 1OGUA 1XMMA 3RPYA 4XBUA 3SXFA 4NCTC 2BRMA 5BYZA 3CCNA 5CU3A 2HK5A 4RIWB 5HHWA 4CLJA 3AOXA 4RFZA 3GCSA 1VEBA 1O6KA 2CN8A 5GJDA 1DAWA 4FSRA 4RC3A 5IDPA 3KY2A 1DM2A 1JAMA 4FKVA 3OXIA 3W2SA 3R9OA 3W8LA 4F1MA 1XJDA 1R39A 3A2CA 4MD7E 4MXAA 5DI1A 3K3IA 3OCBA 3QAME 3DPKA 2FB8A 3MBLA 3BI6A 4EKLA 1SNUA 2R64A 1WBPA 4NKAA 1R0EA 2JKKA 4ENXA 3F3UA 3UZTA 3LFCA 3AC2A 4L6QA 4FTMA 5BUIA 5HTCA 4FEWA 3GC0A 5KO1A 4R3PA 3WE4A 3UOJA 4YTCA 5DBXA 3LJ2A 4QYGA 3VS3A 3ENHA 3DBFA 3LIJA 3NCZA 2WIPA 2QLQA 4PRJA 4O22A 2Z7LA 3PJ1A 5DNRA 1MUOA 3AT2A 5HIDA 2GHLA 2GMXA 1JNKA 1ATPE 1ZMVA 3PA4A 3ZRKA 4RJ7A 3MIAA 3LQ5A 1ZZ2A 2VWIA 2R3RA 1R0PA 4IAFA 3ZLSA 4WG4A 4FYOA 2VUWA 5H2UA 1LUFA 2GQRA 1S9JA 4FKRA 3W18A 5KMIA 4LMUA 5D1JA 3DK7A 4GU6A 4J99A 5HO8A 4C0TA 1XR1A 2PE1A 3AT3A 4M15A 4WOVA 3BWFA 3RWQA 3G6GA 2C3JA 3UOLA 3LFBA 1Q8UA 4GMYA 2JDVA 3T3UA 2B1PA 4W4WA 2OJIA 4TYHA 3V04A 3UC4A 1O9UA 3EN7A 4UEUA 3PE1A 5A4TA 1MRVA 2HENA 3EQDA 4YO4A 4R6VA 3A4OX 5A6NA 3RM6A 2C30A 3FMLA 2YM4A 3FMEA 4O96A 3FEGA 1Y57A 4AOTA 2ZMCA 2V55A 3P5KA 5IG1A 5HLPA 5AA8A 4RIXB 4CT1A 5DHJA 2EB3A 5ANKA 1TVOA 2X81A 4CFUA 4M0ZA 4RVLA 2ITXA 4QMWA 4C38A 4DTBA 4RRVA 3NUSA 2BVAA 5IA4A 5FRIA 4EJ7A 2IVTA 5EOLA 4GG5A 3VUMA 4Z7HA 1H07A 4XS2A 5LMKA 4AGCA 1WVXA 3R22A 4KIPA 1OIRA 4P5ZA 2OKRA 3LFNA 4B6LA 4M7IA 4KBCA 2JEDA 4C7TA 3EQRA 3B8QA 2OGVA 4BI2A 1Q24A 5C1QB 2XJ1A 5HO7A 2IO6A 2B4SB 4EONA 2GNJA 4HPTE 3G5DA 3H10A 3QKKA 4KWPA 3PIYA 3R7EA 4CRSA 4DDIA 3VS6A 5CASA 1H1SA 1JSVA 2HXLA 4U5JA 4XX9A 3UJGA 4YJPA 3UDBA 5CEOA 2A2AA 4MUQA 2OSCA 3PSDA 3HMNA 4E1ZA 4FV9A 4YTFA 3F5GA 4IX6A 4DGGA 2YM8A 1E1XA 2XANA 4JDHA 5C8MA 4FSZA 2UZOA 5E4HA 3AC5A 3VHEA 4U9AA 4C4GA 3IGOA 3LCTA 4YGAA 3RAKA 4M0YA 3EWHA 1R3CA 1VZOA 3TV4A 4E5AX 4C34A 4F6UA 3DAEA 2A27A 4AA4A 5M4FA 4PMSA 5L6PA 4YPDA 4H1MA 3RNIA 1J1CA 2C47A 2UZDA 5E91A 3ORNA 4E4LA 3F66A 5B2KA 3E93A 4FKTA 4ITHA 4ZSGA 4A4LA 1W82A 5CVHA 2PVYA 2CMWA 3F5PA 3OCTA 2W1CA 3OC1A 2JAVA 4U3ZA 4BCKA 2W7XA 1PYXA 4MQ2A 4AT5A 3FC1X 4L3LA 3W2CA 2C6DA 5JZJA 3CPBA 1URWA 4E73A 3F2AA 3MY0A 4GSBA 4AAAA 5BMMA 4O0RA 4NJDA 1P2AA 2YISA 3PXFA 5CZHA 3EFKA 3QUPA 3FZPA 2G2IA 5FEEA 3JY0A 5TT7A 4CD0A 5IU2A 4D9TA 4AZFA 3OW4A 3OOGA 2XK8A 2XUUA 3DAKA 2OFUA 2VWYA 4JRNA 1G8JA 4K33A 4XRLA 5KMJA 1NXKA 4M8TA 2XNMA 3BQCA 3H9FA 4OTDA 2Y8OA 4M69B 4ALUA 3ZHPC 5JQ5A 1PXNA 3WILA 2NPQA 3R1NA 4U94A 1M2RA 5AX3A 5LQFA 3UC3A 4R5YA 4G31A 4TWOA 4IFGA 3CJFA 4OGRA 1FVTA 2PVJA 3FL5A 4N57A 2W5HA 1U5RA 3GFEA 3HEGA 1V0PA 2IW6A 4JX7A 1GOLA 4O6EA 4PNIA 3Q5IA 1H08A 4O2PA 3NUXA 3OXZA 3L8PA 3FKOA 2HOGA 1LP4A 4XP0A 3U4WA 2V62A 2XF0A 3DDPA 4JIKA 2CN5A 4L42A 3PUPA 3GC7A 2X7GA 2ONLC 2YITA 5EDPA 4FNYA 3D7TB 3TJDA 3Q32A 2X7FA 2C6KA 3GU8A 4I94A 5AIKA 3KCFA 4YJVA 3V5WA 1PXJA 4I0TA 3BEAA 1Y8GA 5FTQA 3MTFA 2GQGA 3E7VA 3U87A 2VO7A 4E20A 4IVDA 4EH4A 5JFSA 4IE9A 3WOWA 3FLQA 5A14A 5CU0A 3KL8A 5AM6A 1YVJA 2OXDA 3MWUA 3FI3A 1JQHA 5D10A 1VYWA 4BHNA 1JKTA 3R8VA 4IZYA 4AXFA 3MGYA 4IANA 2XAOA 5CZIA 1XWSA 5IA3A 1LEZA 2C3KA 3LFQA 3OY1A 4BDGA 1XBCA 3TG1A 2VWBA 3U6HA 5ETAA 2H34A 3DJ6A 3BU3A 2FUMA 4X3JA 2IJMA 4DG2E 1V0BA 3W2PA 4F70A 3UO5A 5C8NA 4MXCA 4RZVA 4EHGA 4FUXA 2E9UA 2WMUA 4QMUA 4APCA 1Q97A 4FTAA 4H3PA 3KXGA 3WI6A 3P7AA 5GNKA 5J1WA 5HE2A 2BTSA 4W4YA 5HCYA 4TRLA 4RA4A 2OIDA 5L8JA 3R73A 4G3GA 4BKJA 4DBNA 5L6OA 3E63A 3FPMA 4C4FA 5KUPA 2VO0A 4XG4A 4MNEB 4IVBA 3QCSA 2PL0A 4M68A 5FDPA 3LLAA 5JN2A 2HYYA 4FA2A 2ZOQA 3IK3A 2VTNA 5TF9A 3R8LA 5IQDA 4RZWA 5LVOA 4YLLA 5A4EA 3QCXA 3MVMA 4PY1A 3W0QA 3NYXA 4O83A 4TTHB 3I81A 2O64A 4O0XA 4NFNA 5HVYA 4PTEA 3UBDA 5J9ZA 4FICA 4TW9A 4H3QA 3DXQA 3R7UA 1Q61A 3TNQB 4H1JA 4MXYA 4YSMA 5EI8A 1OPKA 4FTOA 3W32A 3LVPA 2XH5A 2W0JA 3NNXA 1J7LA 3LFEA 4M14A 1YQJA 3FYJX 3WIGA 4QP8A 2J0IA 4G3FA 4D0XA 5LVLA 3U6IA 2YHVA 4ANSA 1K9AA 3ZOSA 2H8HA 3ZSGA 1MQ4A 2BKKA 2CNQA 2WMAA 3R8PA 3RPRA 4DEAA 4C2VA 3R1QA 4CEGA 4RJ4A 3U55A 3FKLA 4E4MA 3BHYA 2CKOA 2QNJA 5HE1A 2QU5A 3BQRA 4M84A 4FVPA 5GIPE 3AMAA 3QQJA 5HESA 4I21A 4X2FA 1O6YA 4HYSA 4ZS4A 5IA0A 5FXSA 4NM7A 3GP0A 4CFNA 1M7NA 3HDNA 5CEQA 3NGAA 1OMWA 4MX9A 3R7YA 2PUPA 3R7VA 3TNPC 3F5XA 4L7SA 2WQOA 1Q4LA 2GNHA 2BAJA 4GU9A 4HGTA 1YI4A 4CFXA 3FLNC 4KNBA 5M53A 4Z9LA 3E7OA 2UV2A 2JAMA 2WTKB 3R6XA 4XEYA 4NU1A 5CSVA 5F1ZA 3IECA 4UALA 1FGKA 5IEXA 2C68A 5DN3A 4JAIA 3LXNA 5DYJA 4YO6A 2X8IA 5JFWA 1BMKA 1KE5A 1UWHA 4GT5A 5FEQA 1Q99A 2PVNA 3QYWA 5IF1A 3TM0A 2ZVAA 3PRFA 4G5PA 3CTHA 3ALOA 3KK9A 5G1XA 2XK9A 3C13A 2ITTA 4BIDA 5LWNA 4FT3A 3UNZA 3THBA 4G3EA 3PLAE 4GYGA 4FSYA 5DRDA 3GT8A 4BZOA 3NFFB 4LL0A 1J7UA 2OU7A 2WMXA 2QKRA 3F82A 2UZTA 3SW7A 2XKEA 2XRUA 2Z7SA 3EZRA 4O86A 4Q5EA 2QO2A 4FKSA 4BDKA 5IUGA 2CHLA 3FMDA 5CS6A 2QOFA 3U51A 3TUCA 1QMZA 3HA6A 4S32A 3NAXA 4X2JA 1URCA 4ZSJA 4BZNA 3W10A 2G9XA 3PJCA 4WG5A 4FTLA 4ASEA 4OTQA 3VUKA 3L1SA 1FMKA 4A9SA 3IG7A 4DH3A 5I9YA 3CXWA 4UYNA 2CDZA 3P86A 3QQKA 4TYGA 4BCFA 4FTKA 4I5PA 4ORKA 4P7EA 4QMLA 4LOPA 5CSHA 2B9JA 3FWQA 4UZHA 3TKUA 4G6NA 3IPHA 1HCLA 1J7IA 4AWIA 5CANA 2ITVA 4CZUA 4L53A 5E8XA 3UP2A 5HZNA 4FTNA 4XJ0A 3LCSA 3QALE 3PG1A 4ITJA 5M06A 4JL9A 4YPSA 3D5VA 4I5CA 3LJ1A 3Q9XA 5K4JA 2WFYA 3N4VA 1H1PA 1VYZA 4WUAA 2VTIA 3AXWA 5CVFA 3S95A 3W0SA 4Q2AA 2YDKA 3ZFYA 3G0FA 3QZHA 3L8SA 2JFLA 4G34A 5H3QA 2X2KA 4WIHA 4EWQA 3KULA 4G6LA 5D7AA 4F1OA 4FK3A 3VO3A 3TXOA 3QTSA 4Q9ZA 2YM7A 5AP2A 3GCVA 4W8DA 5HNGA 3KMMA 3D4QA 3ZYAA 3O17A 2WTIA 5AV0A 4DFZE 3BYVA 4LV8A 5B0XA 4L46A 2ZB0A 4ZMFA 2H9VA 2YIQA 3DCVA 2H96A 3A7FA 2OBJA 1DI9A 4OTWA 3ZFMA 4QP6A 1ZYSA 2BRHA 2EB2A 1SVGA 3OS3A 3BLRA 3OT8A 1F0QA 2JIVA 2EXCX 3P7CA 2V5QA 4L45A 3GVUA 4WUNA 4RFYA 1SNXA 3A60A 4RPVA 5M57A 2XM9A 1YOLA 2HZ0A 3A7IA 2V22A 5JGBA 2FYSA 4AT4A 5EKOA 4QTAA 2XIZA 3AD4A 4R1VA 3LXLA 1YDSE 5BYLA 2OZAB 4ZZMA 1PHKA 3NRMA 2B55A 2VO6A 2DUVA 3KN6A 4L9IA 4YLJA 4FL3A 2C1AA 3F7WA 4A06A 4AN3A 1JLUE 4F7LA 4CKRA 4QTBA 4FIHA 2GCDA 2QO9A 4KBAA 5AP6A 4ZSLA 4X3FB 4CCBA 5AV1A 4RQVA 3QTZA 3COKA 3Q04A 4I41A 3MESA 5LMBA 4HGEA 1FVVA 1H27A 2IZRA 4NUSA 3QXOA 2R3MA 2OF4A 3BGQA 5JEBA 4CFWA 1MRUA 3LXKA 4R77A 2X2LA 4F4PA 5IPJA 3FMMA 5FBOA 4OTFA 5D11A 3RPSA 3BGZA 4PMMA 4YURA 5DR6A 2XP2A 1ZY4A 3NUUA 3QUEA 4FL1A 3V5PA 5LWMA 4O7YA 3COMA 4FKGA 5K5NA 3W0MA 4IWQA 1YXVA 4O27B 5CAPA 4AFJA 4D55A 5IH6A 1GIHA 3A4PA 4AGDA 4BYIA 1W83A 5IH5A 1FBNA 5L2SA 4I5HA 5EHYA 3QKMA 3RAIA 4ANQA 2G2FA 4U80A 4BCQA 2RFNA 4LL5A 2W99B 4HZRA 4QMTA 3DTWA 3ORZA 3SQQA 4BVUA 4D4SA 4IW0A 1SMHA 3Q96A 1P4OA 3TKHA 4DEGA 2IVUA 2W5AA 4RMZA 4E4NA 5CU6A 4YTHA 2XBJA 3QHWA 1W8CA 5HTBA 1BKXA 5FDXA 4CKJA 3MW1A 4U44A 4XOYA 3B2TA 3DB6A 3CSVA 3CGOA 4K1BA 3ZBFA 4BICA 2VTJA 3EL8A 4QOXA 4QTDA 4EZ7A 3Q9YA 3PZHA 2VU3A 4NH1A 1JWHA 4LGHA 2J51A 4IWOA 4QMXA 3R9NA 3PVGA 2QR8A 1IAJA 3AGLA 5JZNA 1AD5A 3IONA 2LAVA 5L2IA 3L9PA 3VBXA 4UV0A 4V0GB 3R7OA 3MH3A 3RINA 3KA0A 3O8TA 3VBWA 4C61A 2UW9A 3ROCA 1ZMUA 2YFXA 1H28A 2XNNA 3JVRA 1XHAA 4IAIA 5TKDA 5HD7A 4X2KA 4EKKA 1UNHA 3MY1A 1V1KA 4DFYA 1Y6BA 4PDYA 3HV4A 2WXVA 4S2ZA 3H9OA 5EYKA 4ZTQA 1OPJA 4QP2A 4R1YA 5IMXA 5HX8A 4GJ2A 3GU4A 5FEDA 4JAJA 4GUEA 3UVPA 3C4XA 2CKPA 3MI9A 3WF8A 2GNGA 4O91A 1XBAA 1YI3A 4FTIA 1OB3A 1GAGA 2C6TA 2A1AB 4G1WA 4FZ7A 1XH5A 3DB8A 3W33A 1FQ1B 3DXPA 2IW8A 2VTPA 3E8NA 1MQBA 3VRZA 3MVJA 2VWVA 4DHJA 3S1HA 4FIJA 2E9PA 3CQEA 4J96A 2P2HA 3BHUA 3F3VA 5EQYA 2FSOX 3ULZA 4F08A 4BRXA 2DQ7X 3DBDA 5KKRC 4FBXA 3UO4A 3PIZA 3F61A 4KABA 4D28A 4CG8A 4K6ZA 4TXCA 3L8XA 4ZSEA 5AAEA 2X39A 3BHVA 4J71A 1CKPA 3ZLXA 4QNYA 4XLVA 3C9WA 3OFMA 4FODA 5CXZA 4JX3A 4LV5A 2PUNA 2J90A 3LCKA 4KRDA 4QMSA 3RAWA 3VF8A 2ERKA 2GFSA 2PY3A 2ZV2A 2LGCA 4FV5A 4WO5A 3NWWA 3OROA 2BRGA 3TZ8A 4EJNA 2WO6A 3QD0A 4USFA 3GOKA 1ST4A 3FQEA 4FZDB 4LM5A 2AYPA 3A99A 3BBWA 3UIMA 4F9CA 4CQEA 4D4VA 5HU9A 2GS2A 3BLQA 2C69A 2JBPA 1M17A 5EK7A 2WQNA 1PMEA 4FV4A 4K18A 4KBKA 3R9HA 3Q2JA 3QQHA 1B38A 4XYFA 4R78A 2Z2WA 3LLTA 2RKUA 4FIGA 5KZIA 5KE0A 3AG9A 5T68A 1PMVA 4YSJA 4R5SA 5AP7A 1TQPA 3RVGA 3RK5A 4ZSAA 4RC2A 4IEBA 2WEIA 4FIIA 5DA3A 3LFFA 4WRGA 3HAVA 2YIYA 3FKNA 4NTTA 3W0NA 4MBJA 5HX6A 3HDMA 4NM5A 2J0LA 5D7VA 2HWOA 2WMSA 2XIXA 3IO7A 4USDA 4EK4A 5HG9A 4TT7A 1PMNA 2PZYA 2XVDA 3BYMA 5JFVA 3ZUTA 3HRCA 5M55A 4DF3A 3HUCA 3FLSA 3C0HA 1CDKA 2OIBA 3U9CA 1BI8A 4GH2A 3CS9A 4AXEA 1H0WA 2VNYA 2XCKA 5IUIA 4F1TA 4I4FA 4FSUA 2VTLA 3RHKA 3EOCA 3KRWA 4MK0A 5AMNA 4J8MA 4RVTA 1FOTA 1U54A 1S9IA 2PUIA 4PP9A 5ANEA 1O6LA 4AG8A 3SAYA 3ZXTA 2ZFYA 4YJOA 5M51A 1FPUA 3IGGA 5E90A 5EW3A 4BDDA 2CGXA 2C6LA 4EOOA 3BEGA 3DV3A 5E8TA 2PMNX 4FOCA 3AMBA 2QQ7A 3MB6A 4MTAA 3QQGA 3SKCA 4B4LA 4EUUA 4DEBA 5AWMA 2Y0AA 3PRIA 4DT9A 1OM1A 1RW8A 2ZM4A 4USEA 4YLKA 3ZC6A 3UVRA 5E9EA 2X4ZA 3TWJA 5C9CA 4BCNA 4EOLA 2DWBA 3U54A 4GS6A 4EQCA 4AZSA 4TWNA 2C0OA 1FMOE 3Q6UA 3RK9A 5C03A 2Z7QA 2BALA 1YXTA 4ITIA 3UGCA 1Z57A 2R3HA 3LQ3A 2B53A 4EH2A 2WEVA 4IWPA 2UW5A 5CT7A 5AUXA 4YC6A 4BJJB 4E7WA 4FV2A 4RWJA 3S2PA 4EZ5A 4FSWA 3VW6A 4WT6A 3KRRA 3HL7A 4DTAA 4OUCA 3FMJA 4EOIA 3LPBA 3TUBA 1OKWA 3UQCA 3HAMA 4KINA 4EQUA 4ONAA 3FE3A 3QF9A 2HW7A 4BCOA 4F9BA 4KIOA 1WVYA 4BB4A 5KX8A 3FZTA 4W4VA 2F9GA 2VWUA 5L3AA 4YZNA 4QP4A 1UU3A 4J7BA 4F78A 4N6ZA 2O63A 2Y4PA 3CKWA 4NT4A 4RVMA 4UXLA 5EOBA 3TNHA 4EHZA 4ZZOA 5J7HA 3F5UA 2GHGA 5EM5A 3VS5A 2ETKA 3CR0A 4OTRA 3UNJA 2VTAA 2WPAA 2XAMA 2VTQA 2OO8X 3GQIA 4MD9E 5ANDA 4O7LA 5GHVA 1WBWA 4C3RA 4XG2A 3MH2A 2UZWE 1GIJA 3MN3A 3Q3BA 3BU5A 4NW6A 4PX6A 2P3GX 1IASA 2QLUA 1M14A 3Q2MA 4ZY6A 4YNOA 2CGVA 3UMXA 1Z9XA 4RX5A 5FP6A 4AGUA 3QTRA 5ANIA 4O7OA 4I0RA 2CCHA 4O21A 3EQGA 3ZXZA 2EUFB 2P55A 3O8UA 4FSMA 4F9AA 4M97A 4L00A 5DLSA 4GIIA 3QTXA 5BV3A 5BVNA 5EKNA 4BC6A 1H1RA 2RFSA 3GCPA 3PWDA 3IW4A 2FSTX 4IZAA 4N0SA 4OW8A 4XP3A 3CC6A 4YJNA 5CU2A 4X2NA 5D9HA 3V5JA 3LXPA 3BE9A 2ZM3A 1KV1A 3VS4A 3Q9WA 5DR2A 4CTBA 5I5ZA 3A62A 2BHEA 5KNJA 2YIRA 4IX4A 4JBQA 1H26A 4EC9A 1IAHA 3G90X 4MWIA 4QMPA 3DZOA 2VTRA 3UYSA 3BIZA 4FEVA 4YHTA 4NCTA 2HZIA 3HRFA 4TL0A 4BTJA 4HOKA 1KE7A 3DQXA 4FT9A 1QPDA 3W2QA 5DT4A 4LQMA 3Q4ZA 1ND4A 2ITUA 3BU6A 3E87A 3PDTA 3PSBA 2J0MB 4D5KA 4FVRA 4F0IA 3PPKA 3QD3A 3EFLA 3OY3A 4O6LA 3OT3A 2WKMA 3R8ZA 4WG3A 3NIZA 2F7EE 2ZV7A 3CPCA 3R01A 2VTSA 3ORIA 5CALA 4JOAA 5BVEA 2F49A 3NX8A 3PE2A 5CAVA 2C5YA 2QI8A 2PZIA 5M09A 2PZPA 3LQ8A 3ZU7A 3AQVA 5JH6A 4EL9A 4M3QA 3FL4A 4G9CA 4P5QA 4DHIB 1UNGA 3D94A 4F0FA 4JDJA 3QL8A 4G6OA 2Z7RA 3PYYA 4HVGA 3TZ9A 5AV3A 3PVBA 3PY0A 2VTMA 2WMRA 4I6QA 4JBVA 4UWBA 3UDTA 3EQFA 1KE9A 2XS0A 3SHEA 5L2WA 2R3QA 4PMTA 4RIYA 1A9UA 5HIBA 4D1SA 4HW7A 4U45A 3W0OA 3P4KA 3RPOA 4XV3A 4DN5A 5E8WA 4ZIMA 1H4LA 4IACA 4YJUA 1MP8A 3RKBA 1ERKA 3TTJA 4XG3A 5J5SA 3UDSA 4FSQA 5I9ZA 4NWMA 5M44A 4FKLA 1IA9A 5HVJA 1BX6A 2SRCA 2WMTA 4MD8E 2WZJA 2XARA 2R3NA 3SXSA 4EH5A 4FIEA 4GK2A 4CMOA 2JFMA 1WBVA 4GFOA 4GV1A 3GQLA 2X6DA 3QTWA 2PSQA 4YZMA 5C8KA 2JKQA 4GFGA 2PVMA 5AUTA 1YXUA 4O7NA 4CSVA 5CEKA 3C5UA 3DQWA 3DDQA 4FIFA 4RJ6A 3I79A 3I4BA 4O84A 3VUHA 3R04A 3VBYA 4I22A 3CD3A 3QTQA 2ZV8A 2Q0NA 5B7VA 2WTKC 3R02A 2PULA 4ANLA 5M56A 3NUNA 2WU6A 4MXOA 3JXWA 4WBOA 4FNWA 3NAYA 2HZNA 3M42A 5LMAA 2ITQA 1GZKA 5CVGA 4PP7A 3RGFA 2QU6A 3Q4UA 2XYUA 4GFMA 4DDGA 2NRUA 4TYHB 4YMJA 4CCUA 4WBBB 1OZ1A 4MF1A 5EW9A 3UOKA 3V01A 2GDOA 1CKIA 2UZUE 3DKOA 3HX4A 5GJFA 3U9NA 4A9UA 2CJMA 4OT6A 3LZBA 4DG3E 3O96A 4X6RA 1ZYDA 3RI1A 2VGOA 2R3OA 3E8EA 5DWRA 4O7PA 3KXHA 4FKQA 4L3PA 4OBOA 4PUZA 3DOGA 5EFQA 2VWXA 4DEDA 4UWYA 4YR8A 3OTVA 4IZ5A 2W1EA 2W9ZB 1UVRA 4RIOA 3TT0A 1PY5A 3ZRMA 2P2IA 5FTGA 3G9LX 1PJKA 4ZP5A 2J4ZA 3VS7A 1DS5A 3PXYA 1VLRA 5DE2A 2FA2A 1JVPP 2JDSA 3F2NA 2XBAA 4DC2A 4ZS0A 2BDJA 2W4KA 2WMQA 4IM0A 3WF9A 2OJFE 3LKMA 5EYDA 2ITZA 4EOSA 2WIHA 4GJ3A 2IVSA 2PU8A 3P23A 3BYOA 5AV2A 2RG6A 4IM2A 3MFSA 4LRJA 2WD1A 3JS2A 5CI7A 4JQ7A 5HG7A 3ITZA 1REKA 4X21A 4J1RA 4FV0A 2CGUA 4F09A 3BYSA 3Q52A 4NW5A 1Q41A 3OVVA 3PY1A 1L8TA 3KN5A 3QC4A 4LDTA 3SX9A 3CQUA 3ORPA 4QMQA 4EH7A 1HOWA 4HCTA 1QCFA 2Q83A 1MRYA 5HG8A 4FE2A 3D5UA 4M67A 3R83A 4G3DA 2AC5A 2PTKA 5HCXA 3QRIA 4QYYA 3UVQA 3GEQA 5L8KA 5DEYA 4LYNA 4PWNA 2ZMDA 2BRNA 3ZONA 2HIWA 4BDCA 5HCZA 4WNOA 4QP1A 1LPUA 1QPJA 4FR4A 1Q62A 2BZHB 2OXXA 4IQ6A 4JG7A 1PKDA 3OWPA 4XOZA 2ONLA 4RJ3A 3FY0A 4XV9A 2XM8A 5AAFA 3OUKA 2JKOA 3R63A 1TQMA 2XRWA 2ITWA 5E7RA 3HLLA 4ZOGA 4PTCA 2R3GA 3DS6A 4K9YA 3QC9A 3IW8A 5IQGA 5FXQA 2O0UA 2JC6A 2BFXA 2YCSA 2FSMX 3FHIA 3F9NA 3ULIA 3QD4A 4TYJA 5BX0A 1F3MC 2OJJA 5AM7A 4PF4A 4U98A 2CNVA 3LJ0A 3IOKA 3OMVA 4E4XA 5FD2A 1KOBA 4I6HA 4IJ9A 5H9BA 5CQWA 2NRYA 4X3FC 1CM8A