3SGDH

Crystal structure of the mouse mab 17.2
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
217
Chain Sequence
b'EVQLEESGGRLVQPKGSLKLSCAASGFSFNTNAMNWVRQAPGKGLEWVARIRSKINNYSTYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVRGTTYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light Chain
publication title Crystal structure of the complex mAb 17.2 and the C-terminal region of Trypanosoma cruzi P2 Beta protein: implications in cross-reactivity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 44
structure length 217
sequence length 217
chains with identical sequence J
ec nomenclature
pdb deposition date 2011-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgdH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgdH01
1PX4A 3ARGD 1G7LB 2RCSL 2JF1A 5D7JA 2DJSA 3HRPA 5B4MD 2RGSA 5I6XB 3GSUA 4I2XE 2J12B 3KYOA 1MY7A 1SY6H 2R2BB 4MWFA 4QXTA 4ODWB 5E08H 2F5BL 5GRVL 1UKTA 2CLRA 4AMKL 2R8SH 3FN0L 3CAFA 1L7IL 2YZ1A 1QR1B 4U1GB 4M48L 4YHML 4JRXE 3VDCA 5GJSL 2P7TA 1GC1L 3GMRA 4KJYB 4WCYH 2XWTB 1HYRC 4K7PY 3TV3H 1XCTA 3PQYD 3SPVA 1ZLVH 1IJ9A 3GSXA 2MJWA 1AC6A 1SM3L 1I1YB 3BEVB 4OLXL 3VFMB 1JYXA 4J12A 5DD3L 4KC3B 4W68A 1IGIH 4ODUB 1C8PA 2VL5B 3QJHA 4J4PA 5C0EB 5KVEH 5FA4A 3IKKA 3T0EC 4RISH 1U3HB 2VH5H 4ZS6C 3RWEB 1PAMA 1S7QB 3NCYS 3O3BA 4MA8H 3PWLA 2FD6L 1QEWB 4HD9A 4P5MA 5EBMB 1NBQA 2P8PA 4DVRL 3ZO0A 2AXJA 3ZDZE 3EFFA 2UUDK 4PJ5B 1ZSDB 5CBEA 4KHTH 5FM5M 3I9GL 5DMYA 5KG9A 4XPFH 1XH3B 3NCFB 2NY4B 1J18A 4NQDA 3JVGC 3T2NL 3CX2A 3S5LB 3IU3A 1JF5A 2LQRA 1KCVL 4QY8A 1M7XA 2DKSA 3OG6B 1WK0A 3QPXL 2WQRA 5D72H 3LCYA 3UZVB 4PG9A 1HE7A 4XTRD 5ID1A 2AXGA 3KPQB 2HFGH 2BVPB 2DS4A 4EI5D 5CHNB 5LCVL 5I18L 2VLKD 4BSWA 3JBG7 4GLRH 3IXTB 1R5IB 5IQ9B 3U36A 4XNQA 2LTQC 3L3IB 5L2JB 4D0BA 3T4YA 4WUUD 5I8OH 1OQXA 1FZKA 3IDGB 1DQQA 4HIIA 3QXUA 1YEIH 4XC1H 1ZVYA 4Q0XL 4RWYH 5HHPB 1JHTA 3RAJL 2DQUL 3W0WE 1WWWX 1R5WB 5FB8B 3WNLA 4F9PC 1FNHA 1I3RB 4M62H 3H2WA 3MO1B 4NO0A 3PHOA 4FQ1L 4GRLC 2EO9A 2DYPB 3MJ7A 3L5XL 3P0GB 5I2IB 1XF2A 1RZJC 5H35B 2A77H 3SO5A 1NGWB 3PDOB 1T0MA 2AK4E 4PBXA 4OAWA 2C3GA 3G6JF 4GG6A 2CLVB 3WE6A 1G7QB 4I48B 3TM6A 2OL3H 4UTBH 3HMWL 3S88H 1XZ0B 2P4AB 3TO4C 3IS1X 4OB5L 3DETD 2CUIA 1SJHA 4LLDB 3U7YL 5C2BL 1EXUA 2DI8A 3K4DA 3F7QA 1FNSH 4I0PD 2YPLA 3FQUA 4MD4A 4ZAKD 1DUZB 2F58L 4BJLA 1O7SA 4J3OC 4MJ5B 4OLWH 2R2EA 3IFNL 4D9QD 4HPYL 1NFDA 3PWVB 3QH3A 3IDXH 4YNYB 1ES0B 5FA3A 4OZFA 5F7YC 4NDMA 4PJ9A 3BD3A 3BHBA 5D4QA 5EIIA 8FABA 4GUPB 4YUEL 4LHQB 2IAMB 2OYPA 4F33A 1U8IB 4UMGA 4YGAB 5D1XD 1XEDA 4RMSA 1G7PB 3FMGL 3MV9D 4WFHD 1Q0XH 5AZ2H 3D3VE 3OJ2C 5A1AA 1IEAA 1W0WA 5SWSA 5K9QI 4PRBB 1RHHB 4ZUWA 4U2ZA 3DIFA 3MCKB 5JPMB 4PJBA 4WGWB 1JL8A 3G5ZB 1W0VA 5K9OB 3I6GA 3VXRD 1AXTL 1BQUA 1YMMD 1MREH 1XR9A 1C08A 1QBML 1PX3A 1YEEL 3O11B 4NHUA 4X6EA 4J8RA 4HWBA 1J86A 2V2WB 1IBGH 3QQ9D 1FN4B 5GGUB 3D69B 1I1FB 3BN3B 3B8YA 4NJ9H 5SV3A 1T7WA 1Z0MA 3KPNB 2C1OB 4Y5VB 2GJZB 4TYUA 2ZG2A 4X4YA 5MHSE 1K4DB 1BWWA 1FNLA 3BP6A 5I15H 3ZE0E 5GGQL 3RIFF 2O5XH 3F6LA 2HH0L 1GOFA 4PRDA 4LGPB 1Z6JT 4XCNA 2FEEL 4HUUB 3FFDB 4ZG1A 3HRZB 3JZ7A 4XBEL 3DVIA 4FNLL 4MMZC 1BZ9B 5CJQH 3LKOB 4GJTB 4APQC 4HH9B 1CD9B 4HJ0D 4JCMA 2X9YA 4AJ0A 5ERWB 5JORA 4ACPA 5I8KL 4BH8B 1MCOH 1CICC 1OGAA 1S7XA 5FYKU 1AKJB 1U8PA 4PV8A 4PJXE 1II4E 3F7YA 2ARJA 2DD8H 2OXGA 4JKLA 5SX5K 2XFXA 3JV6B 4OTXH 4LNRB 5CZXC 4Y2DA 2DQGH 3NCCB 5E94B 1LWRA 1JMXA 1J0ZA 4KQ3H 2VAAB 1EV2E 2DM7A 2QL1A 5CUSL 2QADD 3V4PL 4GW4B 1ZHBB 3LKQB 4LHUG 3CZFB 4U1KB 5ESAA 2Z93A 1YEDB 1YECH 2FX7L 1QTYT 5EBWB 1GZPA 2MQ3A 1JHKH 1JI1A 1BQLL 1F4YL 5E2VH 3T3ME 2UZYB 5I1GH 4QT5A 4RAHA 5EN2A 3DROA 5I1KH 1K8IA 4PS4L 1BJ1J 2V2XB 4RAVA 4RFNC 3V7AE 2DTMH 2YMXL 1KG0A 4DAGL 4PJHA 2VR4A 4HWBH 3HHRB 1XF3B 5INCA 5HDQL 5K59F 5JW4M 2HFFA 4D9RE 1QSFB 2IGFH 4N0FB 4YPGB 3MBEA 4PJ8B 2X70B 1CFVL 1XFPA 3GIVB 1LEGB 1LO5B 5DJ6A 1IQDA 1I8IB 4MAYD 4Y16C 2IFFH 4JFXA 1F3RB 1Q9OB 3O2VL 5CFHA 4BKLA 4OFYD 4G6KH 1KN4H 4ENEC 2VERN 4O5LL 5L8JB 2H26B 4L3EB 2NY2B 1E27A 3LRSA 4HMEA 1HKLH 2G5BA 4FMKA 5IIEB 2QHRH 2NX5B 2HVJB 2ENSA 3ZTNH 3VE0B 1VENA 1IARB 2PF6A 5LKNA 1JYNA 3UDWA 3IDNB 1P6AB 4UTAL 3C9NB 3MLYH 1E0OB 5HI5D 3P4NA 3MRCA 4PRNB 5E99H 5DMIL 4CW1A 4EVNB 1MNUL 1RZFL 4NM4H 1RZ8A 4L3CB 3D9AL 4XP4H 1ZT4B 3MUZ1 3O8XC 4X6BB 3CFBB 3UO1L 5FFLA 5ANMA 4K7FB 1MCDA 1S7UB 1ADQA 2BY0A 2D7OA 1BAFH 2BRQA 2NY5L 3PGFH 4N0UA 1AGCA 1CS6A 2HJKA 1KELL 4NO3B 3RKDC 4D3CL 4FN0A 3EOAA 1EVUA 2DKMA 3LSOA 4FFZL 9CGTA 1Z2KA 1S7RB 3UTQA 3S98A 1WWAX 1FZOA 2X4RB 1KCUL 3AC0A 1MPAL 3RVXD 5HYIA 1S9KC 4ZTOL 3MUGB 2J1KA 1YYLL 3GUTA 1CZ8L 3CVHL 1ZANL 5D9SA 4LVHC 2VMFA 1MCPL 3PQYE 2EE2A 3S37X 3VA2C 5FO8B 1AXSB 3W9EA 3NFSL 2NW2A 1KXTB 4GMTL 4XP5L 1KOAA 3ARFA 2XTJE 3O4LB 4H20H 4JR9H 5ICYA 5LVEA 5TE6L 1JF1A 3QHZL 4OSUL 1KLUA 3VFPA 2XA8H 5C0CE 4NFDA 4QTHB 2GCYA 3M17A 4NT6A 1FHGA 5E2TL 1OTTC 1EHNA 1HZHH 1V7NH 1RIHH 2ZUYA 5B39G 4XMLH 1Q9LA 4DQOH 1KB5A 4D0DB 4KFZC 3JTTA 1Z5LA 4QRPD 5HJ3B 6CGTA 2BOCA 3HI6L 1T66D 5JOPE 3NFPA 5CLWA 3K7UA 1VFBB 2OSLA 3VFGL 1SEBA 4M7KH 3QR2A 4G7YH 1CDGA 2NR6D 2WWKO 2VXUL 4YDLC 5BV7H 1S7VA 3JTSA 4NN7B 3VI3F 4Q74A 1RVFH 4G9FA 1N4XH 5HD8D 5LJYH 3MGAA 4ZUTA 3SGKA 2MOVA 3LKNB 4OFPA 1ADQH 2OR7A 4OI7A 4PJHF 5C0FA 1MF2H 3NPZB 3B5GA 4LPYA 3H9SB 4KKLD 1UENA 3GSVB 5B38A 1OM3H 1A5FH 1JZ4A 4YHPB 5CD3B 3T2QA 4JO1H 3RWIB 4HUWB 5TDNA 2VXTH 1KSRA 4RZCA 2R1YA 3EYOB 4GQPH 3FO9A 4PR5A 3DVGB 5HGBB 3OJDB 1QRNE 5F3HB 1OOAA 4J1UB 3BDBA 4Z0BH 5C0BE 1LP9A 5DZNA 1VFMA 3MNWA 4E42B 2CK0L 2D4FA 4QOKD 2RQ8A 5EFIB 3U4BL 1JK8B 3W5NA 4HWZA 4WFFD 4YX2L 4U1LA 3A67L 1NGXB 3OKOB 5CD5C 4BYHA 4PJIE 5MI0C 3RHWK 2Z31A 2AKRB 4HS6A 4KUZL 4RBPH 2A1WH 4PJAA 4NN6C 3DVNA 4GKZB 1T2QH 4HGWA 3DLQR 2HN7A 4U4BA 2P42B 4HMCA 3DX9A 2PW2B 3FO1B 3MLZL 4HDIA 4ONGL 2WUCL 2FHFA 5HPMB 5D70H 1KB5H 5IT2L 3B2VH 1R3IH 3QNZA 3OJVC 2BHYA 3ABZA 3IJHA 4Z7UE 4Z0XB 4NNYB 1B0GA 5EWIL 2R2HB 2VISA 5FV2A 3MOAH 2PYED 3DX8B 3KDMA 4WEBH 3B9VA 5C08D 4I18C 3VXUB 4E41A 1A6ZB 1ZA6B 1UZ6F 3NOIA 4ODVH 4K23H 2RFXB 1XGUA 1INEH 2EDTA 3D2UA 3EO0A 3QDGE 1RUKH 2H6PA 3UXFA 3ARDB 4FTVA 4BFIB 2OJEB 1AHWC 3GMMA 3PG2A 3SE8L 5E1HB 3VI4E 1T7XA 2PR4H 3WEXB 3U0TA 3T3PF 1F3DH 4F80A 2A2QT 3QEQA 4JFPB 1KJ2A 3OF6A 1UVQA 1P7KA 3L3JB 2VLRE 4ONFL 3N9GL 2OK0L 1EX0A 3O4OB 3BKJH 5K9QG 1IZKA 2ESVB 3CU1A 1M71A 3OKDA 1WF5A 1Q72L 4HV8B 1UXWA 4EOWH 4DUWA 4LCWA 2FSEB 3U48A 5I1JH 3L3OB 4MB3A 4ELMF 4FQXC 1M7DA 3LEYL 5EUOB 3OTTA 5C3LD 3NZHH 3RZCC 3HC0B 4P4RA 3DUSA 4MD5B 1FGNL 4WRLA 1XGRA 4NGHH 4L9DA 2W65B 1CL7L 3T0EA 5DVKA 1QKZH 2Q3AA 3ZKXB 1L7TL 4KKAC 2AVGA 4LLMB 3VMNA 5A2KH 5HYJD 3TYFB 4KAQH 2DM2A 1YJDH 5IMOA 4LVOC 5TQ0H 5F9AC 2P24B 3MRRB 4ZPVB 4PP2A 4U6XA 3MLXH 3SKJH 4WU5A 3I6KA 2ARJQ 3KS0J 3BZEA 2ICEA 2B1AH 2VSCA 5DO2C 2LVCA 3JVGA 3G6AB 4Z7VA 1BBDL 3LB6D 1UQSA 1BM3H 1A9EA 3HG1E 5DRNB 3VH8A 4HMDA 1LO4L 4LSUL 5EZJB 4OI9A 4PGDA 3D0VB 1LP9F 1SJVA 4YIQB 3FFCD 4AQOA 1CR9H 3V0VB 4BZ2H 5SWQA 1W72L 1Z3GH 4L1DA 3MFFB 1DANU 3CFCL 2FEDC 4WFED 3SJVD 5E00B 1KJ2H 4HJJL 4NFBA 2XZQH 2OR9L 2KH2B 1EO7A 1HIML 4Y4KC 3TIDA 3MLWH 3RVUD 1FAIL 3QP3A 5J11C 1J88A 3FCTB 1RV6X 3HZYA 4MNQE 4NPYB 3CSYA 1UCBL 4F9PA 3CK0H 4LQFL 3B9EA 4GRLA 2IANA 4HLZG 5DR5H 5CEZD 1JRHI 4OCYH 1AR2A 4H1LA 1FPTL 3BO8A 5EOTA 4CVZB 1Q1JH 3IFOB 5D7SL 1QLFB 1YPZE 4QRTA 2HRLA 1YN7A 4ZFOA 2XTJC 4HJGB 4N8CL 3MRLB 1EHAA 4WJ5B 3PQYB 5L8LB 3TO4A 1A6VH 4EDWH 2J4WL 4M1CD 4JO4L 3QNYA 2WINB 3MROB 3MOBH 4WU7B 4ORZC 3SQOH 3M1BA 1OTSC 4WTWA 2NY0D 4AT6B 1NJ9B 1AY1H 3Q6GL 5KSAC 1H15B 2NY7H 5GGVL 2W9EL 4LOUC 1JPTH 3AM8C 1QPXA 5KSBB 3IDIB 5HVHC 1AP2A 4EDXA 4NO5B 5ITFA 2YD4A 4HXBL 4X6DA 5F9WC 1BVLB 4GMSH 1NGZB 3QCVL 4MVBC 5IB1A 1GL4B 1LD9B 1UJ3B 2LVEA 1IE5A 3CPLB 4K3EL 3UTPD 5MEOB 3PNWA 2FLRT 2KUTA 1FFPA 3SY0A 2JJUA 1MY5A 4NYLA 5ALCH 4XHJC 5FYJH 4NP4H 3C5ZB 3DI3B 4JG0L 3WDJA 3JWOL 5DT1H 5MEND 3TCLB 4HKJB 4P23D 3BKCL 2W0FB 4P2RD 3S36L 3O3EA 5HTSA 5C92A 4EI5B 1FVCB 2ZUQC 5IEHA 3UZQA 4DK6A 2VLKB 1E28B 2Q8AL 4XPBH 5IB5B 5KVMC 1YMHB 4H1LH 5HGGS 1RZJH 3OR7A 5IMLA 4PJFE 5HHNB 4LAQL 3KYKH 4WUUB 2F8OA 3KPRD 5D7LD 3BH8A 1CGSL 1RJCA 4IRZL 3KHOA 1JPFA 4U05A 1EHXA 3IYLW 5J6HA 1U8JB 1U36A 3S3SA 3TESA 4X99B 4QRUA 1CGVA 5T1MB 2YEZA 3PP4H 4JANA 3BPOB 3MJGX 3CH1B 4CVXA 4P5KB 5DI8B 5ADPH 4NQSA 4WHTA 3QXTA 4NSKA 5C07E 3OR6B 5ALBL 3U1SL 1H3GA 5J9PB 3E8UL 2YPVL 2D4DA 4XCEA 2IH1B 5EC1B 4JY5L 4LK4A 5BS0E 2IALB 2YA1A 3HMXA 3HUJE 4EIGB 1RURH 1B4JH 4APQA 1IEHA 5I1HH 4POZD 2R69L 2H8PA 5I19L 1IM3A 4L8BB 1IC5H 1CICA 3VXNA 5F7UA 4WNQA 1MELA 3MRIA 4RGNC 3MLVL 4AQ1B 1MJUL 2P5WE 1EFXD 4I0PB 3V5DA 4ZAKB 5GS2D 3G08A 5JUEL 5F1NA 1ZVHA 2XPGA 2XYCA 4C56A 1NMBH 1KLGB 4PV9B 2KBGA 1N64H 3L3HB 5D93B 1FNGB 3I75B 4HZLA 2P1YA 3IVKA 1RU9L 1X5FA 5DRZB 4JRYE 1CF8H 5DD6B 4GOSA 4P3CL 5E9DA 3STLA 1U41A 4Q7DA 4TULL 4NWUH 3T0XA 4NQCE 5EO1A 1R24A 2VR9A 5DA0B 2X4SA 5F9JB 2YUXA 1YDPA 3BZ4A 5D1XB 1DLFL 3H9HA 2X89D 3MV9B 4LLQA 2R0ZL 3FZUD 2QHLA 5GRJH 4L8CB 2HJFA 3VW3H 3GSNL 1NC4D 4Y16A 3VXRB 1YMMB 2FGZA 4CMMB 1BFSA 1UM4L 3BIKA 4NUGL 2EDEA 4WHYG 5EOCJ 4X6DF 4MS8C 2BHZA 3DX6B 3AROA 4HPOL 5L88L 2JK5A 4JB9H 3BP7A 2DI7A 1OP3K 1GAFH 2HTKD 3HMXH 4G9DB 4YBQC 1AIFB 1G84A 1FH5L 4LASH 1GGCH 1JTPA 1H3PH 1X6LA 1V7MH 2EH7L 2B2XH 1K2DA 5CCKL 5FV1L 2X4TB 3U9UA 4AZ8A 3VFOA 1T22A 4NWTH 3VD5A 3O8XA 1FIEA 4EXPX 4N5EC 5CKGA 2MCPH 4OD2B 3QSKB 2IC2A 4KHXL 5TDOA 1I8KA 4YFLF 3QXWA 1JGDB 3VXPB 1V05A 4MAUL 2I5YL 1JWUA 3DXAE 5DMJB 4OGAC 4UDTA 4PRIE 4F57L 4KZEL 1J0KA 5F7HA 4YXHL 2VYRE 1SJEA 5DUBB 3O6KH 1X4YA 4WUKH 5C0RL 4XNXL 1N6VA 2SEBA 3ULUE 4R96A 5F7KC 3GGWA 1ZT1A 3P0VH 1JZ2A 5BZWB 4PP1C 1AI1L 4NO2A 1D5XB 2X1WL 3QIUD 1HKFA 4X9GA 4ZD3L 1Y6NR 2R0LL 2QADB 3F65A 2XKNB 3EYQD 1OSZB 4G8EB 2A73B 2X4QB 4G8IB 4P2CG 1J1OL 1HDMA 3W0WA 2O5YL 5IMKB 1PG7L 3B3IB 3TBTA 4GKNB 2VOTA 4XHQA 3ORJA 4LCCB 2IPUG 3P9MB 5EC2B 4X8JA 3P73A 7FABH 2ZUWA 3VXQA 4KK9D 5I8EB 2EDKA 4LSVH 2EEAA 5IHLB 3TNMA 5F89B 3TN0D 1A14L 1TQBB 2AK4A 1WISA 1ZK9A 3LV3B 3T08A 3MGTB 4P46C 4PJDE 2HFTA 1UYWL 4X9IA 1JGUH 5I30L 2R1XB 1I1AC 1GIGL 3NABH 3VFUB 1EUTA 3QCUH 3SCMC 3WFHA 2DLTA 2Y7QB 5HI4C 1S5HB 4UILH 4KJQD 3MRFA 4MAYB 2B8OT 3IKCB 3OKLA 4QNPE 2F5AL 4O4YL 3IDYC 3PABB 3KJ6H 1VEPA 1NGQH 5IVZA 4UB0H 3SKOB 3T04D 4PLJD 5JMOC 4ZUUA 5C0GA 2DQIH 6FABH 3UBXA 1CT8B 1WSST 3UEZA 5SX4H 4EUPB 3DARA 1NCDH 2DQEL 4Z7WA 1FVDB 1ZLUK 1SYSA 5J8OA 1V8HA 3O41A 4OF6A 3MNVB 5KAQF 3WFCL 4U1IA 2FYYA 1MCWM 4HXAH 1CBVL 2EE9A 4U1HA 4OD3H 1FG2B 3WKNA 5CMAB 3D3VA 3SJVE 2NXZC 5DS8A 3MJ9L 2VDMH 3EO9L 3QUYC 1LO2L 3V0WH 3FONB 5TDPB 5CGYC 4OGYL 1ZEAH 2DB8A 1IRAY 2W0PA 1NGPH 4ETQA 5I75B 5FOBB 3WJJC 5HHXH 1S9VA 4XC3L 4F7MA 4YE4H 1BVKB 4L4VD 3TT1L 1J12A 5FM8A 3DBXB 5E1AA 4ZXBC 4HX1A 1G9MC 3PF2A 3WXVL 5F1IB 4R0LC 1T3FA 5F8QC 4KMLB 1RULH 5FDWB 1U8KA 5H94A 2OZ4L 1H5BC 1B6UA 4JN2B 2WBJD 1ZVSB 4M43H 2XWBB 5JQHC 2JB5H 1IC7H 3ZYJA 2HLFD 3KYMA 4S1RL 5I1IL 2IH3A 1MLCA 2YD9A 3RDTC 2CRYA 1CDIA 4DUXA 5IR1A 5E2WL 4OZIA 5GRYA 1QO3A 4PGJA 3K81A 5K9KA 3ILPB 4NKIH 2ZUTA 3C5JB 3C8DA 4ODTL 5D2LA 1L6XA 2Y06H 5EZLB 1TTUA 1EDQA 2Y07L 2NY3D 1J11A 3X3FH 1PSKL 4NKMA 5FHBH 4EN3D 1GGIL 4JVPA 4D8PB 3QUMH 5D8JL 3HR5A 4OQTA 4RMRA 3HCVB 4CRPA 1JNJA 2ATPA 2CR3A 2ZOKB 4HIHB 1P7QA 2M2DA 4AG4H 3LQAL 1UGNA 2R4RL 2XQYK 1HWGB 1UWGH 3TJEL 1S9XB 4PJXA 4HAGA 4QRPB 5GRVK 3JV4A 3B9KC 4R7NB 1AHWA 1FYTD 3UTPE 3SE9L 3BAEH 1P1ZA 2E9JA 4TOYH 3QJFA 5BMFL 1AGFA 2AJ3A 2NZ9D 3MRMA 4WDIB 4CADB 2ZCKL 2AEIT 3J8F7 4LMQE 1CD0A 4WV1C 1HH9A 1T5WA 2ZWLT 3HN3A 5AEAA 4M1GL 4LARH 1AE6H 1HXMB 3LDBC 1CDUA 1S78C 5E8PB 3BJLA 5F96L 1YEKH 4FQXA 2A6JB 1NL0H 1LO3L 1P53A 4F7TB 4JZJB 3LN5A 3VXTA 3RZCA 3STBA 4Y4FD 4DW2L 4FZEL 5ID0A 3JXAA 2VL4A 3EZ8A 4O02L 4F58H 4GW1B 3TT3H 4M5ZL 3VRLE 4R8WL 4ALAH 1A9BA 1ZXQA 1LNUA 5IOPB 1BD2D 4QOKB 5IFHH 2HT4C 3TVMC 2Y36L 3F8UB 4UQ2B 3OGCA 5CP7B 3E0GA 1ODAA 4X5XB 3U0WL 3UYRH 4KI5F 4RQQB 5HY9A 7CGTA 3VWKC 2ZKHH 4OQTH 3V5HA 2K1MA 1EEUA 1X5XA 2A6IB 1I9JH 3HC3L 3B9DA 4U1SB 3X12B 1AQKH 4X83A 5FK9A 3BXNA 1A7QL 2O93L 3A6CH 1NMAH 5DJ2B 4PB9H 4XCCH 3HE6C 3DHJA 3KWWA 1R3LB 1KB9K 3DURB 4LSPH 1WZLA 1T1WB 3M8OL 4PJCE 4JN1L 5AAMA 1T1YB 1DQDL 4ODBD 2E6QA 4G6MH 5DQJB 3DGGA 4Q9BA 2NCMA 3QQ3A 4LF3A 4YO0B 4X7TA 2PYEB 1PFCA 4TUJA 4LEXH 3OV6A 3UJIH 2VJXA 3OKKA 4H5SB 5C08B 4ZNEA 2R0KL 1NBZA 3LIZH 4JY4B 2XRAH 2FIRT 4Y4KA 4M7LH 5C70A 1WEJL 4P2QD 1PKQB 1CDHA 4PPTA 3ULUC 2YSSA 3V6ZA 4R97B 3HE7C 3ZHDA 3MXVL 1FCGA 1A3RH 1TZHB 2I25N 3O3DB 4ZDHA 2R1WB 1T83A 3EOBA 1DVFD 2Y5EA 5JW4Q 2Y1VA 2CIIA 3T1FA 3V4UH 5J56B 2EXWC 43CAA 4CDGC 1CGTA 3RWCB 2NTFB 3KPLB 4DCQB 1GOHA 1SY6L 3I84A 3B5HA 5E08L 1WITA 4YHNA 1I9IH 1G9NC 2R8SL 4JPIB 5DFVC 3EUUA 1LEKB 4YR6A 5C0CA 1QA9B 4OZHA 1K85A 1FRGL 5GS3A 3BRGC 1CYGA 3HAEG 4WW2B 3EFDL 2W92A 1NCNA 5GPRA 1HEZB 1A4KB 5KSAA 1ORQA 2DBLH 4ZPTA 1IGIL 2NLJB 5L7XH 3AM8A 1BQSA 4HIJA 4NIKB 5KVEL 5B3JF 3G5XA 2VDPH 3OQ3B 2LU3A 5HYJB 4RISL 5EUOF 2VDOH 4Q9RH 5EO0A 3QWOA 5CIPA 2VH5L 5IBLC 4YBLC 1KCRH 1SMAA 4MA8L 3ULVE 1VKXA 5DQ9A 1JBJA 2AQ1A 1XGTA 3PGCA 2Y5TA 2VDQL 5FXCH 1KIRA 4JFFA 4KHTL 4O00A 4XRCB 3QRGH 1A0QL 5AG8A 1LE9A 3OB0H 3BD4A 4J6RH 2Z8RA 4XPFL 4KGLA 5J13C 1CLZH 3L3GA 4FQLH 2HKHH 4F37F 2BNQE 4YLQT 3FFCB 1A1MB 5D72L 3MMEA 4BQBA 5DJ8A 3UPRA 3TA3D 3C2SA 3WNNA 1QRNA 1MHHA 5JNYA 2HFGL 4M7ZB 4OBSA 2N7AA 5C0BA 3GRWA 4Y1AD 4IDJH 1MIEH 4P9MH 5D2NB 2L7JA 5BJTB 5I8OL 2AEWA 4PJIA 4RRPA 2F53B 1TVHB 4YFLI 3FQNB 1ETZA 2X4OA 5FUOH 5A43C 2WK2A 5GRUL 1YEIL 3C60B 4NZUH 4GAGL 4XC1L 4YDVB 1F6LL 2DQDL 3K2UH 4RWYL 3MRHB 1R3JB 2JCCB 1U8MA 4M62L 5FCSH 3DECA 5ACMA 5C8JA 5IEKA 4R6UA 1JE6A 5KS9B 5C6TL 3BZDA 2AW2A 4Z7UA 2M1KA 1NCTA 3GK8L 1NANI 4U7KA 5D7IE 1QLEH 2A77L 2ATKA 4HUNB 2AK1H 4JFQA 4I77L 5ACZB 2EDFA 3FO0L 1RZIB 1KTLB 3KG5A 4YJZL 1W2KT 3LZFH 3QUZD 4LPWA 5CIPH 3DTXB 4ETYA 3WHXA 4L29B 4YBHA 4UTBL 2CSPA 2BSTB 3S88L 3THMH 4RAUA 2IPTH 3B83A 2EYRB 3FAXA 4GRMA 2NY0B 2OP4H 3OL2A 1U8HB 1I1RA 1KEMH 3C8KA 3QDGA 1U8QB 3SDAC 3ZDXF 4BSVB 2VLJD 1FNSL 4GW5A 1JNLH 3WN5B 4OCXH 4G80B 5IV2B 3L7EA 1HSBB 5ICXA 1TENA 3VFWB 5EBGA 2E6PA 4DJMA 1YY8A 2ERJB 3C2AH 3K0WA 1MWAA 1JWSA 2VLRA 4F7EB 5JW5A 2N7BA 1CXLA 2PXYC 1A7RH 3RJQB 1GGBH 4Q2ZA 2WWKT 1ACYH 2NY2C 3EHBD 3DYOA 2WIIA 3GRWH 3TZVC 1BX2B 4UBDD 3VRIB 2UWEA 5B38G 4QXUH 1CDYA 1WAAE 5AZ2L 5MENB 1Q0XL 4P23B 1MRFH 3HZVB 1FNEA 4WI6A 5ICZA 3W5MA 3VXMA 2EC9T 4P2RB 5KN5B 3D39D 1FZJA 4PJEB 3RY6C 3VJ6B 1EAPA 3RNKB 4QXWA 3DO7A 5KSUA 4AL8H 5E8OA 2HJLA 3F5WA 3NA4A 3KPRB 3PL6D 5D7LB 4MJIA 5B8CB 2BVQB 4ZO7A 5J6GA 2H2SD 1NDGA 1IBGL 3CDCA 4MHHG 4NJ9L 1EEQA 3UJJH 4BK4A 1FL5A 2DQCH 2DQJL 3BDYL 5HI3C 1XGPA 2QEJA 4EJ1C 3BZFA 1Y18B 3L5WB 3PHQA 2O5XL 3HG1A 3WO4B 3RY5A 3BPLC 3R8QA 4M6MH 2KL6A 4ZFFA 4HG4K 3EYUH 1HHHA 2KZWA 4ZQKB 5H2BB 5IMMB 1M7IB 1FLRH 5CJQL 4NQXB 1PGRB 3OAZK 1MWAH 3OXRA 4PJIF 3VGAB 1ZHLB 1TJHH 2X5PA 3N50A 3TCXA 1MCOL 5DK2A 1EFXB 1KTDB 1IAII 5C0AB 1XR8A 1F58H 5LXGH 2BCKA 2DD8L 2VDRH 2GJ6E 1NDMB 4GBXD 3VGHA 2RB8A 4MNQA 4KQ3L 3FTGA 4P4KC 4QTIH 5FGBA 1REIA 4Z7UF 3V2AR 4TUOB 4I3GA 3DWTA 5B21A 1JHKL 4XVTH 1HI6B 1T6VN 1UA6H 3FZUC 2F54A 5LGJA 1U9KA 5I1GL 1YPZA 1DN2A 4KWUA 1UB6B 4P46A 3ARED 1AQDB 4IOIB 5I1KL 2I07A 3EZJB 5EU3B 4PYGA 1CDCA 4JQVC 4Y19D 3QXDA 1U92A 4L4TE 3PXJA 3IJSB 3HR6A 4B7LA 2DTML 4NRZB 4HK0A 1I1AA 4AIXA 1BD2E 4HAFA 4F7PA 4HWBL 3BD5A 3SCMA 1AO7D 2H45A 2Z92B 3LY6A 4OUUB 4S1SL 3VMOA 3VXSE 3WL9B 4IJ3B 4OGXH 1Q94A 2IGFL 3GJFB 1NC4B 1K6QH 3VI4F 4GXUN 5T5NF 3FB8A 3BW9B 3EO1B 2A6DB 5IUSA 1W72B 3FN0H 1TETH 4LHUB 1FL6A 1JVKA 4MCZB 5D7JD 1J0YA 4G6KL 3MRKA 2PCPB 1MEXL 1KN4L 4PRAB 3HFML 3K4ZA 4TTDC 1TPXC 4YH6A 2GFBB 1SM3H 2CDFB 3H9YA 1HKLL 3K46A 1WLHA 1T4KA 3MR9A 4KU1A 3S5LG 5DD3H 3ULVC 3ZTNL 4R2GC 5ESQA 3QO1A 2KKQA 3FB6B 4BUGA 4QGTA 3MLYL 3QUYA 3L9RA 5E99L 1VA9A 2Q20A 4NM4L 2VLMD 5EO9A 4XP4L 4P2QE 3TH3T 4EI6A 1S7TB 2X4UA 1C5CH 2J2ZA 2AXFA 5IVXB 1U3YA 3QO0B 3DVFA 1WBZA 4XWOC 2J7LA 4ZXBA 3QIWD 4FXGB 4J4PD 2UUDH 4U3XA 32C2B 4R0LA 3O9WC 3PGFL 4NZTH 3TBYA 2V7NA 5CSZA 4PJFA 3DUHA 4IMLA 3WJLC 1H5BA 1A8JH 4U1MB 1L6ZA 2Q76A 3HKFA 3QG6A 3QIUB 2MKWA 3RDTA 4MNGA 1AGEA 2X2YA 3L6FB 5D7KE 3V4VL 1CLYH 3MV01 4X7SL 4XAKE 2HWZH 5AZEH 5J7CC 1TJGH 1ED3B 1G7LA 5IK3B 2D03H 5DUMH 5C07A 4NQDD 1MUJA 2CXGA 4H1LG 4DTGH 3TN0B 4CMHC 2PYFA 5BS0A 3ARUA 1MCEA 2EIBA 3HUJA 4H20L 4JR9L 4ODWA 4JKKA 1MHCB 1S9WB 3SDXE 5E5MA 4HK3N 5HDLA 4Q0XH 2APWA 3WFDH 1KB9J 2R9HD 2XA8L 2DQUH 3V8OA 4W4OC 3JUYA 4WIQA 4RCAA 1R5VB 5DJYB 1HZHL 4YHYC 1V7NL 2P5WA 4DEPC 1J1XL 3B9KA 5GJTH 4XMLL 3NACL 4DQOL 2H2PC 4OZGE 3VFMA 5AD0A 1QFWI 4I5BA 1HH6B 2NYYD 1FCCA 3W11D 2XT1B 1T5XB 3P77B 4JFZH 4QRQB 5BV7L 1TDQA 1V3JA 3P4LA 1YPZF 2UYLB 1RVFL 4JRYA 4NO0D 4WV1A 1W8OA 1YQVL 1E4XL 3U7YH 5C2BH 2H9GB 4F9LC 1ADQL 1XMWA 4NQCA 4CBPA 2AEPH 2EICA 5I66B 1G9MH 3FT2B 2R56H 1YQ2A 5IB2B 3MRJA 5IB3B 2OBGA 3U4EA 1ZSDA 1F4AA 2OTWB 1N0LA 3A0OA 1OM3L 3BMVA 2WBWB 3OXSB 4PJ7B 5DGRA 5B39B 1A5FL 2FBOJ 2AJVH 1N6QH 1C12A 1CGXA 4JO1L 3MCLH 4YAQB 5MEQB 5C9JB 2VXTL 5AUMB 2YPLD 4YUEH 4L4VB 1MFCH 1LDSA 1WCBA 4QRSA 1CE1H 4UQ3B 1EEZB 3TVMA 2PN5A 4Z0BL 5DLMH 4M61B 1U8OB 1R3HB 3GJFK 2WBJB 4KY1H 1KJVA 5GRWA 2E7CA 4PJ9D 4XVJH 3IT8D 3KLDA 4HQQL 1XCQB 3W9DA 5T3ZL 4KRLB 5M7QA 2A1WL 4CU6A 2NY3B 1T2QL 4I13B 1WZ1H 1PZ5B 3NIFE 4EN3B 1EO5A 2MQ0A 5D70L 1KB5L 3SKNB 3B2VL 2J3SA 1WWCA 2I9LB 5I2IA 1OLZA 2CMRH 3DXAA 4OKVA 2FO4A 1BIHA 5DZOA 4N1CA 4H8WC 2WWMD 2VLLA 4PRIA 3DRTA 3MOAL 3RBSA 1ZHNA 2CLVA 3ZKNC 5JOFB 2C3HA 3E2HB 4WEBL 5KVFL 3SGJC 3RTQC 2DN7A 4BQ9A 2VITB 4L9LC 2GQHA 3LN4B 3HE7A 4K23L 2HH0H 4ODVL 1INEL 3Q0HA 1RUKL 1FYTB 3GSNB 3QULB 3FQRB 1K4CB 4FNLH 4MJ5A 4JGUA 5ETUB 2X05A 1H3WM 2NMSA 4MA1C 2PR4L 4NQEA 2NQCA 3HB3D 1FFOA 3KPPA 1PY9A 4HUXB 5J1AB 4YNYA 3EJZC 5I8KH 1ES0A 2CKNA 1I3GH 2JJWA 1OAKH 4LCUB 2GY7B 2G2RA 5F72S 2BSSA 1TVBA 3MLUH 3UMTA 4CN4A 5DTFA 3BKJL 4CAGA 3ARPA 3MV11 4PJDA 5HSFA 3T8XA 3LKSB 4EOWL 2LAAA 5DC0A 3UAJC 5FECB 1U2HA 4Y4FB 5I1JL 1AGDA 5KAQG 2XG4A 5CKAA 1VACA 4DK3A 2ZSVA 1OGAD 2DQHH 1BQLH 1F3JA 4PRBA 5AAWA 4P99A 3GMOB 3MCKA 4M1DH 1VFAA 2YC1B 4PS4H 4Y2DD 1ZAGA 4ODXB 1QKZL 1UWXK 4ZUVB 2DBJA 4U6TA 4JKWA 2VXSL 5FYKL 4L8SC 2W60B 3HPLB 4KAQL 1CFSB 3DYPA 15C8L 5TQ0L 3DRQA 1CD1B 4YXLH 5I9QC 1I1FA 2E3VA 3MLXL 3SKJL 2C1OA 4TUKH 2A74A 1K8DB 5ISZE 4ZODA 2KQMA 3ULUH 5IKCB 2AP2A 3TP4A 1MJJB 3HI1B 4Z76A 2B1AL 5E6YA 4O5LH 1BZ7B 4YFDB 1V3KA 1N3NB 3MBED 4ODSH 3MRNB 2JB6B 3U0PA 2FWOB 4AM0A 1VFOA 4KROC 4KJPD 1WJ3A 4R3SB 1CR9L 1A7BA 2B5IB 5FAAA 1Z3GL 4K7PL 2UZIH 4XMKH 5BCAA 4O58H 5C9KA 1KJ2L 3ZSTA 1U58B 2E9WA 2XZQL 1TITA 5DEGA 5DMIH 2YD6A 1G9NH 2BSRB 2F74A 2YA0A 4LEOB 1J5OL 3T65B 3V79C 4PTTA 4LKCA 1C16B 3UO1H 1DVFB 1U8NB 1TQCC 4N0CD 4Y19E 5DRXA 3T09A 3CK0L 3QQ4A 5JQ6H 1CGYA 2VZ3A 1DEEB 5DR5L 5D93C 3B5TA 4OCYL 5HBBA 2R29L 3H6JA 4XB7A 4ZO6A 3LHPH 3L3KB 3CJJA 2HVKB 3KJ4B 2D9CA 4FFWC 3SGEH 4NBZB 2UV3A 1IEBB 3NCBB 5DJZA 3ESVF 1A6VL 4ZTOH 3CVHH 1QHPA 4D0CB 3MYZA 3MOBL 4EZMA 4HG4J 3SDAA 1YNLL 4N0FA 3SQOL 3RPIB 4U6HB 3NFSH 2NY1D 1AY1L 2ZOLA 2NY7L 1JPTL 1M6OA 3BQUC 2Q1EA 1KIPB 1ZGLM 2DLFH 4G8GB 4U1NB 2C3WA 1BFOA 1NEZB 1MCQA 4LSDA 2VLME 5A3IC 3ULSA 3CDGA 4GMSL 4V2CB 2BNRE 3ARFD 3TZVA 2A0LD 3MACH 1YY9D 3VE0A 4LPUA 4HUVB 2APVA 1TCRA 4UIKL 5ALCL 3RWFB 3CX5K 4MX7A 3TBWA 5GQBA 2DMBA 2VXUH 2GTZB 4GRWH 1BFTA 5KJRH 5HHQA 5GS1B 2DMKA 3TA3B 3BVNA 3LQAC 1HNGA 4Z7OE 3CFBA 5T33H 3GSOB 4RIRA 1VEOA 3ECBA 4Y1AB 3S35X 3RU8H 4DKDC 1EFQA 2VQ1A 2GUOB 4G9FD 4HKBA 4J3WA 3I85A 4S2SA 1X5JA 3KYKL 4N0RA 1FIGH 1KPRA 2X9XA 5I1EH 1VHPA 3BUYA 4LSQH 4MDJA 4ZFOL 2FRGP 1S7RA 4JFDE 3U30B 1JZ6A 4BQ8A 3TJHD 4J7RA 2QV2A 1NMCC 4KJWC 3RP1A 4RMVA 4JPVL 1G6VK 5ADPL 4M5YL 3ZL4H 1J05B 2R15A 3MUGA 4PJCA 2MHAA 4E0RA 2WANA 4OI8A 3U4BH 4QHLB 2D0HA 4AEHH 1N7MH 2X7LB 4WO4C 3CIQA 4NKDB 2EEDA 3RFZC 4KVCL 4PB0H 3O4LA 3QUZB 1TNNA 3QNXA 1B4JL 4XCFH 2JCCF 1MIMH 4G3YL 1NCAL 4XNZC 4XP9H 1IC5L 4ZTPL 4HGKC 3WYRA 5KS9F 3MLZH 4PGEA 4Q58C 3D0LA 4LBEB 1K3IA 3RX5A 1F8TL 4QHNB 5C0IA 5GS0C 2OI9B 2VLJB 1D5MA 4X98B 5JXEC 2Z31D 3U83A 4P4KA 1OT1A 4KVNH 4LCYB 1NMBL 4IS6A 5EWIH 4QXGH 2DLGA 2EXYD 2E5EA 1N64L 3BWAB 2RAMA 5DRWA 2YHGA 4U0QB 3BGFB 5HHMD 3QXVA 5I73C 3MLTB 1RIUH 1CF8L 3NPSB 4YWGH 4J3SA 3QWRA 4XI5D 3K80A 3Q1SH 4NWUL 4JQVA 5FUZH 4KZDH 1CN4A 2DIJA 4G6AD 1P4LA 2ZJSH 2YPLE 2D31B 1J0JA 2W91A 2Y23A 3D18B 5TGBB 2NXYC 1XIWC 1KXVC 3VG9B 1WC7B 3SDDC 1NFDE 2J8UE 3D39B 1Z9SA 2NNAB 4E41D 4MQSB 4C83A 5CJOH 3G9VA 3FB5B 3BGAA 4XNMB 3D2UD 3RWIA 3VW3L 4UV4H 2DLIA 1HHJA 3FQWB 5BZDB 4FTVD 5C71A 2A6KA 1VERA 1FE8H 1C5BH 4J1UA 1E4KC 4TQEH 3PL6B 1FBIH 1BIIA 4MCYB 2P8MB 4U0RB 1UFUA 4PJEF 3QEQD 3OF6D 4JDVB 5SWSE 1IL1B 4BH7A 3RWDA 4G6FD 1GAFL 1FYHB 3ARTA 3HMXL 3OKOA 3HLAA 4ZUSB 4LASL 1GGCL 4PJBE 1H3PL 3CZJA 4RMWA 5BRZE 2B2XL 1T04B 1R6VA 4LCWD 2VKXA 3GMQA 4XXCC 3WXWL 3VRLF 4U49A 3BH9B 3GB7B 3EYVA 3CNKA 3WUZA 5GSRB 2MCPL 2ICCA 2BNQA 3Q6FB 1T1XA 4LDLB 3GBLA 1A4JB 3TFKC 2Z8SA 3I2CH 4MXVE 4ORGA 5DK0B 1GH7A 5KVGH 4NNPH 1EJOL 1T0NA 3VWJC 5BQ7B 3O9WA 3Q5YA 4XXDB 1XF1A 3T0ED 3RWJA 3N1MC 5T1KB 2LFGA 2AJYH 3O6FC 4E5XB 1CFNB 3DX8A 4ZS6D 2GITB 3O6KL 3VXUA 2P45B 3OB8A 4WUKL 1TLKA 1A6ZA 4BQCA 4Y5YB 2YD1A 4NZJA 1FO0A 3P0VL 3IETA 1LO4H 1EMTH 4P57A 4GBXB 1JV5A 1XAUA 3MGOA 1G7JB 1AD9B 5TFSH 3AREC 2OJEA 3AU1B 2L4OA 1HHKA 4P59H 1S7WA 5F44A 4I3RH 2X4PB 3EGSA 3Q3GA 7FABL 4K2UH 1OGAE 2Q8BH 4LSVL 5D7IA 4AH2A 3U6RB 1INDH 2Q86B 4Y19B 4ONHB 2EDLA 5GZNC 1YC8A 1KENH 2EE6A 5DEZA 1B0WA 2BY3A 1KF9B 3ALWA 4W4OA 2KPNA 1F11A 5GGSA 3PIQB 1G7MB 1AO7B 4MD0A 3G6JB 3L3OA 1IT9H 5FYJD 3ULVH 3V5KA 5IBTL 3NABL 2XY1A 3QCUL 3HC0A 1H8SA 4M6NL 2J5LC 3P4OA 5D7SH 4UILL 3MRQB 4P3DA 4QRRE 4TVSa 5D7JB 3KJ6L 1NGQL 4N8CH 4UB0L 4DFHA 1FLTX 4LKXA 2PTTA 5ENWA 2HKFH 2P5EE 2IAND 4GRLD 3FT4A 4MQXC 3GSUB 4JO4H 3BRDA 3PGDA 4F9LA 1FAKT 1NCDL 3IRPX 4GKOA 1DP0A 4MWFB 4UAOC 2P24A 3NZ8A 2CLRB 4ZPVA 1MI5E 4QO1A 3QFDA 1IGTA 3Q6GH 3CU7A 4HXAL 3QAZB 5JW4N 1KCLA 2VDNH 2W9EH 5T1LA 1DBJH 2P7TB 3GMRB 3C8HA 4OZ4A 1WAAA 5GISH 3MRBA 4N0YH 3SPVB 3TO4D 3GSXB 1FO0H 4NC1E 1DR9A 3G6AA 3V0WL 1X5YA 2FEEI 4W6YB 2FO1A 3FN9A 1ZEAL 2Q3ZA 4LLVA 3QJHB 3QIWB 3QCVH 4GO6B 5HHXL 1DEDA 4JO2H 4XH2B 5FA4B 4YE4L 1VGEH 4MJ6A 5JIPA 1DDHA 4U6VH 2EDJA 3J7HA 4JAMA 5C6WH 1SEQH 3MFFA 3S37H 5DD1H 3ULVF 2GSGA 4JG0H 3WUWA 3KYNA 2OL3B 1UXSB 1RULL 5IWLC 3S8WA 3PWLB 3BKCH 4TRPH 4KDWA 4P5MB 4M93C 2P8PB 5I1AA 4M43L 1A02N 4PGBA 2JB5L 1IC7L 3OX8B 3C5SA 3OHXB 3ET9F 1ZLWK 4DZBB 5CBEB 2AGJH 3Q5OA 3ROLA 3AAZA 4NKIL 5KG9B 3AS2A 4NQDB 2KDGA 2Y06L 5IGXH 3X3FL 1GZQA 1X5LA 2WBKA 4QY8B 5FHBL 1HN1A 3LEVH 4IRZH 4CVZA 4PG9B 1G0XA 2YN5A 3BYTA 5ID1B 2AXGB 4ZSOE 2GY5A 2YWYA 4BSWB 4OCRH 3SGJA 2JKXA 1INQA 4AG4L 3MRLA 1UEYA 4NC2B 4WJ5A 3U36B 4XNQB 3HS0B 4D0BB 3T4YB 3U1SH 2WINA 4JY5H 2Y6SC 3D48R 1DQQB 2GJ6A 4HIIB 4F15C 2D9QB 3PP3K 3GSQA 1JHTB 2BNUA 3BAEL 1H15A 4TOYL 4C4KT 5T3ZE 5I19H 4ZMAT 5T5NG 4NO0B 3PHOB 5L0QB 4LVNB 3MJ7B 3CFKB 1XF2B 1RK1B 4Z77A 1MJUH 35C8H 3BPNC 1PQZA 4OAWB 1DUYA 4GG6B 4LARL 5DDHA 4L4TA 5HYQB 3CD4A 3CPLA 5T5FH 3WE6B 1DBMH 2GTWB 4APQD 1YEKL 3ZE1F 1NL0L 2BFVH 3C5ZA 1CICD 1BLNA 5JDJA 1SJHB 3VXSA 1EXUB 3AS3A 2YPLB 3FQUB 4MD4B 4PRPE 5CZXD 1YYMH 4TULH 4XB8A 4F58L 1BBJA 2VC2H 3TT3L 2R2EB 5IF0B 4C56D 2GW5A 1FVCA 4ALAL 3QH3B 3K1DA 4JRWA 5TE7H 3KLAA 3IXAA 5FA3B 3IJYA 2OTUB 4NDMB 4PJ9B 3FO2A 3BHBB 4FG6C 3UYRL 4H8WH 5EIIB 4OM0H 8FABB 1EJ6A 2IBGA 2ZKHL 4OQTL 2NW3A 1I9JL 1U8JA 4NUJA 4C55A 1AQKL 2IPUK 2XN9E 5D5ME 3RGHA 1UM4H 5I71B 4GXVL 5C09B 3BT2H 4JRXD 3A6CL 1NMAL 4JCLA 3EOTH 4PB9L 4XCCL 5L88H 1W0WB 4K3DH 1T89A 4LSPL 3MLPA 1GPOH 2P46B 3OR6A 2F8XC 1QRKA 1A2YB 3DIFB 3RUGE 2HP4A 1QHOA 1FH5H 5KVDH 3KLHC 1W0VB 3CMOH 4Y16D 3I6GB 3K8KA 2IALA 3CX5J 5E6IC 2YK1H 1F45A 1ZS8A 4LEXL 3UJIL 2PW1A 5K33A 4NHUB 3L3DB 4ENED 4X6EB 3LIZL 2XRAL 2V2TA 4M7LL 4D9LL 3MV8E 3LOWA 3FOLB 4EIZC 5FYKE 3BKMH 3RA7H 2W59A 4X4YB 1A3RL 2FBJL 5DVMA 4GAJL 5BOZG 2BHUA 4F57H 4PBWD 3BP6B 5E03A 1FNGA 3BESR 1K9TA 4PRDB 3QFJE 1JPSH 3O8XD 4XNXH 3V4UL 2FIKA 4XCNB 1PG7W 2W9DL 3OKNB 4HSQA 4K9EC 1MJ7H 5IROC 3N85H 3O2WL 4ZO9A 4JY6A 2R0LH 5F9JA 1I9IL 3SDXA 1X44A 2Z8WC 3RKDD 5AWNH 5JORB 1AH1A 2DL2A 1S7XB 3U79A 1B0RA 3FB7A 1U8PB 3RIFK 4PV8B 5HGHA 3QEQE 4HCRA 3T77A 1CDJA 2ARJB 2XFXB 4OZGA 3LD8C 2ICWA 4Z8FL 3N1FC 4EUPG 3QUXC 4Y2DB 2DBLL 3PWNA 5L7XL 1HCVA 3GI8H 2CRMA 3BQUA 3TIEA 2ED9A 1FFNA 3P3YA 5ESAB 2Z93B 3W0WD 2VDPL 1NSNH 2VDOL 2YRZA 2VE6A 4Q9RL 1KC5H 2G75B 4NQVA 4QT5B 3D85A 5EN2B 1KCRL 3DROB 5DVLA 1ZGLA 2CDGA 4RDQF 3L1OH 3SHSA 2AK4D 1NUFA 3MOQA 1D9KC 4RAVB 4DOHB 3LAFA 3CFJA 5HDBE 1KG0B 2QSTA 4JHBA 3T0EE 4GAFB 4PJHB 3F58H 5FO7A 1OTTD 2BX5A 3GMNA 1QOKA 3D5OF 4J6RL 4ZYKA 2HFFB 1HHGA 2MKLC 5JHDE 3S97C 1CLZL 4HFWA 4NC1C 2VIRB 4G5ZH 2HKHL 4LRIC 1G6RA 3OPZH 4PJGE 2YZ8A 5DJ6B 1ZLUH 1IQDB 5L2KE 3KXFE 4HBCH 1CFQA 1JGDA 3WFCH 4JFXB 4BKLB 5DYOA 1CBVH 4OCMC 4KQ4L 3G5VA 1F4XH 1NUDA 4IDJL 1MIEL 4P9ML 1E27B 3T0WA 3EO9H 3LRSB 4WI4A 4Z7VE 2DMCA 2G5BB 3NAAH 4NQTA 3VGEA 3UTTA 5F70A 4JREB 4ELKA 2OS7A 2FHBA 1ORSA 4XC3H 5FUOL 5DA4A 4G6JH 2FGWL 3P4NB 3QDJE 3MRCB 3K2UL 4OF3A 2A73A 4G8IA 4CW1B 5IMKA 3B3IA 1AR1C 3WXVH 2ITCA 5BV7B 1I7TA 1RZ8B 2HT2C 3D3VD 4HCRH 3AXLB 1KJMA 2ZUXA 2FX8H 4DZ8A 5GGRY 5D6CA 1WGOA 5ANMB 2XOTA 4OLVH 1QLEL 3BEWA 1DQMH 2AK1L 3LRHA 1SMOA 2K7QA 1QSZA 4N0UB 4YDIL 1AGCB 5F7DA 4JG1H 1URLA 1OSPL 1FZMA 3LSOB 3IB4A 3THML 1MLBA 2IPTL 5CD5D 2OP4L 2NY1B 4WY7H 4YC2B 3UTQB 1TNMA 3NN8A 5JXEA 1A1OA 3ZE2E 4POYA 1CL7I 1FZOB 3ETBF 1JNLL 2BMKA 3QDME 4C59B 3IKCA 2WP3T 2I9TA 4OCXL 5MHSD 3PABA 5I74C 3GUTB 3LQAH 5H8DA 4H25A 4HEPG 5D9SB 3WV0A 4AEEA 5DVOA 1G6RH 1M1SA 3IAPA 3C2AL 4FQCH 5IM7B 3SDXF 4PY7A 3W9EB 3B8SA 2NW2B 1A7RL 1I8LC 1GGBL 2RIKA 3ARFB 4JM2C 5ICYB 1ACYL 4AYFA 3KYAA 1JF1B 4ZOEA 1KLUB 1XIWA 3VFPB 1MJ8H 2VTFA 3GRWL 3SE9H 4OT1H 5EUKA 1P7QD 3EJYD 3SDDA 3SGDH 2GCYB 4K3HA 4QXUL 3ARVA 3S3PA 3TF7C 1Q9LB 2ZCKH 1KB5B 5E0QA 3GZKA 3JTTB 1Z5LB 5CGMA 2BOCB 1BEYH 5DD0H 4UU9A 3NFPB 2OSLB 1JUFA 1E4KA 1SEBB 5FYLE 4WHDA 4AL8L 1S7VB 4OF0A 2JJTC 1LO3H 4G9FB 4X6FA 1GXEA 1DFBH 4ZUTB 5EU4A 1I8MB 3GSRA 1CGUA 5EIVA 1CU4H 1S9YA 4X6CE 1UM5H 5FDWA 1MH5B 4OCNC 4O2CA 1ZVSA 1I85C 5C0FB 1JWMA 2AXHA 3RIAF 3UJJL 3T4AA 3IS0X 5ISZA 4QF1A 4HZAA 5B38B 4UUJA 4FQXD 3IFLH 3C5JA 5GS0H 3NGBB 3RZCD 2Y36H 1IGML 3U0WH 4D9RD 4M6ML 3KNBA 3FO9B 4PR5B 2QQKL 3VWJA 3EYUL 3FT3B 4B5EA 5BXFA 3DJ9A 4Y5XC 2GAZB 4KKAD 2W38A 3O6FA 5E5UB 2ZOKA 1FLRL 1LP9B 4PLNC 1DBBL 3MNWB 1A7QH 5GGVY 2Z35A 1JNHA 1MWAL 2FJGA 1TJHL 4HWZB 3F7RA 1FQ9C 1MAMH 4KI1A 1BQHA 1S9XA 4IMKC 2Z31B 3T0AA 5LXGL 2VDRL 1WZKA 4HS6B 1WFTA 4PJAB 4M8QA 3DVNB 4HGWB 5HHMB 3X11A 4QTIL 5DO2D 2EECA 2OQJA 2R0KH 3DX9B 1AJ7H 3P0YH 4HDIB 4YK4C 3IDJA 5INDB 5CJXC 4LGRB 2FR4A 3QNZB 4XVTL 4M02A 3IJHB 1EEYA 1UA6L 4HF5H 1IAOA 3REVA 4MXQC 1B0GB 4G43A 2VDLL 1GGYA 1NKRA 2K9UA 1HXMA 2FEDD 4C56E 4I4WA 4XP6H 3KDMB 2XIDA 3P9LA 5EU7C 3ZT7A 5E8PA 3JWNC 1KYOK 2BVOB 1XGQA 4E41B 3LQZB 1N59A 4Y4HC 4JZJA 4Y4KD 1XGUB 3D2UB 3QA3A 1KIQA 4CGTA 4OGXL 2H6PB 1K6QL 2VRAA 4FTVB 5E9DE 1JPGA 3BP5B 4UOJA 3OAYH 3GMMB 3HPJA 1TETL 5AYUH 3U0TB 5IOPA 1KJ2B 1T21B 5F6HJ 1D5BA 1FRGH 1UVQB 3ZTJH 1P7KB 4G6FB 4UQ2A 2Q7YB 3EFDH 3FHAA 5D1QC 5JZ7C 1NGYB 2BNRA 1NFKA 2XTJD 4JFEA 5EU6E 3OKDB 2V9TA 4W70A 3DO3A 4LCWB 5F7LB 4O51A 1RIVL 5C0CD 2APFA 1M7DB 2CUHA 1PEWA 5DGQA 5BVJA 4P4RB 2XACC 3DUSB 3DURA 1XGRB 1OTSD 4TVPE 1QSEE 4YQXH 2EZ0C 1C5CL 3CLEH 5KSAD 5J06A 1WICA 3BYYA 4LOUD 4XGZA 3JV0A 3CGTA 5JOPD 1A64A 4YO0A 2VDQH 3CCHA 3T0VA 2YD3A 3KPOB 4JKPH 4NZTL 4H5SA 1A0QH 5IWLA 3F12A 1F4WH 4MGXA 4CNIB 5IMOB 1H8OA 5JO5A 3DV4A 3BWUC 1SVZA 1PKQA 3S4SA 3PWJB 3I3DA 4MVBD 4DGYH 1WZMA 2ORBH 4PP2B 3C6SA 5EG6C 3EYFA 5F9OH 4JFDA 4WU5B 3I6KB 1TZHA 3BZEB 4XHJD 1A3QA 1B3JA 2ICEB 1CLYL 1VEMA 4JFFD 4RGMC 2HWZL 5AZEL 1TJGL 4XZUA 1UQSB 2D03L 5DUML 2FL5A 1A9EB 3VH8B 4DTGL 1VDGA 1X6NA 3K8LA 4PGDB 4RNRA 3RY4A 2BXYA 3RWCA 5SWQB 5IB4A 1EBPA 4X0KA 2ZG3A 1QRND 5GRUH 4GAGH 4JPIA 2DQDH 4CJ1A 5C6PB 5C0BD 2LTQB 3WFDL 1LEKA 4V1DE 1MRCH 5DJXB 3TIDB 4IDLA 4WW2A 4KMQA 5J3HC 3QYCA 1F5WA 5T1DH 5GJTL 5C6TH 3GK8H 1E6OH 3IF1B 3HZYB 3LEXA 1KXQE 1P4BH 4GT7A 2NLJA 3CSYB 4I77H 3ZT5A 3FO0H 5C1MB 3NCEB 2H32A 4JFZL 3WFZA 4GRLB 2IANB 3WHE0 5CEXA 4H1LB 3BO8B 5EOTB 4YHZH 3VFSA 5DHYA 3LPGA 4JO3H 4FZ8H 1UT9A 4M7JH 4RX4A 4B41A 3VDBA 4LFHG 3FRPG 1YN7B 4ZFOB 3DUUA 2QQLH 1N5YH 2AEPL 1G9ML 3GMLA 4LP5A 2R56L 1HOCA 2CIKB 3TO4B 1OP5H 5AG9A 2J8UA 3QNYB 5TPWH 4BFBD 1N26A 4RGND 3M1BB 2GKIA 2AJVL 1N6QL 4L8DA 3QDGD 3MCLL 4JFHE 4Z7WE 4WW1A 1A1MA 5CAYB 2CKBA 5EU5A 2Z4QA 2EC9U 1MFCL 4KXZI 1CE1L 2D0GA 4LLYA 5EZIH 1AP2B 1EK3A 4EDXB 4UDUA 5DLML 5ITFB 4YHIA 43C9A 2WLZA 4X6DB 4S1DC 4KY1L 2VLRD 3CFDA 3G04A 2IG2H 3TBSA 4XVJL 2E7MA 5IB1B 3PWUA 2HMIC 3PNWB 3E1F1 3FJTA 1WIPA 1FFPB 2F53A 3SY0B 5M94B 3LN9A 1TVHA 3VD4A 3FQNA 4NYLB 5DJDA 5BRZA 5A2IH 3I3BA 3C60A 2FHCA 1UH3A 4Z7OF 3REWB 3RL1A 4DN4H 1WZ1L 2YD8A 3VGDA 3VXMD 5IW6A 3O3EB 4GSDH 1NBYA 1KUMA 4M8VA 2QLVB 5E6IA 1IGCH 3PE9A 3LKRA 2CMRL 3QWQB 2H32H 4MS8D 2QJDA 2DQJH 4OZIE 1KPUA 1ZHKA 4JZNB 3OR7B 3BDYH 4XP1H 1BZQK 5E2UH 1OF2A 5D2LE 1VPOH 2VSDA 4L29A 2XV6B 3BH8B 4MJID 3VXOA 1JPFB 3EYSH 4YBQD 5J6HB 3RGVC 1M4KA 4QRUB 4BSVA 3QXAA 1A6UL 2YEZB 5E8NA 1Q0YH 4JHWL 3GJEA 4JANB 3WN5A 1A3LH 1CQYA 4CVXB 1H3VA 4NQSB 4WHTB 3S7GA 4AENA 4NSKB 12E8L 4LSRH 5A2JH 4N5ED 4OZFH 3UYOD 3U4AA 3HG1D 4XCEB 5IROA 4OJFL 1I3GL 1SBBA 2BXZA 4IRJC 1OAKL 3EOYG 1J8HE 2HT3C 2CKBH 3MLUL 1ONQA 3U46A 2V9QA 4OGAD 4APQB 3D6GA 3D25B 4CUCA 3ARBC 2H8PB 1N2RA 3B4NA 3JUZA 1CICB 2DF3A 3R0MA 3VXNB 3QI9C 4IEFB 4DVBB 3WS3B 4WWKC 3WSQL 4WNQB 3TWCH 1RI8A 3MRIB 4P23A 3GIZH 4PP1D 1G9EA 3V5DB 2DQHL 3WMSA 3QUXA 5KN5A 3G08B 4GG6F 5SWZA 1NC2A 2XPGB 4M1DL 4JQXC 5ADOH 1JTTA 3P9WB 3BP4A 4MNQD 3RX7A 4QRRA 3MLSH 4HZLB 1IFHH 1KTRL 3IVKB 4IHOB 1CLCA 2P5EA 1IVLA 4FMFA 4MA3A 3GI9H 4I2XB 3IDMB 4S1SH 3STLB 5C2UB 5HPOA 5EO1B 1F00I 2X4SB 4YXLL 1D9KA 4RFNB 1DQTA 1MI5A 1YDPB 3BZ4B 4P46D 1NFDF 2J8UF 3H9HB 1O0VA 4IOFC 4JRXB 4TUKL 3SO3C 1HQ4A 4P9HC 3RL2A 1LEIA 5F7EL 4LLQB 2X09A 1X7QA 1EHLH 1MFEH 1UZ8A 3ULUL 1MCKA 1I1AD 5IFJB 3SCMD 1MEXH 1WUNT 3L5WA 4LRIA 2JELL 1TJIL 3HFMH 5HI4D 4ODSL 3PWPA 2J8HA 4Y16B 4KKCC 3C09C 3BIKB 1CXIA 5H2BA 3TBVA 1JFQH 2C7UA 4GKSA 2UZIL 4XMKL 1A6TA 1AC0A 4GQ9H 3U9PL 2JK5B 4O58L 3LPFA 1BP3B 1U8LA 5CSBA 4Q97A 3IFPB 1OHQA 4YEFA 4K9EH 3BP7B 4PJBF 4R90H 1OD7A 1G9NL 5C0AA 1NPUA 1K2DB 4X7EC 3U9UB 3VFOB 4XVUC 1T22B 2NXZD 2AS5M 4ZNEE 2VXVH 3QUYD 4MXVF 5JQ6L 3O8XB 3ALXA 4HK3J 5FKAB 4JDZA 3B2UC 5CGYD 4JJ5A 5TDOB 4RFEA 4UT7H 4ZSOA 1JWUB 3LHPL 3MJ8A 4UDTB 4ZXBD 3V4VH 4QYOA 3CFIC 1KNOA 4X7SH 4WI8A 2IPKA 1SJEB 5D6DC 5EZOH 4R96B 5E95B 1ZT1B 4NO2B 4OUUA 4N9OB 1BREA 3H7BA 3RDTD 3M07A 1B6DA 3B6SA 3BUTA 5CWSA 1NFIA 1HDMB 4TSBH 3STZB 3W0WB 3X3GH 1Q9KA 4LHUA 4LVHB 5ABDE 4MCZA 2DLFL 4X8JB 3P73B 5C07D 3CXHJ 4OZHE 3VXQB 5EOCL 4MNHA 2L0DA 1I8LA 4JM2A 5IW1A 1J1XH 1GYAA 2AK4B 5BS0D 3NACH 3MACL 1SBSL 1RFDH 4IRSC 4M7LT 3I6LE 4XPTH 3ZKSD 4OCSL 5LGKA 1S3KH 1T1ZA 1IC1A 5KJRL 3WFHB 2COQA 1F13A 1GSMA 3AB0B 2P5WD 2D7QA 3B9KD 3QEUA 1NBVH 1YQVH 1E4XH 4PRPA 5D96B 3MRFB 4YXKH 1I3UA 1RUAH 3QUMB 3OKLB 5T33L 4YDLB 5IVZB 4KGJA 2JJTA 1KYOJ 4EXKA 4ZUUB 3RU8L 5C0GB 2DQFA 4JFFE 1F02I 3UBXB 4JRYD 4MZ3A 1KEGH 4U1MA 1I85A 1SYSB 4IIQC 1FIGL 4OKDA 5JLZA 5I1EL 3O41B 4LSQL 5MEPA 3NCYP 4U1IB 2FYYB 4NQCD 3VRJA 2YKLL 5ACLA 3C87A 1S78D 2XN9A 1U95B 4HH8A 5D5MA 2P8LA 1CK0L 4U1HB 3L6FA 1MCNA 3AMKA 5DJ0A 3D3VB 4X4MA 5DS8B 3ZL4L 4YDJA 4DWHA 2JJSC 1WBYA 3RUGA 4BSJA 3EDJA 5F6HI 5DJAA 1N7ML 4AEHL 4ETQB 4HC1A 5I1CH 1BOGB 4NRXA 4LDEB 5A16A 1S9VB 3KPMA 1CG9A 3CC5B 4Y5XA 4PB0L 4F7MB 4HQQH 5CINH 1IAMA 1MHEA 5D71H 2BY1A 3EAKA 5T3ZH 5E1AB 4HX1B 4XCFL 1IGFL 1MIML 2HT4D 3SKUD 4U1JA 3TVMD 2XTLA 4P2OC 4XP9L 1U8KB 5H94B 5DWUH 1YUHB 3MV8A 4IMKA 5MI0B 3VWKD 2FDBP 1DTUA 2VZUA 2IH3B 1MLCB 1EZVX 4NN6B 5IR1B 1YEHH 2ADJA 4KVNL 1AD0A 5K9KB 1PVHA 4QXGL 4NFCA 5D2LB 3HE6D 1X5ZA 5CJXA 2VXQH 3MREA 4QRQA 2J88H 3EJYC 5KVFH 5FO9A 2YPKB 3QFJA 4NKOB 1RQ5A 4RGNE 1RIUL 3VFNA 4KRNA 4NJAL 4YWGL 1OPGH 3VI3E 3OBAA 1EO8H 3Q1SL 4JJHA 3KPSE 5FUZL 5GHWH 3H3BC 4KZDL 2ATPB 3DXAD 3DX7A 1P7QB 2ZJSL 5EB9A 1RJYA 4I18B 4PRID 3NH7L 5L6YL 4Y4HA 4RDQG 2XWJA 2GT9A 4PJXB 4NNXB 3ULUD 3UP1A 1Y6KR 2FLBT 5CJOL 2F15A 3HE7D 1AHWB 3BE1L 4UV4L 3VFTA 5AUMA 1ZOXA 1F3DJ 1RMFH 3QJFB 2B4CC 3GBNL 1AGFB 1C5BL 1FE8L 4JM2F 4GLRI 2AJ3B 4TQEL 4Z6AT 1FBIL 4DKFH 3MRMB 2UWEE 3BGMA 3O3UN 3QZWG 4NQED 2EXWD 2YUVA 4HC1H 1R3HA 5D1QA 1G1CA 2AERT 3VXME 1I7ZA 1HH9B 1T5WB 1DN0A 3OKYA 5DVNA 2FZ3A 3SE3C 5DFVD 2D7NA 4FQXB 1TVDA 1ZLSH 1MHPH 3ZYOA 2QSCL 3FHQA 4U33A 3RZCB 1DLHB 2VXSH 5ID0B 5FYKH 4PRHE 5JHDA 1ZE3C 4MJIE 15C8H 5DQDH 4PJGA 1QBBA 5LQBH 5L2KA 1EGJA 3I2CL 3KXFA 2I9LA 1A9BB 5KVGL 1LNUB 4NNPL 3HZMA 2GK0A 2AABL 3LH2L 3DMMC 5LAXB 2AJSL 2AJYL 4Z7NF 3OGCB 1RSFA 4LVOB 5IBLD 4XCYA 4LLUA 2FJHA 4XBGA 3MV7E 5HY9B 2VITA 4LCIH 2R2CA 1FC2D 3V5HB 1NAMA 3HTLX 1EMTL 1HHIB 3S6CA 4KDTC 2XNAA 5FK9B 1YEGH 4WTZG 1UZ6E 1BOYA 3BXNB 1A6AA 3QDJA 5TFSL 1K4CA 1RK0A 1MCJA 2EDYA 4K7PH 3IGAA 4P59L 4I3RL 2ZUVA 3T0BA 4K2UL 3DGGB 4MMXC 2Q8BL 4LVNC 5EOQH 4PJAF 4LCUA 1J5OH 3QQ3B 4LF3B 1INDL 4X7TB 4AIZB 4TUJB 2DAVA 3H0TA 4G42A 1KENL 3QUKB 3ARGB 3OKKB 2VZTA 4LU5H 4TNVF 1NBZB 3Q48A 1T83C 2P47B 5FECA 1MFDH 3O0RH 3OAUH 1IT9L 5J11B 1SVCP 3ULVL 2YSSB 1JYVA 3K1KC 4NZDA 3V6ZB 2R29H 1NEZG 2F54E 3O3AA 3GO1H 4ZDHB 3MYJA 2R23B 1XGYH 3EOBB 5JHLH 3QDMA 3LS4H 1D6EA 4NM8H 3SDCC 4EEEA 5FGCE 2P48B 4ERSH 2VAJA 4X9HA 3T0DA 3T1FB 2ZCHH 1A7PH 3SE4C 2HKFL 5F71A 2EDHA 1EGJH 2YOCA 1CFSA 1ERNA 1OD9A 2XTJB 4FP8L 1YNLH 3RNQA 3R4DA 3OG4B 4YHNB 1LGVA 3MUJA 2OR8A 3FRUA 1MVFA 1EH9A 5I1LA 4YR6B 5C0CB 4Q9QL 2VDNL 2NY6C 1DBJL 4Z18A 1FGVH 3K74B 3SOBH 3CMGA 1PD6A 2EYTA 5GISL 3UYPA 4F7CA 4N0YL 2VN4A 1FO0L 1L9NA 1NAMH 3RVVC 5C0DA 5A40E 3SDAD 5KSAB 1ORQB 4ZPTB 1N3NA 3MRNA 1U91A 4YGVA 5KSVB 1CI5A 4X9FA 2CLZA 4JO2L 4NN5C 1OAZL 1VGEL 3G5XB 3PJSA 4U6VL 5HVHB 4UIKH 1SEQL 5EO0B 3QWOB 3S37L 5DD1L 1KGCE 1UWEL 5CIPB 5JTWA 5F9WB 2X4NA 4JHAH 4XVSH 2PXYD 4X6CA 1HILA 4XX1E 1G7HB 4TRPL 1VKXB 5DQ9B 1OTUC 2NY2D 3PGCB 1XGTB 2FATH 4JLRB 4LFHD 4LEOA 2V9RA 2Y5TB 3T65A 3TZVD 1KIRB 2GSIA 1Q9WA 4KRPC 1U8NA 2AGJL 3PDDA 4L5FH 3IAQA 2HLAA 4GS7B 1LE9B 1QD0A 2IBZX 3L3GB 5IGXL 3TPKA 5EBLA 2ZUQB 3LEVL 2VZSA 5DJ8B 3UPRB 2D3VA 1YNTB 2BJMH 3ILQC 4JKMA 3VCLA 1I4FA 1QRNB 2AJXL 5JA9A 4R7DB 2D7TH 1MHHB 3JWDC 3MRGA 4K8RC 4MNGE 5JNYB 4Z7VF 5C0BB 2AQ2A 2X10A 4JPKH 4OCRL 5I16A 2DWDB 4JPVH 3FQTA 1JTOA 1IEBA 4M5YH 2C5DC 3RGVA 2A9MH 2EIZA 4PJIB 3X13A 4F37K 2MMXA 3O6LH 4KVCH 2X4OB 2N1KA 5F6IB 3I02A 3QDHA 4NZRL 5HI3D 4G3YH 1DBKL 1NCAH 1LILA 5HGAA 4ZTPH 5C8JB 4G8GA 5IEKB 4U1NA 1PZUB 4IRJA 3HNTL 2E9BA 4Z7UB 1AGBA 4MQ7A 5JDSA 1F8TH 2ATKB 4JGMA 5FYLH 1LK2A 35C8L 4JFQB 3ARBA 5DJCB 3LMJL 1UACH 3VU2A 3QDAA 2FCBA 5T5FL 2MNUA 1DBML 1CFBA 3QI9A 4WWKA 2KQNA 1CQKA 3WHXB 4ODHH 1OW0C 3RWFA 2BFVL 4KK5C 3NVQA 4RAUB 2GTZA 4GRMB 4YPJA 3O45A 5CJ8A 2F8VA 3QDGB 3AUVA 2ID5A 1JHLL 4NRYA 4JQXA 4DKEH 3VA6A 4GW5B 1YYML 2VC2L 5I0DA 3MA9H 4P4KD 4OF5A 1ROWA 4N90E 1YNKL 1UEMA 5F1OB 3FQXA 3L7EB 4HKZA 2Y4SA 4QHUB 3RVTC 5TE7L 4PJ5E 1C5DA 5ICXB 1YY8B 4UIMA 4F3FB 1U0QA 1MWAB 4U31A 2VLRB 4H26B 2V5YA 2IMNA 4J3XA 3C6LC 1KBGL 4H8WL 4OM0L 3GMPA 3QWRD 1KFAH 2WIIB 5EU6A 1HQRA 4HKXA 1IC4L 2UWEB 3GKWH 3D87B 3BT2L 1CE6A 4FQJH 1FNEB 3EOTL 4K3DL 4XNYH 1J05A 5FDYA 1GPOL 1QSEA 4R4BA 1FZJB 4G7VH 4XAWH 2IJ0C 1EAPB 2Y72A 4K71C 3WLWC 5CBAA 1F42A 3DO7B 5KSUB 5KVDL 3CMOL 5E8OB 2DM3A 2BSED 3ARXA 2YK1L 2HJLB 4QLRA 4X6CF 3NIGF 2ZPKH 5DF0A 5J0BA 4MJIB 3OKMA 4TTDD 1U2CA 3WXWH 1JMZA 2EDBA 5J6GB 4NOBA 1RZKC 2WW8A 3ULVD 2F9BT 3PXHA 4JM4H 4R2GD 3BKML 3CUPA 3RA7L 1IAKA 3BSZH 3V8CA 1FL5B 1GGTA 3BOVA 1D3CA 1EJOH 1MCSA 5J12C 2E8YA 5I1DA 2CUMA 1XGPB 3BZFB 4Z9KB 1Y0LA 3QISA 1XF4A 3PHQB 2EDDA 4OQ1A 3HG1B 4WTXA 2VNCA 3NIDE 3KLSA 1JPSL 1ZTXH 2BNQD 1CWVA 2GJJA 1MJ7L 1HHHB 3N85L 3QIBC 5HXMA 2DKUA 4XWOD 3RVWC 1MCHA 2YD2A 4Z95H 2PUQT 4RSVA 2Q6WA 3O9WD 1NUGA 4M6AA 5DHVA 4X4ZA 3OXRB 5D6DA 4FQ2L 5TGBA 3WKMH 4V1DA 2IMMA 5AWNL 1WC7A 5DK2B 3CSBA 5CGTA 5FGBC 2LABA 4NQEE 4LDOB 3D39A 2NNAA 1JGLH 1XR8B 2BCKB 4P9HH 3E6FB 1X9QA 1SYVA 4JFOA 4NKQB 4MNQB 5C0JA 3U7WL 3FTGB 1N0XL 3BIAX 3FQWA 3GI8L 1IMHC 1DQJB 1X5IA 3L95A 2X1XR 3FOMA 5IG7B 1NSNL 1F90H 2FJFB 4TVPH 5JA8B 3TPUA 3INUH 4Q6IC 4XPGL 5LGJB 3NTCL 5IBTH 1KC5L 2D0FA 3R0NA 1YPZB 3AY4A 4P46B 4I9WD 5D1ZC 2I07B 4M6NH 1QVOA 1DBAH 3L1OL 1P69B 3QXDB 1U92B 4IRSA 4FXKA 2X9WA 4HK0B 1I1AB 2FX9H 1ZWIA 1LE5A 3F58L 4F7PB 1WQVT 2PO6C 3SCMB 1GHFH 1S7SA 5FOJA 1Q94B 4PG2C 4TSAH 1RZ7H 2H2PD 4G5ZL 4HHAA 3EIFA 2I26N 3OPZL 3Q6FA 3FB8B 3IDYB 1GRWA 2IF7A 2NPLX 4HBCL 3I50H 4RGOH 1T03H 1FL6B 2B39A 1HWHB 4HEME 4ZFGH 1ULVA 1QNZL 4KRMB 1MQKH 5T1KA 3MRKB 4EQ3A 1F4XL 4IIQA 1YEJH 1U6AH 3ZKMC 5CEYA 3NAAL 1T4KB 5DEFA 3Q2CA 4X9BA 2JIXA 2XXCB 5ESQB 1ND0B 4WEMB 5DHVH 3QG7H 2BC4A 4NCDA 1FL3A 2VUOA 2NXZB 4G6JL 2EYSA 5T1LD 3QUYB 3L9RB 1R3KA 2JJSA 4CU8A 25C8H 4HCRL 3M45A 3BDXA 3ZDZF 4F8QA 2C4FT 4YHOH 4P5TC 2X4PA 2O61A 4PFEA 4EI6B 3O2DA 2X4UB 1DQLH 2AXFB 2FX8L 4GRWE 5JXAL 4OLVL 2APTA 3U6RA 4P3WA 4ZXBB 1DQML 1N6UA 1RJLA 3GEWB 4R0LB 2D2OA 1ZLWH 2V7NB 4P2OA 5CSZB 3HNSL 4PJFB 4IMLB 4DGIH 1H5BB 1VADA 2Q76B 4JG1L 5IQ7H 3V95A 3G6JA 4MHHI 3QG6B 5HVWA 3QPQC 5GIRB 4MA7L 2D7MA 3RDTB 4WY7L 1JZ3A 5I6XC 1OGTA 5J89A 1KLFA 1AGEB 1TZIA 3GBMH 1OCWH 1KPVA 3MRQA 5C07B 1HXYA 1MFBH 1Q38A 1MUJB 1G6RL 2EKSA 4U1GC 5K93A 2ZSWA 1A7NL 4TTGA 4FQCL 1ZT7B 2PYFB 5BS0B 4XMPH 4PY8J 1J8HA 3S35H 1N8ZB 3S96A 5KBNC 1G7IA 3HUJB 1CXEA 1QSFE 4WHYH 2QQNH 1C7SA 3DSFL 5E5MB 3V6OE 4TPRL 1MJ8L 4N9GB 4WI7A 3MRPB 4OT1L 3WFBH 3ZKND 3PP3H 3GSWA 1I7RA 4PTUA 3RTQD 2APXA 2P5WB 3B9KB 4NC0B 4LQ1A 4OZFG 5AD0B 1U3HC 4YFEA 1FVEA 4I5BB 4KTYA 4L3EE 2GJ6D 1BEYL 5DD0L 3QIWA 4XH2A 2NX5E 1BECA 3B9AA 5LGHH 3S34H 4HS3A 1OAYL 4JRYB 3KHQA 3QHTC 3EJZD 1BWMA 3O2DH 1EBAA 4WV1B 4Z78B 1DFBL 1WFOA 2OL3A 1UXSA 1X5HA 1CU4L 1RUPH 4XWGL 1UM5L 4NQCB 3SE3A 3LDBB 2C1PB 2NY4C 2CJUH 3OX8A 3MRJB 3U4EB 4L4TD 4LLWA 3OHXA 3UAJD 4DZBA 2LAGB 5E4EB 4PREA 4Z7WF 3IFLL 5GS0L 3C5ZD 3PV7A 2E8ZA 4G8FA 4N8PA 3VXSD 4JE4B 1D5ZB 1C12B 4AEIH 5FCUL 5TE4H 2HTLD 3GNMH 4LGSB 3UTZA 3N1QC 4MLSA 4YHKH 1WCBB 1XF5A 4QRSB 2EDNA 3DMMA 2I27N 1MAKA 3TVMB 5JPNB 4GXVH 5LWYH 2H41A 4ZS7H 1RJZA 3VWKB 1KJVB 1QFUH 2YUWA 5IHUL 5ESVB 2VABA 3HS0A 1MAML 2NZIA 4KDTA 3W9DB 5JR1H 4W6WB 5CZVH 4KMTL 4BFGA 5B3NA 2X42A 3P4MA 3HE6B 5C7XL 3O4LE 4ZFZA 2CDEB 2ADGB 3GM8A 4UINH 1X4XA 1IZJA 1JN6A 3FAWA 1AJ7L 3P0YL 4MSWA 4U6YB 3CFKA 4D9LH 4X4XA 5DD5H 3WDIA 3KGRA 4HF5L 4OZIF 2MTPA 2VDKL 4KROD 2B4CH 1RK1A 3E6HA 1NEUA 3DXAB 2FO4B 4OKVB 5L8KB 5D2LF 5IJVB 2VLLB 4PRIB 3GHBH 2FBJH 3ZE0F 4PGCA 3DRTB 2OXHA 4GAJH 5CILH 5HYQA 1ZHNB 1R0AH 2GTWA 1CD8A 4XP6L 1FJ1B 5TH2A 3MZTA 2J6EA 5CS7A 5I8CA 1FC1A 3HE7B 5ILTH 3UJTH 3CFEA 2W9DH 1E4JA 1JJUA 1NCWH 3O2WH 3MCG1 3SDCA 1KTKE 2C3VB 1IGYA 4X8XA 4FFVC 4O2EA 5D7KD 4GAYA 1EA9C 5IF0A 1L0XA 4LPXA 1MVUA 5AYUL 4XAKD 2QTEA 4PJXF 4NQEB 3SE4A 1FFOB 2IAMC 3KPPB 2ADIB 3H9SE 1QFOA 2OTUA 2G2RB 2BSSB 1KT2A 1TVBB 3DPBA 5DTFB 2QKIA 4OCLC 4Z8FH 4FFWD 4OLZL 4PJDB 3T8XB 4XNUH 3HZKA 4KI5E 3T3MF 4OLYH 1AGDB 4EBQH 5C09A 3SBWC 4BFEA 1VACB 2ZSVB 3F7VA 5C0NC 1F3JB 1JGEA 5K9JH 1JRHH 4YQXL 1A2YA 2G60H 1VFAB 5IESH 4K3GA 2EO1A 2R4SL 3CLEL 4CN1A 3ARYA 1K5NA 3N1GC 1J7VR 3BQUD 2B0SH 4JZOB 4BZYA 1CVRA 3U2SA 1GVIA 5T3XE 4JKPL 2AJUL 4Y5VC 4YBLB 3L3DA 4OFVA 1F4WL 5E70A 1V3LA 2Z91A 3CVHB 3DRQB 5A3ID 3D85D 3BN9D 3FOLA 4DGYL 2ORBL 2A74B 5F9OL 3LKPA 4FQQA 2J6EH 2L7UA 4HIEA 5EULV 3SJVB 5J13B 1UB5A 4Z76B 4KQ4H 3QEGL 3ZZ1A 2WNGA 1J0HA 2DL9A 3KR3H 3U0PB 3VXUE 4AM0B 1IILE 3OKNA 3RQ3A 2AI0L 5J1TC 1JZ5A 2G9HA 1B88A 1JYWA 1CTOA 4HLJA 3EDEA 3ES6B 3BPCB 1RZGA 3QRFM 2IADA 2BERA 5TF1H 3VDAA 2FGWH 2V7HA 1N5AA 5E24E 5DEGB 1MRCL 1EERB 4DUVA 4GRWB 5KOVC 2F74B 4Y89A 4A6YA 4PTTB 5DSCA 5HVGB 4LKCB 5T1DL 1W0YT 1X5GA 2OMNA 3UTTD 4PGZA 4I9WE 1E6OL 4MDIA 3UCRA 2HG5A 4K94C 3HA0A 1P4BL 4KJWD 5DRXB 1QQDB 4EKXA 4O2FA 3PV6A 4YDIH 3QQ4B 2ESVE 3R06A 4KKBC 1BJ1H 5HGDA 1OSPH 1D5IH 1VFUA 2MQCA 4WO4D 4NBXB 4YHZL 2AJZA 5B3JE 4JO3L 3WFEH 2G75A 4FZ8L 4Z5RA 4M7JL 5EUOE 3X17A 1DSFH 4C4KO 3KPSA 2QQLL 1N5YL 4IBLT 4WFGE 4PJ8C 5I17A 4N8VA 1OW0A 1MQ8A 1UM6L 3V6OC 5DJZB 3CXDH 3NA9L 1X5KA 2A83A 5JW4R 4JVUA 3HAEA 5TPWL 2WUBH 2Z0BA 3GDBA 3SDAB 5GS0D 2UVEA 4PYHA 2VIRA 3QEHA 5JXED 3ZKQD 2LE9A 3H7LA 2ZOLB 1MRDH 2UZXB 4OZHF 1ZA3A 1M6OB 3TYGH 4LAJH 5EZIL 2PXYB 3WIFA 1BFOB 1IGJA 1M05A 4MB5A 4QWWC 3C6LA 5IVOA 2WSKA 1VB9A 1T20A 3JWDH 5BOPA 4K8RH 2IG2L 3ULSB 3CDGB 1JF6A 3TZVB 1CFTB 2VZ1A 4KK8C 2YRLA 2X1QA 1TCRB 3TO2A 5HYSA 4MX7B 2NXYD 1XIWD 3TBWB 5DMGC 2EIDA 3SDDD 3G5YA 1PW3A 1QYGH 5HHQB 4PRHA 1HSAA 4A6YH 4DN4L 3AXLA 1IAIM 3BVNB 5F88B 3EDDA 3MA7A 4GSDL 2ZP0T 4S0TD 2BOBB 1IGCL 4RIRB 2A9NH 3ECBB 3L5JA 4KTEH 4FQHA 2VQ1B 4HKBB 4XP1L 5E2UL 3QBTB 1WT5C 4S2SB 1VPOL 3MV7A 5I76B 4R26L 1U93B 1IGMH 1KPRB 3EYSL 3BUYB 2WM0A 2WZPD 4MDJB 4F8TA 4PLOB 2QQKH 5F9DC 4F2MA 3RWHA 1Q0YL 2C4XA 5IW3A 4JFYA 1A3LL 5ISZD 1VESA 4TSCH 3HAEH 4X80H 1DBBH 5FYJU 2YBRA 3ZDXE 3BPLB 4PJCB 2MHAB 4E0RB 4LSRL 3OKEA 1X4ZA 2QBWA 5SX4I 4CN6A 3TFKD 5IM7A 5GGRB 3QIBA 4GG8A 2CKBL 4HT1H 3VWJD 5HDOA 3QNXB 4OBRA 5HHOA 2FNBA 3O6FD 4QCIA 4FQIL 1PBYA 4H0IA 3S36X 5KW9L 4JDTH 2QR0A 3RWGB 4PGEB 3BKYL 3LRGA 3D0LB 3TWCL 5KSBE 3GIZL 5C0IB 3SKMA 3L7FA 1CTNA 4NN7C 1D5MB 4ELMA 5EIQA