3SGDI

Crystal structure of the mouse mab 17.2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
218
structure length
218
Chain Sequence
DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGSHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light Chain
publication title Crystal structure of the complex mAb 17.2 and the C-terminal region of Trypanosoma cruzi P2 Beta protein: implications in cross-reactivity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 57
structure length 218
sequence length 218
chains with identical sequence L
ec nomenclature
pdb deposition date 2011-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgdI02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgdI01
1TJHH 2OR9L 1DE4B 1NCTA 4NUGL 4NKMA 4G43B 3FQTA 1MF2H 2EIBA 2GW5A 2EEDA 3VRJA 1MCWM 4X7SL 3VWKA 2YA1A 3LRSA 4WO4C 3GMLA 3QEUB 3AAZB 3ROLA 4UB0H 5K9JH 3OKYA 3UZQA 3GFUA 3TT3H 1KLFA 2ICWI 1CDCA 1F6AB 2YPLE 1IM3B 2W0PA 5L9DH 5DJDA 2APVA 1B0WA 1EDQA 3B2UC 3KYNB 2I07A 5ANMB 3RX7A 4MB3A 3WIIL 4EKXA 1QLRA 1B4RA 1DQJA 1DQQB 1NEUA 2F74A 4R4NC 3S5LG 1PLGL 5IESL 1I9IL 3V5DA 3BQUA 2D7QA 3MV9B 3O4OB 2JJUA 4LPTA 1P6AB 4R8WL 4D0DB 1DQMH 2EEBA 3T0AA 3EW3B 3VI4E 3P40A 1WSST 4NUGH 2OK0H 3DRQA 4BQCA 3FRUA 3SGJC 3KAAA 3T1FB 4LQFH 3KPPB 3MRRB 3UTPD 1FH5H 1AFVH 3S97C 3IDJA 1WV7T 2NY2D 3LKOA 1YC8A 5EC2A 3O4LD 2OSLB 4FQXA 4QF1A 5ESAB 2R2EB 6FABL 1V3LA 1IAIH 1FBIH 2FR4A 2YUZA 5BZWA 5EO1A 5HHVL 2YD6A 3ILPA 3IU3A 4YJZL 5I1CL 2CLVB 5EBWA 5DD0H 5LWYH 5M7QA 4Y5YC 4R7DB 3ARGB 1HI6B 1LK3L 5K9KA 4NZRL 4Q7DA 3IJSB 4R0LC 1YMMD 4Y4KC 3QWRA 1D6VH 2HKFH 4HBCH 1BAFL 4JFYB 4HUMB 3KJ6L 2XOTA 5I66A 1G1CA 1H3WM 2WBJA 2VLJA 4NNPL 5MP6H 4ZUSA 3PL6B 2CUMA 5EU6D 3QULA 4U05A 1EEUA 4LLWA 3T8XB 2B4CH 1MRDL 4RX4D 3UO1L 4PJCA 5KVEL 4DTGL 3ZE1E 5T33L 3VFSB 2CUIA 4GS7C 4HFUH 4M4PA 1T6VN 4AL8H 4LLYA 1IZKA 5D1ZA 1C7SA 4XWGL 3W0WB 4OZGB 3TJHC 3K8KA 4TUJA 2NXZC 4LCUA 2XWTB 1XZ0A 4MX7B 1W0WB 2V5SA 4YBLB 4I0KA 2VXVL 2IF7A 5DMGD 3BGFB 2C7UB 3ZZ1A 5IIEB 2HT3D 2EH8L 4D9LH 4J2XA 2X40A 4IMKC 4OCRH 1HIMH 2ESVB 5SX4H 2B1HH 5B39G 4LHQB 3HKFA 4HIHB 5DRZB 3EYSL 3MLZL 1W72L 3CX5J 4XP9L 3ZYZA 4EEEA 1ZLWK 4ZODA 3SCMC 3CU1A 2CKBH 5C0BE 3QIUD 5D8JL 3DYMA 4KKCC 1ZE3C 1RIUL 3NFSL 4NM8H 5KJRH 3ARZA 4MS8D 4ELME 5EC1B 5J6GB 1V05A 4EQ2A 3FZUD 3MJ9H 1S78D 3CVIH 3AMKA 3TNMB 4U6HB 1DBJL 2BNQA 3TA3C 3IDMA 1NH6A 1ZHLB 4JFDD 2HJKB 2P47B 1RIHL 2BJMH 2DLFL 4XHJC 1VGKA 2F54A 4F7CA 5BV7C 1RHHB 3MOAH 2OQJB 1WVZA 5C0AE 2F5BH 4KPHH 4ZXBA 3H9HA 3I50H 1KNOB 4MA1B 2A74A 2GITA 1I85C 3CLEH 1MAKA 5ACLA 3HC3L 3CFCL 3PJSB 5GRJL 4FQIH 4XWOC 2XNAB 2DI9A 4U1SB 1EGJA 4XCCH 1H3UA 1N7MH 2EKJA 2YN3A 4WUUB 2MTPA 2MWCA 4NM4H 1KIQA 4KC3B 5ID0B 3F58H 3V6OE 4JRYE 3PHSA 1FFRA 4I48B 2GSGA 4XB8A 1FVEA 3CVHA 2C3GA 4U1IB 4TTDD 2BNUA 3RTQD 4PJ5B 1OWRM 5DJ2B 2N7AA 4PG2C 1IKNA 4NJ9L 4HPYL 5KSBB 2DWDB 5JW5A 4PRAA 2PYFA 4Z7WF 4E41B 4Z9KB 5EU5A 3BEVA 1DVFB 5DHVB 4NQDD 4GO6B 1MAML 3VRIA 5JLZA 3GDBA 3LEVL 3KPRA 2Z31D 1F6LL 4P59L 4X7TB 4HCRH 2RIKA 2ZNXA 5DJYA 3WEXA 3MMEB 3ARXA 3RGVD 4TN9A 4XXDB 4ALAH 3MNZA 1FHGA 4P2RD 1CFSA 4X8XA 5FM5M 1HYSC 4YHMH 4AIZB 4XT1C 2V6HA 1UG9A 5KZCB 4N0FA 4O2CA 3P77A 4J3OC 5F7FA 3C6LA 4OFVA 3L5WA 1KT2B 3QG7H 2MHAA 2XWBB 3WV0A 4KXZI 4QTHB 3RWFB 4Z7UF 1CGSH 1U8HB 1XCTB 2PCPB 2EIEA 1F58H 3TIEA 5HHOA 2PYEB 3DETD 3OTTA 5FYKU 1K8IA 5GGRY 1D5IH 4H0GA 4RMSA 2BC4A 4FG6C 1BBDL 2C1OA 3R1GH 4RMQA 5DURD 3BSZL 1U8QA 3I6GA 4TRPH 3X14A 3KVQA 1F3RB 1P9MA 4JFZL 2R1XB 4RIRB 2PO6D 2B5IC 4PGZA 5DRNB 2P5WD 1CLYH 1JN6A 4OCYL 2AQ2A 2BVPA 4WUKH 3STLA 2NZ9C 5TF1L 4JG1L 1RUKL 2QTEA 2VNCA 1B0GB 4JQVA 4M6OL 4PJAA 4W81A 4V1DA 4APQD 1FV1B 5B3JF 3U4EB 3T0VA 4CADB 1DSFL 2BY3A 3FQWA 4PLKC 4POUB 1OHQA 4G5ZL 4LLMB 3AREB 3IJHA 4NC2B 5KG9A 1EPFA 2FHBA 1P7QD 1KTKE 4LPCA 3FHQA 4EVNB 2ZG3A 1YEKL 3PHQB 4C55A 3BE1H 3WNMA 3ILQC 5ISZE 4PTTA 3IF1A 1MFAL 2EC9U 2OJZL 2H2SD 1J1PL 3TV3L 4NN6B 1FFOA 3PWVA 2R1YB 5DFVC 3O41A 3CU7A 1XGYL 3BP7A 3PWPB 3MJ8B 5AZ2H 4GQ9H 1UVQA 5BVPL 1BX2B 3MLTB 5DUMH 5BW7A 4WI5A 3SDAA 3KYMB 1AQDB 4ZFOL 4JGJA 4TUOA 3BZDA 2FLRT 3REWB 4WHYG 3D85A 1U42A 5TFSH 1HCFX 3L1OH 3VG9C 2DBLL 3C5JA 1X5HA 2WBWB 3KXFE 4MJIE 4RBPH 5T1DH 3LV3B 3TP4A 3VXRA 1NJ9B 1B3JA 4FA8A 2AJYH 2NY6C 2I5YH 1YEGL 4HUWB 3QXAA 4HXBH 2QBWA 4EN3B 4TPRL 3ZHKA 4XNYH 2EC8A 4HKZA 3CDGB 1MCHA 3RVTD 4PJXA 3U46B 1JHTA 4NQCA 2HJLA 3UPRA 2GJZA 3HB3D 4MDJA 1VFBB 3T4YB 4JDTH 2P48B 3V6BR 5GSRA 3BW9B 1I8LC 2Y5TB 3IDGB 5F1IB 3I9GL 3PXHA 5INCA 5DZLA 4TSBL 5E5MA 2WQRA 5FYJH 1SEQH 4KAQL 4UOW1 3HNSL 3UTSE 5DS8B 1X4YA 4JLRA 2A6JA 4MWFA 3UTQA 2HKHL 5DHVH 2P7TA 4HDIA 2EO1A 4O00A 1A02N 1EMTL 4P3CL 4TNWF 4H8WC 3ZKMC 2QLVB 3MLSL 4N9OB 1CXLA 1QVOB 3SKNB 2YEZA 3CZFA 3KPSB 5FDWB 5AZEH 4JY4A 5I8KH 3UTTE 3GHBH 2BVOA 3ES6A 5I74B 4PY7A 3EJJX 4W6XB 1EO8H 1RPQA 4ZDHB 1YQVH 5JHLH 3IFLL 5DEGB 3VH8A 4G8FA 1CDYA 5I2IB 5FAAA 5SV3A 4TQEH 1EFQA 5AAWA 5J11C 4BM7A 5FECA 1DBML 2FWOA 2QSCL 5D7IE 5JO5A 3SDDB 3TO2B 5IEHA 4GG6E 2EZ0D 4Q6IC 3ULUL 2MJWA 1DEEA 2XG4A 2H26B 4YIQA 3T65A 5ILTH 1TVBA 2E27H 3BX7C 4RAHA 3DGGA 4JZJB 1LEKA 1I1FA 1MCEA 3T0DA 4CVUA 3RWDA 4JFFE 5DHXB 1N4XL 1TQBB 5ALBL 3WDJA 1YJDH 5EUOB 3B9KB 2IFFL 4PJ9C 1W0YT 2ZSWA 3O6FA 2B7DT 4K3EL 4B0MM 1JMXA 4ZG1A 3LQAL 1A9BA 5ID1B 3HE7C 3I02B 1FO0B 2ICWJ 1A0QH 1T21A 2DTSA 1CDIA 1KPRA 3WHXB 4KK9C 3MRHB 2PN5A 1XR8B 2WP3T 2UZIH 4X9GA 4GRLD 3FMGL 4GG8A 1XAUA 5E8NB 2DQDL 3U30C 4ERSL 2HVKA 5EULV 1GH7A 3DHJA 5DRWB 1MHCA 3RVXD 1A2YA 5JDJA 4ZSOE 3O45A 3OX8B 1KB9K 1YY8A 3U36B 5F7HA 1Y6MR 4I18C 2D03H 3CFKA 3D3VE 3ZE2E 1OAQH 1J0ZA 1OT2A 2MNUA 2W9DL 2AV7A 3QJHB 3T77A 2YZ8A 4KJPD 4KZDH 4OQTH 4GBXA 2D7PA 3KNBA 3CFBA 1I4FB 3N1GC 2X89D 4G9DB 4RMVA 1ZVSA 4MVBC 3S98A 1FYTB 3BH8A 1DLFL 4KQ4L 4NP4H 1XR9A 4TULL 1MRFL 1FORH 5IQ7H 4L4TB 4HD9A 2CDEB 1MCIA 4QHKI 5JR1L 2BXZA 4DGIL 1BQHG 3ETBF 5JDSA 5I1LA 1Q9LA 3IDXL 4CU7A 3DJ9A 2WWKT 1AD9B 2R1WB 2ZUQB 5HYQA 3LPWA 5C6TH 3RZCA 4MD5B 5EUKB 2H32B 3QQ4A 5IT2L 4NC1E 1JYVA 5C6PB 2Y72A 1ZGLP 4Y5VB 5SX4I 3WIFB 2D2OA 3O6KH 4NKIH 5E6IB 5MEOA 4ZO8A 1AE6L 1E4WH 4FQLL 3RVWC 3A6CH 3TFKD 4Z7WB 4P4KC 3WSQH 4KKAC 5DD1L 2IBZX 5D93C 2FO1A 1FAKT 3HE6D 4LPUA 4MZ3A 3DXAB 5C0EB 2ERJB 1TCRB 3QI9C 3P3YA 3VDBA 3CK0H 4M43L 5CJOH 3KLAA 3B6SB 5C0JA 1U93A 4G8GB 4BFIA 4EZMA 3RVUC 4G9FB 4JFHD 3MXVL 2WV3A 4WHTB 8FABB 3JTTA 5MENE 1ZA3B 5I8CB 4HKBA 2A9NH 3LAFA 4F8TA 3Q48A 3MV8A 1K4CA 2CRIA 4JM4H 1IRAY 2XZAL 3U4AA 3IJYB 5HGAA 5E4EB 1NCDL 4WW2C 1AR1D 5KSUB 4XI5C 4LEOA 4UTBL 5IB5B 4JEGB 5IFJA 1EHAA 2OBGA 4PB9H 4OZFG 4MHHI 5IVOA 1M4KA 2ILLA 3DTXB 4N0UA 2RGSA 2QHRH 1CU4L 3P0VL 4ZMAT 3FJTA 1J0IA 1OAXL 4NCDA 1OARL 2FCBA 4HJ0C 4EI5A 5IMLB 4NKOA 4Y4FD 3FFCD 3WLWD 2DDQL 1MJ8H 3N1PC 3O8XD 2XZQL 4KI5E 4OV6F 1FO0H 3S37X 5C0RH 3TVMC 3GBLA 5LGJA 2QQLH 3GSVA 1C08A 5T5FL 3LKRB 4LLUA 2A83B 3NABL 2WWMD 5I1KH 2YPLA 1LO5A 3OZ9L 4X6EB 3ZYOA 4YR6B 3DX6A 3WFBL 1UEMA 3Q2CA 4U0RB 5BOZG 3JV5A 2Y07H 5GRUL 4RBPK 1MLCB 3GMPA 4ZQKA 5IQ9B 5C0CB 4MAYA 5EOTA 4CDHA 2CJUH 3DRTB 3G5YB 3VD5A 1B9ZA 2FEEL 1QYGH 4TVPE 5B38G 1CFTB 4I0PA 4XTRC 3X13B 1JJUA 4ZO9A 5FB8B 1CFVL 3RY5A 3PNWA 1N8ZA 1EGJL 4HK0A 3VGAB 4PRIE 4L9LC 1RVFL 2R0ZH 3FTGB 3V7MA 4QGYA 1L7TL 4GLRI 4PS4H 4QRUA 1FSKC 4ODTH 2XWJB 1KJMA 4C59B 4WTZA 2W91A 5GGSA 1JVKA 1G9NL 2AK4B 3OR7A 1T1XA 2HRPL 2DM4A 4KTDH 3CVHL 4L8SA 1T22B 1A1MB 3SGDI 2XY1A 2DYPA 3LN4A 5DQDH 2IANA 3KPOB 2ZCHL 2W38A 1JZ4A 4HG4K 1HSAA 1NCUA 2MOVA 4L4JA 5FHBH 1DL7H 5I6XC 3LKNA 1AKJA 1JGUL 1J0HA 1BFSA 2VL4A 4CMHB 5D1QC 4F37K 4HS3A 1N5YL 1R5WB 2AXFB 3JWOL 1RK1B 4HZLB 4K8RL 3AC0A 2BOCB 2H32H 5EG6C 3QPQD 3DGCR 1IBGH 5FKPA 1IC7H 2R9HD 4GAJL 5T5NF 2LTQB 5CEXB 2H8PB 4HUNB 3ZHDA 5F7WC 2L4OA 4TUKL 3WFHA 4Y8DC 4MB5A 5DVKA 3QEUA 2DQGL 2G9HB 5TDPA 5FUCC 1Q72L 4UQ2B 5HJ3B 4YHIA 3KWWB 1IM9A 2YD5A 4N0YH 2QHLA 3NZ8A 5TGBA 1I1AA 3K4AA 1N0LA 2R2BB 4AMKH 4JREB 1G9ML 2ZCHH 3C60B 3Q3GA 1U8OB 3MV7E 1QQDB 3OG6B 3SDYH 4OFPA 3TIDB 2IH3A 4MLIA 3BQUD 3AS0A 1UXSB 3GGWB 3EOBA 5AWNL 4JY5L 3L3JA 2ZP0T 4P2YA 5DI8A 1TQCB 3L3DA 3GMOB 1S9WA 3QCVH 7CGTA 1DQLH 4H5SA 1AD0B 4AEIL 2DTMH 4GAGH 5FYLH 3KLHC 5DMJB 3HG1D 4UINL 1MUJB 1QPPA 4C56E 2JCCA 1MCWW 4ENED 3REVB 5GGUB 3QO1B 4YC2B 5IHLB 4FQXD 5D1XB 5T1LB 2JLLA 4B7IA 3MRIA 5HYJE 5C0BA 2ITDA 1G7PB 3QDAA 2XQBH 3I3BA 4GXUM 1RJZB 2ENSA 1T03L 5CWSA 4H1LB 1S7QB 2D7OA 1H5BB 3HZKA 2PW2A 4UNTA 2VZ3A 1B6DA 5FUOH 3W11D 4XNQB 3OWEA 1Z6JT 3HCVB 1BF2A 1T1WB 3L3OA 3MGOB 4HPOH 4NO3A 2WBJD 2VLJD 1D5MB 3TBVB 2EECA 2EXWD 2X4RB 3FB6B 1I9JL 4DGVH 5GISL 2F8XC 4LLDA 1NGPH 3AS1A 2P42B 4HS8H 3RUGF 3BOVA 3Q6GL 4M02A 1TJGL 3E8UL 5FF6B 1JWMB 1GIGH 1ZEAH 1H0DB 5HHME 2IBBA 1MQ8A 2CLRA 5C0AA 2JJWA 2VLKA 1A47A 3MBEA 4M8QB 1M05A 1GGBH 3GSRB 1E27A 3GKWL 1FE8L 4BYHA 5FYKD 3QQNA 4U6XB 4LFHG 3ME0A 3ECBB 3K7UA 2IGFH 3N85L 4O9HH 3C8KA 4P5TB 4J3VA 4ZUTA 2DB8A 5E4IA 4YHZL 3QIWB 5E2WL 5HPOA 5EZJB 1JWSA 2AJUH 1WBYB 2CMRH 4HC1H 3V6OA 2AGJH 5FKAB 3WNNA 1N6QL 4JRYA 1JZ7A 5T1MB 1FJ1B 3KHQA 1R5VB 1YNTB 3IGAB 2KKQA 1J5OH 3BP5A 5IFAH 4HWNA 3SN6N 5CP3A 4WY7L 3NZHL 4W68A 4QOKD 3VGGA 5D2NC 2W0LA 1AGFB 2MKWA 4NQEA 3U0PB 4QRSB 1RZJC 1CXHA 4JE4B 1M6OA 4ZFFB 3AUVA 4JZNB 1INQA 5IHBA 3TBWB 3GMMA 3GM8A 1J11A 4ZNCD 1VKXA 2ATPB 3H9SB 1AGEA 4YH6A 3TO4A 4NWTH 1KTRL 4L4VB 5DWUL 5IEKB 2QR0A 5J6GA 4RFOL 4PJHB 3U6RB 4QRPD 1RZKH 4OJFL 4YE4H 1RZGA 2NY1D 4ODXB 5IBTH 1CL7L 2B2XL 4OGYL 2I26N 3FAWA 2F54D 4ODHL 3VG0H 2C3HA 2DJUA 5H94B 4PLNC 5DSCA 3BN9C 2P8MB 1NCCH 4NHUB 3UROR 4KWUA 2Q86B 3SE3A 3D9AL 4ZXBD 4S2SB 1NLBL 1CZ8L 3QA3A 3F6IA 4YNYB 1OGAE 3T2PA 2E6JA 3WJJC 3MR9A 1MVUA 5MEPB 1HXMA 1UCBL 4GMTH 1TPXC 3QG6A 5D7JB 1BJ1J 3INUL 5I17A 4PRDB 4QHLA 5E6YA 5CJ5A 1B2WL 2ADIB 1UENA 3ARDA 2MMXA 4OLVL 3ULVH 3DHMA 4P2OB 4I2XE 2VDPH 3SY0A 4Z76A 1OTSD 2JKXA 5GS0H 2BNRB 4OI9A 3QDJE 4L3CB 3Q5TA 1NAKL 4CMMA 3GBNL 4MNHA 4OGYH 5LVEA 2Z93B 4F7TB 4KKLC 3SPVB 3C9NA 4IHOA 5B8CB 2QL1A 4RDQF 3RY4A 4DVRH 2BY0A 5IM7A 1FZOB 4U1IA 4PY8I 3E6HB 3KR3L 4HJJL 3PQYE 4LASL 3OBAA 4OT1L 3EZ8A 3ZE0F 5HY9A 5DJ2A 3GSNB 5EB9A 5CCKL 2WLYA 4H1LH 4L29B 2A6DA 2ED7A 3KPRD 4Y19B 5FO7A 1VFMA 4K8RD 2DQJL 4R96A 1G7LB 2LU3A 1ZLUH 5ISZA 4AEEA 1JIBA 3I3EA 2E8ZA 4M6NH 1P4IL 4YDIL 3IU4L 1M1SA 3WS3A 2AEQH 1CQYA 2PTUA 3RX5A 2FGZA 4OGXH 4XBGB 5IFHL 4KTYA 3VDCA 3MNVB 4R4FL 3VXPA 4XP6H 4HS6B 4FS0A 4YBHA 5FXCH 3CLFH 5I1EL 5HDQH 2O26U 2M1KA 1NBZB 1P84J 2NQCA 5D7SL 1GOHA 4QHKJ 3VXTA 3B9DA 3GI8L 2IBZY 5IVXF 3H7LA 4LKCA 4FFVD 5IBLD 4QTIH 4MJIA 1SBBA 5HHOD 2C4FU 1YYLH 4DKDC 1A4KB 4YHKL 2VJXA 4UILH 4D9QE 2R0WL 5JW4M 3CFEB 4ZFGL 4Z7QE 4X9IA 5FGBC 3DYOA 1LP9B 5KVFH 3QIBA 2R1XA 5I71B 4TSCL 4G3YH 1T5XB 4FZEL 4X7CC 5TDOA 3STZA 3VXMA 2CD0A 3GSUA 2Z9TA 1TNNA 3C2AH 3O2WH 3V8OA 2E6PA 5T3ZH 1I7ZB 4V1DD 1MCJA 3UTSA 3P4OB 3SGEI 4LVNC 1U8MB 2Q3ZA 4K2UH 4HKXA 2DLHA 1NUFA 1NFIB 1DBBL 4XNMB 1U8JB 5KOVC 2P8LB 1XEDA 2FRGP 1QNZH 3GBMH 3RWCA 3MGTA 2EEAA 5ICZA 2EYSA 4WO4B 4PLJC 4ZFGH 5DTFA 3CMOH 3UTTA 5AUMB 4YDLB 1JF1B 4JZOB 1X5ZA 4OZ4B 1WFOA 4U1MA 2FL5A 3QDHA 1KN4H 2APWA 3UJIL 5F9JA 4FXKA 4L3ED 3GSWB 5D7IA 3SDAD 1NMCB 4GKNB 4HUUB 3VFUB 2VERN 3MLTA 1QFOA 4HUVA 2AJZB 1EJ6A 2EDJA 4JPVH 4F7EA 3D85D 4TSAL 1JTOA 2ZG1A 3U1SH 4WVRA 2I25N 2F19H 5EN2A 5DJZA 3VXRD 4JFFA 3NCEB 4JKLA 3LS4L 4J3XA 2HMID 3DSFL 4ODUA 3WXWL 1O7SA 1LWRA 4QHUB 1OAZL 1RFDL 1EHXA 4NQCD 4IRJA 4NJAH 3D0LB 1GHFL 2Q3AA 4YHOL 3RX8A 4G6KH 3EDEA 2MQ3A 3T0EC 2EDKA 4JPWL 5I8EA 3BW9A 4Y4KB 4XGZA 1A7PH 1RUPH 3NPZB 2ZUUA 1AGCA 4K7PH 3GSNH 5JOPD 4IRSA 4GMSH 1A6VL 5L7XH 4HF5L 5FGRA 1F3JB 3PUCA 3VXSE 4LK4A 5L8KB 3SKUD 1IAOA 1BPVA 1ZLSH 5D6CA 3FN0L 3LDBB 1U3HA 2FEEI 3BD4A 3FHAA 4GS7B 1SJHA 3OHXA 3SKNA 4OV5B 3I75B 3RUGB 1G7MA 4PJFF 4ELMB 5EZLB 1NEZB 4DUXA 4OM0L 1M7XA 1Z0MA 5LAXA 1ZMYA 1IE5A 2BSSB 3NCMA 1MRCL 3R8BB 4K9EL 2HFTA 5IBUB 1LK2A 4JPWH 2QADD 2O5XL 4MHHG 3B83A 1HDMA 2AJVL 1PJ9A 5B22A 4PP2A 5J6HB 2NCMA 2HRLA 5C09A 1KB5A 4NO2B 2AJSL 1IGCL 4IJ3B 4C4KT 3TN0C 5CBAB 1FVCB 4GUPA 3C08H 1OW0C 3DX8B 3EOTH 1WZLA 1M7IB 4EDWL 4IOSD 1R0AL 5FOJA 3HR6A 1S7UB 3L3KB 1WC7B 4JM2D 3TM6A 1G7JB 4RGNC 3IYLW 1PY4A 4MCYB 4HGKC 3SDCD 1FNFA 3HNVL 1S5HB 4O5LL 4ZUVB 3QQ3A 1IGYA 1CF8H 3ZDYE 3KYOA 4JRWA 3DPBA 1RIVH 2A6IA 4KK6D 1Y0LB 2J2ZA 1YEJL 3HMXH 2XPGB 3VD4A 2DQUL 1R3HB 1PG7X 2E3VA 3OSKA 2VQUA 3VXUE 4AYFA 1XF5B 4KZEH 4TNWK 1CFQB 4UMGA 1VFAB 2R4SH 3E6FB 2FJGA 1WCBA 4PV9A 3NCYP 4X4ME 5BV7B 4ISVA 1UKTA 1NKOA 4OZIF 4G8EB 1HILA 2KZ1B 5GHWH 4F3FA 4O4YL 5M95B 2GJ6B 2FATH 5MENA 1F4WL 4GBXD 3DV6B 4CGTA 1YNKH 2D7TH 3UDWA 4PG9A 5CSBA 5CJ8A 2HLFC 3UTOA 1JK8B 5IHUL 3T09A 5FOBA 3Q1SL 4KUZH 4UIMB 4NO5A 2AXGA 1CG9B 3EO9H 4PJ8B 5L2JB 3IETA 4DUVA 4GKSA 3RGHA 1QBML 2JB5H 1N64L 4OKVB 5DFTA 4JG0H 4J3TA 3RIAK 1JGDA 1FYTA 4WWKA 5DHYA 1NUNB 4GW1A 4YFLI 5F1NA 3DROB 1OTUC 2BHUA 5CSZA 4V2BA 2AQ1A 4GAFB 1X5JA 1KTLB 1T1YA 2DIBA 4PFEA 2EYRA 5GGSY 1ZLUK 3QUZA 3H0TB 1F8TH 3GIZL 5HD8D 5JA9A 3RZCD 2XFXA 2VDNH 2R1WA 5E0QA 4WU7A 4G8IA 4YDVB 3VXOB 4MA8H 4OLYL 1I3GH 3HS0B 4I9WD 1UYWL 1CD9B 3KYKL 4WFFE 3EOAA 2FIKB 5C3LD 5E8OA 4C54A 5EOCL 4KJWD 3IXAB 5FIEA 3WIFA 1YN7B 2W9EL 4P9HH 3FB8A 3QXDB 4NRYA 4TVSa 1LHZA 1A6WH 3D0VA 1QEWB 1ES0B 2NXYD 5D5ME 5ABDE 1WTGT 2VUYA 4Z7WA 4NO0B 3VFPB 4F8QA 2VLMD 1MCKA 3CDCA 4Q97A 3VFVA 4P23A 2GT9B 3QXWA 2QSVA 1U92B 4Y16A 3MA9L 5FHAL 2FX8H 1RK0B 1NMAH 3IKCA 4HIXL 1Z5LA 1V3JA 4Z0XB 4DFHA 4PRIA 4NSKA 1GGIL 3GIZH 4PREB 4XPFH 1NC4D 5B4MC 2JELH 2HFGH 4H0HB 4LKXA 4WW2F 5JXEC 4XPBL 3DUSA 3LZFH 4J4PA 3L6FB 4P9MH 3V4PH 5IKCB 4OLYH 4RNRA 3O2DA 3JV6A 3MV8D 1KGCD 5TQ0L 2DQCL 2Z91A 2WUCH 2XTJD 1SYSA 1U8LA 3MCLL 4XP1L 5F70A 1YUHA 3HC4H 2VAAA 1LO3H 1KJVA 5CGYC 2M2DA 4LAJH 1XIWC 4Z7UA 2EO9A 2B5IB 4L8DA 4Y5XC 3TH3T 5E9DD 3HAEB 4RA0C 1A3LH 4OLWL 2ZUVA 3MLRL 3O3DB 1PW3A 5DK0B 4AIOA 1YYMH 2IAMC 4ZAKA 5DZNA 3PWLB 3UBXA 3H9YA 4KUCD 1BM3L 3FT4B 1QLFB 2J8HA 1RURL 1NANH 2D31B 4D0BA 4KVNH 3LEXB 3KXFB 1A3QA 4EI5D 4N90D 1IQWH 1YEHL 3V8CA 1CL7I 1IAKB 1QBAA 1T3FA 1FLTX 1IEAA 6CGTA 1F13A 2FD6H 1BFOB 2DL2A 2IQAA 1EJOH 5DZOA 2YPLD 1KCSH 5E99L 3ZE0E 1X4XA 1DANT 4HH9B 1GPOH 1LDPH 2AP2A 3D69B 4LCWE 4UQ3A 4MAYD 5BV7H 1WIPA 2CSPA 3EYVB 3BYTA 3JWDL 2YBRB 1RUML 2NY2C 3CJJA 3ZMRA 1HHIB 4M7ZC 1P4LA 3TZVA 4I0PD 4G6AC 1YPZF 3G5YA 32C2A 2ATKA 4U1LB 4NDMB 4PY8J 3FN9A 1IEHA 4X80H 1KEGL 3M8OH 1PDKA 3WFCH 4X4YB 4Z5RB 4D8PB 3E2HC 5F6HI 5HYJA 2BK8A 2DD8L 4P3DA 1GXEA 2BERA 1SHMA 2XWJA 5E8PB 2DWEB 1B4JL 1SMAA 5IG7B 5IVXE 1AJ7H 5I1AA 4ELKB 3B5TA 1GOGA 2DQFA 4LSTL 2LAAA 2IAND 4JJ5B 3MRFA 4DKEH 2ZZUT 2HG5B 4X5WA 1FPTH 1GCFA 3RL2A 1I1RA 1AC0A 1OPGL 2E7BA 5ICXB 4X8JA 1AKJD 1NUGA 4HZAA 2F58H 1F90H 5DJAB 1U8KB 3SKOA 1S7TB 4XVTL 1IGIH 3UTPE 5HVHC 1LILA 1WIOA 2Q1EA 1HH9A 1OWWA 1G6RB 4YO0B 3RWIB 5I76A 3CCHB 1TETH 3O4LE 3OV6A 3QFJB 4K3DL 2APBA 1A6TB 3WL9B 4BKLB 1T1ZA 3RY6A 1FGNH 2GFBB 4NQSB 4YQXL 3NCBB 5K33A 5DMGC 3FONB 1IM9D 5C08A 2O5YL 5C71A 4ZS6D 1A6UL 1I1AD 3DMMA 1YMME 3BKMH 3QUYB 3RI5K 2OCFD 3V7AE 5JNYA 2Z35B 1Q9KA 1C5CH 4ZUWA 3UC0H 4PTUA 3H7BA 4AM0B 4B7LA 4Z8FH 3EBAA 2XKUA 4PJFB 2Q6WA 5J11B 2ZUXA 2JJTC 5EU6E 1K5NB 1HK6A 4ZSOB 4LSPL 1QHOA 4JRXB 3MLVL 1I9RH 3ARRA 3VFGL 4WFEE 3D3VB 3GMQA 3HFMH 5LQBL 3NFNB 4MNGE 4O02L 3FZUC 1MUJA 5MHSD 2HP4A 3N9GL 5BXFA 3G6JF 4XRCB 3X11B 5ERWB 2EXYC 3HAEH 4O51B 1OAYH 5JHDA 3F7YB 3V0WH 3RPIA 3WKMH 4PJBF 3ZKSD 1U8IB 3HE7B 2FX7L 1BLNB 2X1XR 4KV5F 1I8IA 4DVBA 3WO4B 1GL4B 2XA8H 3SDXF 2BDNH 3LH2L 1T1WA 3O0RL 5JW4Q 4GJTB 3FQUA 3WNKA 2G2RB 3D48R 4GW5A 4UBDD 3U30B 2NZIA 1INDH 1VEOA 1WAAF 2X4RA 3MLVH 2WZPD 1X5FA 1VDGA 3PL6D 1PG7L 1PKQE 4RRPA 2VLKD 4N8CH 4OCNC 1U8PB 1T04B 3MBED 5LKNA 4I18B 5ICYA 1PX4A 1OGAA 1YY9C 3ZTNL 5LGHH 1OCWH 2ZCLH 3NPSC 3JTSB 1NL0L 1S7RA 2C9AA 2IQ9L 2PTTB 4FP8L 4R2GD 2PR4L 4KK5D 5F3BA 3U4BH 1QLEL 4ACPA 5CD5D 4I2XA 4BSJA 2OR7A 1CYGA 4OCLC 3WKNA 5D2LF 4WGVB 1OGTA 4JFDE 4JPKH 4OF5A 1KPUA 4UTAH 4JRYD 4ZTPL 2YK1H 4LLVA 4JB9L 1FZKB 4R7NB 3O9WA 2E7LC 1MIML 1U3ZA 5JQ6H 2R69H 1S8DB 1KPVB 1YECH 2EDYA 3KDMB 5JPNB 4JO1H 5F1KC 3RWHB 4YHLL 4NQED 3S9DB 5GGVL 3PQYA 4Y2DB 3HZMB 4I5BB 4ODVH 4EI6B 2ZCKH 1M71B 3EYFA 5TH2B 4PJGF 4XC1L 5KANI 1LO4H 4NYLB 2FZ3A 1NBVL 5ENWB 1OLLA 3L3IA 1NL0H 3V9FA 2EKSA 4WIQA 4XNUL 3TO4D 3QEQB 1SEBA 4QLRA 4YK4C 4MD0A 4NUJA 2R56L 2NY5L 1A3RL 4OAWB 2HJFA 4P4KB 2WUBH 3EDDA 4P46C 1G6RH 1EK3A 1WZKA 2DMKA 1IFHH 1UZ8B 4MQSB 4GRMA 3V52H 2FEDC 4H8WH 1U91B 3BIKA 2ZUYA 4PUBL 3P4MA 1PAMA 2A1WL 3B8YA 5F9WC 4NQDE 4NHUA 4Q2ZB 2PO6C 1N59B 4POZD 1CFBA 2YRLA 4GOSA 1IGMH 4DKAA 1KCVL 2J7LA 1L6XA 3IAQA 1KB5L 4YWGL 1KLUB 4G7VL 1BVLB 1X4ZA 3ARDD 3P30H 5CEZH 2R0KL 1I3UA 3ARBA 4APQC 4FQHA 4LSRL 4WUUD 4P2RE 4RISH 4WW2B 3LB6C 4FQ2L 3EYOB 2P45B 1MFBL 2AI0H 2HWZH 3VD3A 4MD4B 1MIEH 3BZFB 5KOMC 3RZWA 2C26A 4G6ML 4YHPB 5EBMA 4HQQL 4HLZG 4Y4HB 1T80A 4K71C 4QRRB 3MODL 1F5WA 3CDYA 5HHQA 3SPVA 3STBA 3O3AB 4HWZA 2DQIH 5BRZE 4PJ5D 1FL3B 2EH7H 5TPWL 3ARVA 2WQ8A 5GGVY 1DN2A 5EZOH 3CUPB 1ZAGA 2CH8A 4J12A 1H3GA 4ODWB 1K3IA 3DSNA 4E41D 1JF5A 4DUWA 4FTVA 3MA7B 3GO1L 2NX5E 1MFCH 2FJHB 2P5WE 3D18A 3NH7H 3MBXH 3O6LL 4M1DH 5DO2C 3WE6A 2R29H 3CH8A 4WEUD 5GZOD 1I1YB 3PGCB 1LEIB 4OFKA 3LIZH 3ULSB 3QEGL 5DRXB 4U2ZA 4HMDA 3BH9B 3O3UN 4WW1B 2AEIT 1BWWA 3T0XA 1D6EA 4U1JA 2QQNH 4PB0L 1GGCH 3AXLB 3MO1B 2BMKA 3OAUH 4JGUA 5KZCD 3QNZA 3DOSA 5BMFH 5F7UA 4Z95H 2AV1A 3QJFB 1WF5A 5INDB 3MRBA 5FA3A 3F8UB 5D96C 4QXTA 4LU5L 2EDEA 1UM4H 4MQXD 4L9LB 4JO3H 3EZJB 1YPZB 2IEPA 3DX9B 4HT1H 4M7JH 1E28A 3RAJH 2JTDA 1FSKB 4KHXH 3SEPA 5I1DA 1KTDB 4QO1A 4KJYA 4NRZB 4WRLA 3WMSA 3O4OC 5DT1H 5T3XE 4MA3B 1BQLL 4FFZH 5C0GB 4GXUN 3VXMD 3IFNL 2VXTH 5TJWK 2GTWA 3I6KA 4O2EA 1OSZB 3TBTB 3RDTA 2YD1A 3MFFB 1CR9L 3G5ZB 2Q7YB 5B39B 5AG9A 1HEZB 1EFXB 2HLAB 5D1QB 2E9JA 1DBKL 4C56B 2EDDA 1ZWIA 3VFMB 4LSQH 3VXSA 4XH2A 3G5VB 1LNUB 3GMNB 1QHPA 4EOWL 2DI7A 2VWEC 2JIXA 3UTTD 1O7VA 5EBLA 4OF8A 1O0VA 2X4PB 2DL9A 5IMMB 3PV6A 1K4DB 1BQLH 5IV2B 1RU9L 5IW6A 4OGZA 1GGYA 4V2CB 2V7HB 3W9DB 1AXSA 3V6FB 3RWJB 3HMWH 4OLZH 2NTFA 4RGOH 4PJ7F 3O2DL 4YX2H 1T0PB 2X4TA 1R3IL 1TFHA 3JV0A 5FO9A 3MJ7A 2SEBA 5D6DC 1T0MB 2WSKA 4UIKL 3GKZA 3IFPB 4D0CA 4YXLL 2NNAA 4QWWD 1KIRB 5JW3L 3N1MC 4U1GC 2X4OA 4EN3D 15C8L 2BFVH 3NIDE 4IRJD 4YBLC 2OI9C 1GVIA 3HI1A 4PP1D 1K6QH 1X5GA 2YD4A 4TVPH 4Q58C 4IS6B 4UOW0 5DYOB 3RVXC 4XX1G 1XGTA 4JDVA 1I7UB 3EYQD 3BKYL 1RU9H 3IXTB 2PKDA 3F7VA 2YKLL 3OKNA 5DJ8A 4Y5YA 4H88L 4JKPL 2A77H 4PGDA 4S0SD 3QCUH 4R0LA 4UDUB 1IGTB 3VXUA 1DBAL 4IRSD 4E9LA 5GSVB 1E6JL 1NBYA 4M62L 1HINH 5J3HD 1TXKA 4X4MA 1T66C 2G60H 5FGCB 3SDXB 1U3HD 4LSUH 3UMTA 4JO4L 1MNUL 2VXUH 43C9B 1HQ4B 2VH5L 4AZ8A 3BPCB 4FMKA 1IL1A 4P3WA 3OJDB 3VFOA 1FAIH 1WFNA 1GGTA 3NN8A 3RWGA 1PX3A 4CW1B 3DI2B 3TNNB 1JNJA 3LHPL 2Z4QB 1BHGA 4AT6B 5F89B 3P0GB 2QQKL 4WV1A 5ACZA 2J8UF 3UX9B 4EBQH 4OKDA 1HOCB 5C09D 3BDXA 3CH1A 3SO3B 3JVGC 1SJXA 5E1HB 3W2DH 4QNPE 5D7LE 2ARJA 3MRJA 1MCCA 5GJSL 2GKIA 3RBSA 4MA1C 3BDYH 2H3NA 2O61B 4G6FB 3SGKC 2GEEA 1UH3A 4FABL 3P4NA 1FIGL 3V4UH 5DR5H 1OAKH 1HE7A 1ORSB 1BEYH 3RFZC 1CI5A 1Q94A 5D2NB 1OM3L 1NGWB 1FFNA 1FG9C 1RUQL 1Y6NR 5T1KB 5I30L 1A6AB 3UZVB 3VH8G 1BD2B 1YEFL 3SCMA 3HE6C 4M5ZL 1MCRA 1MQKH 1T20A 2AW2A 4RZCB 1T89A 4L3AA 4OLXH 4KVCH 5C2BL 3QDJB 1BFVL 1AXTL 2BHYA 3SE8L 5TE7H 5DJCA 3F6LA 1HXYB 4OBSA 1ZS8A 3HNTL 4UNUA 1MH5B 3OKEA 5J8OA 3T4AB 3TA3A 1WJ3A 4DKFL 2GTZB 4FFYH 3GRWA 3BI9X 2VDRH 4PJBE 4KQ3H 4X9FA 1MWAA 1NMBL 2FSEA 3L5XH 5I16B 4HWEL 2DQEL 4MXWL 2Q8AH 1AR1C 1E6OH 1SBSL 1K2DA 4BSVA 1PZ5B 5BJTB 5MEND 1RZIB 5DLML 4YDKL 5AEAA 2G75A 2IADB 4LGRB 5F9OL 3S88H 2W0FA 1JNNH 2E7CA 1QR1A 3DV6A 1R3KB 1YA5A 4N68A 1TPXB 3MZTA 1BFTA 4KH2A 4XNXL 3P9MB 4UV4L 5I1JL 2YWZA 4EUPB 1UWGL 1JFQL 5JW4N 2JK5B 5L2JA 2NY3C 4Z77B 1FYTD 3OGCB 4WWKD 3WJLA 3UTZB 1ZVYA 1UQSB 5AD0A 3X12B 3WLWC 1Q1JH 2HAZA 3PXJA 4OUUB 5BQ7A 5CINH 5HYSA 1GYAA 5SWSA 1TZGH 1QSFB 3O3BB 1BOYA 1KLGB 1NMBH 3NCFB 5E00B 3HRZA 3AROA 2YD9A 1ZHKB 5D2LE 1QO3A 1FZMB 1RJYA 5DJXB 3FO1A 5HDBE 4P5MB 2XIDA 3M1BB 5IP4A 2GK0A 4PG2A 5DJ6B 3H3PH 1SJVA 1S3KH 1MCOL 2LE9A 1N0XL 4YXKL 4Z7OF 3TYGL 3MREB 3RKPA 4JFOB 1JHKL 1JFQH 3QO0A 4KDTA 3QUXA 4XBEL 5EU3A 1OQXA 1I9EA 3PABA 1C12A 1A4JA 3FO9B 5F7DA 3KPQA 1UC6A 4WI2A 4LCWA 5SWZE 1KXVC 3AREC 5C0IA 4NO0A 4P23D 3HC0B 5EOQH 5I1HL 4X98B 3ULUC 2VZOA 2EYTA 3DXAD 2AKRA 1GRWA 1FLRH 3FFCE 4UT6L 2M8XA 3O11B 4S1QL 3AVEA 4PRID 2DQHL 1A5FH 2LAGB 1U6AH 3BWUC 3QAZB 1T0NA 4JKWA 3PHOA 5TQ2H 1IQDB 3NIGF 4Y88A 4KKNA 2UY7A 4X5XB 1NGYA 4NGHL 2VXSL 4KRMB 4ZD3L 2VDKL 5IMOA 3LQAC 5BVJA 3FO0H 2UWEF 5IVXA 3W9EA 4IIQB 3VXQA 1YNLH 3NCJL 3DLQR 3MNWA 2LABA 3QPQC 3A0OA 3QNYB 5EWIH 5L8JB 1JYWA 4ZAKD 4AIXA 1WBXB 1HZHH 2R9HC 3VWKC 1DQDL 4JJHA 4EIZC 4FXGB 3BXNA 5GGTH 5CGTA 2P24A 1Z9LA 1JUFA 4LVNB 1CLZH 4OZHF 3CSBA 5HHPB 4S1QH 1V3MA 2DQHH 3O4LA 1GSMA 2V9TA 5BO1H 3UXFA 5C07B 1UADC 2X4UB 3KPMA 3H3KA 3WXVH 4JR9H 4U4BA 1NSNL 1F4XH 4AG4L 2NYYD 1G9EA 4ZD3H 3EHBD 5C1MB 3Q6FB 1BFOA 4WI7A 5D71H 4PJDE 1AQKH 3CX2A 3BAEH 2C3VA 3ALPA 1AI1H 4HXAL 4BZ2L 1NFDE 3WCYA 2R0LL 3M45A 3P73B 5EU6A 3RWEA 4OUOA 1J0JA 2NMSA 3QUMB 1F4AA 1RULL 5A2JH 2B1AL 2VDQH 5HGHA 1JL8A 3NACH 4HIIB 5KW9L 1ZOXA 5KANG 1MREL 3WUWA 4EUPH 1JPSL 3IFOA 2EDWA 2EE9A 1CICB 3SOBL 5H2BB 1YEIL 2JJVA 5FO8A 4HKJA 4GH7B 5GRVL 5GQBA 2DWEA 5CD3B 3SDDC 2HH0L 2X4QB 5FCUH 4XNZC 3V6ZB 2NY4D 1IKFH 2V5MA 2BOBB 4D9RE 4L8BB 5MERB 1G7IB 4WJ5A 5E2VL 3T0EB 2W60A 2CGRH 3EIFA 1I8LA 1RZ7H 3D25B 5DUPH 2VLRB 3B9AA 1K8DA 3HG1E 3EJZD 4N9GA 2IPKB 3FB7B 4NKDA 1FRGL 4MJ5B 4LOUD 2OZ4A 1TQBC 3ARFA 5D1ZC 2K3TA 3B9KC 1LO2H 1KN2H 1PKQA 3UP1A 2CR6A 3WD5H 1MJ7H 3QIUA 2ICWB 4ZS7L 3ROOA 1EXUA 5E2TH 5LBSL 1A7OH 2H1PH 1S9YB 1XGRB 3GJFB 4BKLA 4XCYB 5HGBB 1YEIH 4YDJA 5C08D 1EUTA 1XGPA 1IT9L 3DMMD 5HPMA 4MDIB 5KSAB 3LKPB 5CILL 1B0RB 3L9RA 3F5WB 4X6CF 4ODSH 3VA6A 3ET9F 3TT1H 1TVHA 3G6AA 2VLJE 4HH8A 3C60D 4JFDA 3CSYA 3HI5H 4LSSH 5BS0B 1RZ8B 1KSRA 1UZ6F 4PJCE 5EOCJ 5DVMA 3ARTA 1A7RH 2VL5A 1ZSDA 5GS0D 4Q6IA 1GC1L 2AABH 4N1CA 2BRRL 3BESR 4C57C 1F2XK 3S3JA 1I7TA 4ETQB 5FYKE 1IGJB 3NFNA 1A21A 2VRAA 1QKZL 2PW1A 2Z0BA 5T1LD 2VIRB 2J6EL 4EXKA 2XN9E 1F4HA 3CPLB 5C0DB 2A0LC 5JHDD 3MRGB 3FCTB 1V8HA 2DKSA 2YUVA 4PJ9A 1CLOH 4OZFB 5D9SA 1T7WA 4CUCA 3HE7A 3VFRA 4OM1L 2R23B 4X0KA 1RMFL 1P1ZA 4PR5A 4LLQB 4A2LA 1WICA 4XP5L 2F5AL 2VLLA 3TWCL 5F88A 4Z7VF 3ARQA 3QQ9D 4QOKE 2ZUQC 3SJVA 2HFFB 5DGRA 1H15B 1KENH 2ZOLA 4L5FL 2V2TA 1NCBH 1D5BA 5EPMB 4OSUH 1OSPH 1WWBX 4E5XA 1L0YA 3MOBL 4JQIH 4NQDA 5E6IC 1OGAD 3IVKA 4JANB 4M1GL 3SQOH 3CC5A 3EFDH 1J1OL 1KCLA 3MCG1 5DQJB 4NNXA 2DKMA 5HVGB 3BIBX 4N5EC 2GQHA 4PD4J 2IPTL 3RGVA 3BISA 3E3QE 5CMAB 2CDGB 1Z3GL 4WFGD 4QRPE 3HA0A 4WDIB 5D5MB 4WI4A 4OZIA 1F97A 3IAPA 4P5TD 3BP6A 4P2RA 3QUMH 2GUOA 2VC2H 3OKMA 2I9TA 5B38B 1G6VK 2F54E 3UBXI 3W5NA 1S5IL 2GCYB 3O9WD 4OGAD 1NDMA 1BREA 3LKQB 2YPVH 1HQRA 4JHWL 4XP4L 1XGQB 5TF0A 4LCCB 4JHAL 3JWOC 4K8RC 4OD1L 3PWNA 1BQSA 1ND0B 3BUTA 1Y6KR 4LPYA 4X6FB 5BRZA 5I15H 3K3QA 5F7YC 2B0SH 3VWJA 1X5YA 4ZTOL 5E4EC 3HZMA 2VITA 3VGFA 3NA4A 2VKXA 3TBSA 5KVDH 1MLBA 3CIQA 1M7DB 5DUBB 4K3JL 2NX5A 4WU5B 3MJGX 5ADPL 3DURB 1YC7A 2DLGA 1CD8A 1JPGA 2V7NA 3GSXA 3H9SD 4NKQB 1JI2A 5E1AA 2IH1B 3C6LC 3MXWL 5EH1A 2VSCA 1LD9B 4XMKL 5JPMB 2C3XA 3EO0B 4FFVC 5JOFA 1I3RA 1XF1A 4CL7A 4DEPC 2YWYA 4LIQE 4JFXB 5JOEA 3QFDA 4XMLL 3RA7L 3GJFH 3F65A 3NA9H 3HZYA 4S1RH 4JN2B 4BSWA 1P9MC 4N8PA 2LV4A 3QI9A 4HGMA 3HUJF 2HFEB 1BIIA 1SYVB 2VZTA 1CK0L 1R3JB 3QWQB 4J7RA 1YDPB 3U0WL 2CR3A 5ADPH 1VGEL 4JQVC 4YGVA 1HH6B 5BZDB 3ARBD 4N8VB 1JPFA 2I60L 2MQCA 1R24A 1PD6A 1UA6L 2X44D 3S5LA 4HEME 1XIWB 1PQZA 4WW2A 2CK2A 3EYOA 1OB1A 2AEPH 4Y1AB 4S0TD 2IAMB 3BZFA 3UAJC 3O2VL 3QZWB 4K23H 3CFJA 5HHOE 5F9DC 1BZQK 5KN5A 1L9MA 4J23A 1QACA 1VESA 4RQQA 1IEBB 3WN5A 1DDHA 2ZJSH 4UT9L 4PRBA 4OZFH 5GIRB 4FTVD 3CUPA 5IMKB 1J1XH 2DKUA 1WLHA 2VDLH 1J05A 1MJJB 5BW7C 4HWBH 3MA7A 3SDAC 4OZHB 1UM5H 3TVMA 5MEQA 2OTWB 2ITCA 3NCCB 2FHCA 2DQTL 3GRWL 4PRPB 4M7KL 1MWAL 1UXWA 1KCUH 3X3GL 4PJAE 5TE4H 3P0YH 1EBPA 1AO7B 4Q9QH 3A67L 3D39A 3VI3F 1G7HA 1RD6A 4CN4A 3BT2H 1DLHA 5IB1B 1EBAA 1G7QB 5CP7B 4Z7OE 1KELL 2NY2B 2OTUA 4JVUA 1SJEB 5I75C 2X7LB 1U58A 4LCYB 3U7YL 1I7RA 3QYCA 5ECJE 4JDZA 3TLRA 5EA0H 1MI5A 3EYUH 3I2CH 3QUKA 3CXHK 5D72H 5C7XH 1V7NL 5TE6L 2GAZB 4L8CB 2ZPKL 4JY6B 1F11A 4CDGC 2HTKD 4JREC 4OLUL 3E2HB 5DD3H 5ALCH 3SE9H 1YMMB 1RZFL 1GZPA 1HHHB 3OKOA 4J8RB 4U1KA 4OIIL 5LG1A 3NCYS 1A1NA 1GAFH 3ULVC 2DQTH 3BZEA 3BWAB 4PJIB 4ZNEE 2R8SL 4L3EE 1WWCA 2H6PB 1TQCC 3HAEG 2AS5M 3ZL4H 3RDTD 3DV4A 4MGXA 5DJ0A 4XPTH 4IOIA 4FQQA 4LBEB 5TDNA 5B39A 1EFXA 3LKSB 4X6BA 3T0BA 3VXSD 2APFA 4MNGB 4G7YH 1A9EA 4ZPTA 1AP2B 1OAUL 4XAWL 1I1CA 4YHYB 1HNGA 1GOFA 2JIXD 2P5EB 1P2CB 3HZVB 4KDWA 4NQCE 4CNIB 4KMTL 5HHXL 2QADC 3LMJL 4WO4D 1Q9OB 3HPLB 3V5KB 5E24E 4YXHL 3MLWL 2VR5A 1JE6A 3EFFA 2JJSA 5L2KB 3K1KC 3DUUB 3OKLB 4U6VL 3B2UD 3BUYB 2Y25A 5DA4A 4NFBA 4FMFA 3SKMB 1UWEH 4R4ND 4QHNB 1MFEL 5DMYA 4MAUL 4OZGF 5I1GL 1ZT1B 4PRNB 1D5XB 1DUYA 3O6FC 3R0NA 5D7LA 2BSED 3KPNB 3V2AR 2X9WA 3KLDA 3LEYH 5E94B 2BSTA 3N50A 5I19L 1FL5B 1YN6A 1CBVL 2NW3A 4P2QE 1UM6L 4M7LT 5JMOC 2I9LB 1UB5A 2AJ3B 5LXGL 1QA9B 4IRZH 5J1AB 1ZLVK 1CXKA 1FDLH 3QIWC 1BJMA 3GNML 1EAPB 1W8NA 2YA2A 4A2MA 4EDXB 4OD3L 1SM3L 4F33A 35C8H 3AU1A 2C5DC 3ZYIA 1JPTH 1CDGA 1MHHA 3BHBA 3TC9A 4Y4KD 3G6JA 4GSDL 2LQRA 3U2SB 4WGWB 1YMHA 4DK6A 1D5ZA 5IWLA 2RBLA 4MAUH 1IGTA 4GBXC 1ZGLA 2C1PB 4R90L 2FYYA 4E0RA 4PJBA 2D0HA 2WMPA 12E8H 4CU8A 4X6DB 4TNVK 4LGSB 2A6KA 1FZJB 1XF4B 2KDGA 4U1HB 2CIIB 1BZ9A 1NAMB 3MRMB 1JBJA 2Q76A 3OKDA 2Y36H 2FNBA 1HQ4A 5CUSL 3HI6L 4MXVF 3NPSB 1X7QB 2XQYG 1FNEA 3H3BC 1WTLA 3FT2A 4KJQD 1HKLL 4PV8A 2JE8A 3PIQB 1P7KA 2UZXB 1R3LB 4OFYD 3TJHD 1JHLL 5KSVA 2NXZD 3FQXB 2BVQA 4OFIA 3P9LA 3RTQB 4DAGL 1NGXB 5F3HA 5HD8C 3RZCC 3J7HA 3WIHL 2VOTA 4F80A 1FVDB 4I3RL 1NCNA 4FQJH 4H26B 1PYWB 1F4YH 1H3XA 3GK8L 4KJWC 3NFPB 5D7JC 2BCKA 2Z31B 2XT1B 5D2LA 1GJIA 5HGDB 1IARB 5IF0A 2NXYC 4KDVA 4P2OC 5ESVB 4Z7NF 3SCMD 4WWID 5EO9B 4QGTA 4KKCD 4QHMB 1IVLA 1HKLH 4YLQT 4RGMB 1N3NB 3PP4H 4ORGB 2X9YA 2OZ4L 3F62A 3GJFK 4UUJB 3TGXA 1X5IA 1OVZA 5KSBF 4YK4B 2Y7QB 2MSPA 1ZTXH 3BKJH 3IDUA 3LQZA 4AH2B 2X9XA 3CFDA 5IB2B 4PJGA 5CHNB 5SWZA 5DMIL 5DVNA 2WINB 1DUZA 3TA3D 1RSFA 4MA7L 1TMCB 3RNKB 3MLXH 4NHCH 4NT6B 3FFCA 4XCEB 4XHJD 3O8XA 2P1YA 2XTJC 4XPHH 4K3GA 3MLUH 5CZVL 4GAYA 4JFPB 1HHJA 4UU9A 2A9ML 4I9WE 2AJXL 5F9WB 3VXNB 1NGQH 2PO6B 2P5WB 4WENB 4Z7VE 4LGPB 4JO2L 3QNXA 4RAUA 1CIUA 3WJJA 1S9XA 3L7FA 2FO4B 4A6YA 3KPLB 4U6YA 3DO7A 3GUTB 4PGBA 5LJYH 1DTUA 2FGWL 4APQB 1C16A 1DCLA 1JWUA 2ADGA 4X4XA 2GK2A 4NPYB 1VERA 5GS1B 3BGMA 4M5YH 1W0VB 1CE1L 4LF3B 5SWSD 1P7QB 5K9OB 1KIPA 1I8MA 4OD2B 1NCAL 3BVNB 4QY8A 4LHUA 2ICEA 4K71B 2VXQH 4HAFA 4PGCB 1LE5B 3FRPA 4HJGB 3K4ZA 1A7NH 5DD6A 3MV8E 2YPKA 1KGCE 3BPLC 3JV4B 2WIIA 2H9GB 1JZ2A 4ZFZB 1HHKA 3MRQB 3R06B 2HT2D 1MEXH 1F02I 3WFDH 2OP4H 3BKCH 1A14H 5IHZB 3VGEA 5E9DE 1CGYA 2X2YA 4P4RB 3C5ZA 4HGWA 3ULUF 4GXVL 2GSIA 4JFOA 4LAQL 3VFNA 1VACB 1NDGA 4LCWD 1LE9B 3RU8L 2MQ0A 4C83B 3OKKB 4NO0D 4DQOL 3U0TB 2AVGA 5IGXL 4PJEF 3O3EA 3QCTH 4KY1L 4N90E 1HYSD 1NAMH 5DEFB 5EORH 4O58L 4MQTB 4M48L 1JGLL 3QDMA 4YDLC 3S36L 5E2UH 3BPNC 5K59F 5D96B 1W72B 2YRZA 4X5XA 5JXAL 4J6RL 3T2NL 1BOGA 1IC5L 3IDIB 4M7LL 4MJ4A 1S7VA 1VHPA 1VA9A 3BO8A 1NMCC 1QFUL 4ZPVB 5SWQA 5IB3A 1TZIA 4LP4A 4Q9RH 2UVEA 1RJCA 1MFDL 1GZQB 1ERNA 1XGUA 2OR9H 1BJ1H 3KGRA 3RNQB 2NZ9D 1QD0A 5IR1A 3HG1A 2CK0L 4PYHA 5C0FB 4X5LA 4DZBA 4X7SH 3KJ4B 1I1AC 3K4DA 5A2LH 2P46B 3LS5L 2HN7B 1JV5A 5GGRB 2FJFA 3PDOB 3U9UB 3FQRA 2UYLA 25C8L 2IANE 4M7LH 1FN4A 1X5XA 2Y9RT 4S1SL 3WIIH 4F7MA 1R5IA 3ILQD 4P9HC 3DVNA 1PLGH 5IESH 1BBJA 1I9IH 1KIUA 2EIZB 3UBXG 1T4KA 3V95A 1VADA 2QQQA 1FL6A 2GJJA 4R8WH 2J1KA 1BWMA 3DX7B 3FT3B 1Z2KA 4OIAA 5ACMA 4UT7L 5E03A 3MRLA 3S4SA 1HHGB 1ZANL 1NC2A 3G08B 3LDBC 3RVVC 2CK0H 4DZ8B 4WFED 1FNGB 3PDDA 1KC5L 5A1AA 2X5PA 5HHNB 2IALA 5T3XL 6FABH 3MUJA 5DQ9A 2AK1L 3K2MC 4RWYL 5HHVH 1FNSL 3QHFL 5I1CH 4LVEA 1TITA 1C5DB 4PJ7A 3GIVB 1X5LA 2XN9A 2NY6D 3HPJB 4KTEL 4U1GB 1LK3H 4DN3L 4GRLB 4NZRH 4R4BA 5CJXA 2OI9B 5ANME 1Z0NA 4UBDC 2CIKA 2PF6A 4P57A 2ZNWA 3T3ME 4IJ3C 1BAFH 3ESVF 3KJ6H 4WCYL 3TJEL 2JB6A 3FFDB 3MUGB 4NNPH 5EUOF 3MBEC 3T0EA 3C6SA 4QKXB 1BQHA 1MRDH 5CKGA 1QBLL 3UO1H 5KVEH 3GMRB 4DTGH 4QOKA 1OF2B 2E9BA 2JCCE 3FQNB 3ARFD 3TBYB 3D6GA 5T33H 5H35A 2WAHA 3VCLB 4MJ5A 4R3SB 5JUEL 4KK5C 3ZT7A 5MHSE 1SMOA 2VYRE 3QFJD 1XF3A 4HHAB 4Y0GA 4N1EA 4JAMB 5ETUA 4IDLA 1EO5A 4XWGH 2WLZA 1CD1A 1YEDA 3DIFA 3ZKMD 3MQIA 1RHFA 3V6OC 5EO0A 3Q5OA 1JGEB 1EEZA 3MRKA 4XVJL 2VXVH 5IK3B 4QRPA 4BZ1L 1UB6A 2GIYA 4IMLB 5KTEL 2EH8H 3OR6B 4JGMA 2G5BA 2ADFL 2NLJB 1Q9WA 3MYJA 2R2CA 2VLKE 3EYSH 5FK9B 4Q9CA 3LRHA 5C8JA 5E08L 3MLZH 4JRXD 1W72H 4RFNC 5J7CC 4XP9H 2O5ZL 1ACYL 8CGTA 4FQCL 3TN0A 2ZOKA 5CIPA 5D8JH 2J8UA 1RIUH 2HVJB 3NFSH 4Z78B 4PJ8C 3QRGL 4FHBD 5KS9F 2OJEB 1L6ZA 4HK3J 1WZ1L 5E6ZA 4OCSL 1ONQB 4PJ9D 3A6BL 4NFCA 3HE6B 1DBJH 1P6FA 3FOLB 1WT5C 4XVSL 5DDHA 3HE7D 1JYXA 4KU1A 5E8EA 3MRCB 5ADOL 4AENB 1RIHH 7FABL 4CN1A 4KK9D 2DLFH 4ZUUB 2YC1A 1B88A 4MSWA 4HWBA 4GRWF 3JWDC 1LGVA 5FCSH 4P5KB 2YSSB 3SJVD 1FP5A 1C5BL 3EDJA 4NQEE 4QCIA 3RJQB 4ZFOB 3UJJL 4WHDA 1E4KC 2A73B 1L7IL 1UJ3A 1PY9A 4XZUB 4OF0A 4YHNA 3VFWB 3HC3H 4LCIL 3L95B 3CFCH 5GRJH 5CZKA 4F9LA 3TYFA 3EDKA 5DQJA 1LEGA 2VE6B 4OF7A 1T2QL 3OJVC 5D70L 5CKAA 4DW2L 1QPXA 4WDIA 4XCFL 2X70B 2V5TA 3JBG7 4YAQA 4GLRH 2NY3B 3BZ4B 5DK2B 4MVBD 4NZTL 4G80A 4MCZA 4RFEB 1FFPB 4MXVE 1N5AB 2XICA 3GB7B 4MNQA 4RAVA 4Y4FB 1CFNA 1S9VB 4RRPG 4JPIB 4NJ9H 4HPYH 3VE0A 3Q0HA 1CLCA 5BRZD 3SGDH 3MRNB 1H9VA 1J12A 3CXHJ 1MHEA 3DVGB 1MAMH 1ZHBB 2CRMA 3VWJD 3LEVH 4B41A 4QRQA 5GZOC 2F8VA 4P59H 3BEWB 4S1DC 1JMZA 2ORBL 1IGFL 4BQ8A 2NX5D 4F7PA 2JF1A 4NQXB 1V7ML 3P4LA 2P8PB 1M7DA 4WUUE 1EHLL 4NZUL 3QEQD 3WDHA 3FO2B 5CJQL 2N4IA 3QEHB 3RVWD 3AY4A 3IDYB 3B3IB 2Y4SA 4M1CC 1ORQB 3EGSA 4P4KD 4Z7NE 1ED3A 4KKAD 2DM2A 5F8RC 2Y5EA 4JFQB 3QDGA 4XC3L 3TPUB 4CVXA 1QSEB 4PJ5E 1CGTA 3VFTA 2V17L 2FB4L 2VQ1A 4KRPC 2VABB 3QI9D 4E41E 1DFBL 4YFLF 3QIBC 1BBDH 4HUXB 1T7YA 1HYRC 4LNRB 3B5HA 5GJTL 4PJEB 3BSZH 3RVUD 4W70A 5EU4A 4JFZH 3PGDB 4QYOA 4XPAL 4OCYH 2VDOL 2W65B 4EUPG 1NPUA 4MJ6A 5T3XD 1P7HL 2YZ1A 2NW2B 1RJLB 1WEJL 5CBEA 4JG1H 5TF1H 5BZDA 5DMKB 1BVKA 1S7SB 4ZNEA 1RUKH 1NFDB 4L3EA 5IVZA 3RL1A 4F2MA 4M6OH 4XI5D 4NKMB 5GXBB 2VZSA 5B21A 1CGVA 3VDAA 4R26L 2X42A 3FQTB 4N0CC 4W4OA 4Y5XA 1DSFH 5DD5L 2OL3L 4G5ZH 4K07A 3VRJB 3VWKB 3LRSB 1KFAL 1RZJL 3GMLB 3CXDL 1MSPA 2UWEA 4PRHA 3ROLB 1YEEL 4QRRD 4DOHB 1F3DJ 1JCKA 2PYEE 4JFEA 1YEKH 1MJUL 4X99A 4ONHA 1ZT7A 5DJDB 1ADQA 1IEBA 5CJBA 1VFOA 2I07B 1JNLL 1MFAH 2OJZH 1JZ5A 1J1PH 3TV3H 5CEYA 1QLRB 3TVMD 1DQJB 2F74B 4U1NA 1XGYH 3V5DB 3BQUB 3VXME 2QKIB 1SVCP 5BVPH 3C8HA 2Y1VA 1OTTD 3D39D 1SY6A 3DRQB 1NGZA 3FRUB 2EC9T 4HV8B 1U95A 3LVEA 3IDJB 1P84K 3LKOB 1KFAH 3SBWA 3PF2A 4JKKA 4JCMA 2DBLH 1L0QA 3MV01 4FQXB 3BP4A 4OBRA 1KJ2A 4A6YL 3QWOA 2X7LA 5BZWB 5EO1B 1CXFA 1YEGH 1MJUH 2J8OA 3ILPB 1MI5D 1DN0A 3IU3B 4TPRH 5EBWB 4P2QA 3QUYC 3ULVF 3EYQC 5LCVL 5K9KB 2RFXA 4XMPL 4W6WB 5I73B 2PXYA 4IRSC 3I9GH 4I13B 5I66B 2WBJB 4TSBH 5IOPA 4ZUSB 5J3HC 4KAQH 1Q0XL 3HNSH 2NY5C 3QULB 4XNZB 1CE6A 4LLWB 5JW4R 4PJCB 3PWJA 5IW1A 5IVNA 3RIAF 2HKHH 5J9PA 3DO3A 2W59A 1EFXD 1EMTH 4LLYB 1KCRL 5JZ7C 4P3CH 3ZDXF 1T5WA 3IRPX 3MLSH 4K55A 2V2XA 5D1ZB 1XF2A 4HIJA 4JM2A 4TUJB 1TCMA 5SV4A 1TTFA 4YFDB 4NBZB 1U8NA 1XZ0B 4LARL 3SDCA 3OJMB 3IFLH 3WO4C 4F9PA 2H2PD 1QUNA 5JORA 3L7EA 3S34L 1DBMH 2QSCH 4LRNL 4XBPB 1CIDA 1UWXH 1AGDA 2VTFA 3ULUH 3MLYL 2VR9A 5HI5C 4WNQA 5D7LD 3QHZL 1JRHL 4NC1C 2YA0A 5A3ID 3L3HA 3H42L 4X6CA 1N4XH 4WI3A 4LSVL 2WNGA 3L3GB 3F7PC 5ALBH 5KVGL 4GW4A 3UZEA 1JNHA 2IFFH 3KLHD 4K3EH 5J57B 3KPSE 3WLBA 3LQAH 1P4BL 4E42A 2VZUA 1WWWX 2X6MA 1BZ7A 1LO0L 4LMQE 2AJ3A 1Z9SA 1QA9A 2XZZA 4DGYL 2BNQB 4HWUA 1XH3A 4Z0BL 3IDMB 5F1SA 5T5NG 1EAPA 2NY1B 1MY7A 4UAOC 3UJTL 3FMGH 3K0WA 2KPNA 1VGKB 2DQDH 2F54B 2R2HA 4KHTL 5C09E 4F7CB 4ERSH 5KS9B 3WS6A 4O2FA 1NLDL 1CT8A 4Y89A 2Y06L 4ZXBB 3H9HB 3U2SA 4Y2DC 2A74B 2GITB 5EIQA 3UDWC 3MCKA 2F53A 3ZKXB 2W9DH 4PJHF 1D9KA 3PV7A 5EUOE 4GRWB 1XF4A 1P4BH 1ZHNB 1KIQB 5IJVA 4Z7VA 2MCG1 1Q0YL 4X4ZA 5L8LB 2IMMA 2XRAL 2CLZA 4MLSA 4NOFA 1DLFH 4KQ4H 3D2UA 4TULH 1MRFH 2GSGB 1FVEB 3CVHB 4NN5C 4BH7A 1DP0A 3V4VL 2CDFA 2BNUB 3QUZC 5JR1H 3S35X 2Z92A 4DGIH 5FYKL 3S7GA 3B2VL 4KI5C 1HKFA 1XCQB 5JW5B 1LVEA 2PYFB 3IDXH 1FG2A 3MRDA 5EU5B 2N7BA 3BEVB 3QH3A 3VRIB 5JLZB 3T04D 2E7LA 3KPRB 1NC4A 2R15A 2Z8WC 4X7EC 5IT2H 4BELD 4MQ7A 5DJYB 3WEXB 3L5IA 1AE6H 4IDJL 4FQLH 3SGEH 4WI8A 3MNZB 1G1YA 1AGBA 1CFSB 2ADJA 2XKNA 4CN6A 2UUDK 1FYTE 5E9DA 4Y16C 5DD1H 4N0FB 2XACC 4O2CB 3P77B 4CU6A 4Y4HC 3C6LB 3V4VH 2X4SB 3L5WB 3M17A 5SWZD 5I1IL 2MHAB 4LPWA 4GQPH 3D87B 3X17A 3NIFF 4M43H 3EO1A 3KYAA 3TIEB 3GHEL 4J4PC 5HHOB 2WINA 4DEPB 1K8IB 4P46A 2YD7A 2BC4B 1NCWL 3FOMA 3OF6D 3OMZA 3MXVH 3RNKA 1BGXL 5CZXD 2C1OB 1VPOL 5I18L 3X14B 2PUQT 3LSOA 1KUMA 3QRFM 4JFPA 1JN6B 4OLEA 2XZAH 2BVPB 5HDOA 1NCDH 3STLB 5HI4D 1E4XL 4MB4A 4UTBH 3BJLA 4Z7WE 1QRNB 3GI9L 4LEXL 4NNYA 4PJAB 1WBZA 3KPLA 3K8MA 4I4WA 4V1DB 5ITFA 3RI5F 4NQVB 3HUJA 1TJIL 3FQWB 4GKOA 2MCPL 4YPGA 5FA4A 4M61B 1CU4H 3IJHB 3DXAE 3P0VH 4J1UA 5KG9B 1OAXH 5EU7E 1HSBA 1LP9F 4ONGL 5A2KH 3OPZL 1OARH 1KG0A 4LHUD 3UYRL 1QSFD 2DDQH 2NYYC 5DK3A 2XZQH 3IKKA 5F8QC 4UDTA 4PTTB 4I8DA 3OXSA 5EFIB 1J0KA 5FYLE 2YR3A 5T5FH 1KACB 2J88L 3GJEA 3B5GA 1FFOB 3PWVB 4OCWL 3VI4F 3O41B 3PWUA 3NABH 3OZ9H 3ZT5A 2IG2L 3BP7B 3SKJL 3AS2A 2DMCA 4Z7UE 5D7KD 4HLZH 2CKBA 3WFBH 3OXRA 4LIQL 4RA3A 3C5ZD 3TZVC 4G42A 1MCFA 3QB7C 3RPKA 3SDAB 5GRUH 1S7XA 5IHZA 1WQVT 3V0VA 3NTCL 4TUOB 3IDNA 4F57L 3V5HA 1N6VA 4NIKB 3D85B 4DWHA 5HYSG 1A7QL 2X4NA 3MJ9A 3C5JB 1PBYA 3VMOA 1CFVH 3VXRB 1DE4A 4HMEA 4G43A 1EGJH 4GRWH 3QXAB 1C1EL 1RVFH 2IWGA 3THML 4D3CL 4WEBL 3KG5A 3QDMD 1L7TH 5I75B 3VRLF 4HKZB 2O93L 1F6FB 4PJXB 3AAZA 2HJLB 3UPRB 2GJZB 1AY1L 5B3JE 4MDJB 2NY4C 1G9NH 2HRPH 5GSRB 3VGHA 3CVHH 5BOPA 3SKJH 1J8HB 4BQBA 1F6AA 5INCB 1IM3A 4IEFB 1IC4L 5E5MB 3ZE1F 4R9HA 4ZOAA 3KYNA 4N8VG 5ANMA 4I3SL 2WBKA 3EJZC 4JLRB 2A6JB 4D9RD 1DQQA 1JGUH 4MWFB 2VDML 4NQUA 3UTQB 2P7TB 4HDIB 3MV9A 4FN0A 1N5YH 1FFQA 1NBQA 3JWOH 3RY6C 4K8RH 4D0DA 1FGVL 3T1FA 5C6WH 3KPPA 3QZWG 4GAJH 3CZFB 3MRRA 4JY4B 5EZIL 4OTXL 2BVOB 3DMMC 3ES6B 4KI1A 4ONFL 4TUKH 4PY7B 1HN1A 2DQGH 2OSLA 1Q72H 1UWXK 5ESAA 2R2EA 3VH8B 4G8FB 4HBQA 4FQ1L 4M00A 1N26A 5FECB 2CLVA 2FWOB 4OCXL 2QADB 3N1FC 1MCPL 4R7DA 5JO5B 1G9MH 3ARGA 1HI6A 3AFLA 4NWUL 5FV1L 5IEHB 4TTGA 3VGBA 1EO7A 1DEEB 3IJSA 2NTSP 3OB8A 3CFIC 1OQOA 4YIQB 3T65B 5AWNH 1UH4A 4HCRA 1TVBB 1X3DA 4I1NB 4I77L 4JY5H 4B53A 3DGGB 4JFYA 1T83A 2EIZA 1LEKB 1I1FB 3U48A 3RWDB 4P49A 4ELMF 4K94L 4AEIH 5AYUL 1FC2D 1NC2D 4PBWD 3PL6A 3FT3A 4ZOEA 3T8XA 1J87A 4UINH 3ABZA 1TTUA 1MELA 3KPTA 2ZSWB 3O6FB 4JN1L 4LPVA 3VFSA 4WFHD 3MTRA 5JMRA 2XI9A 1T21B 5D6DA 5C08E 2D7NA 1KPRB 5FUZL 1T03H 2YD8A 2XN9D 3C5SB 3W0WA 4OZGA 4RSVA 2BY1A 1QOKA 4X7DC 4GG8B 1C5DA 3V7AG 2XWTA 4MX7A 3ZSSA 1W0WA 2HVKB 3SO3C 3QR2A 1MHCB 1AR2A 1A2YB 1CDUA 1DEDA 3O45B 2BVTA 1T7XA 5F71A 1I9JH 1INEL 1YY8B 5GISH 2C7UA 2MPAL 2V2WB 3T0ED 1PSKL 5IIEA 3CFKB 3Q6GH 4OI7A 3V0AC 1ADQL 1TJGH 3E8UH 4FFWC 2ESVA 2WIMA 1QRKA 3T77B 4HIHA 2LU4A 5DRZA 1MHPL 4GBXB 3UPAA 4AEHL 4YUEL 1K9TA 3KNBB 3U9PL 3GKWH 1FE8H 3WUWG 3CFBB 4G6JL 5HYEA 2RCSL 4HMCA 1BMGA 2IPUK 1ZVSB 3BRGC 5F96L 3QXUA 3N85H 5JHDE 1SY6L 5FUZH 3BH8B 3J8F7 1RQ5A 5J0BA 4FZ8L 5EC1A 3O9WC 2X41A 4YHZH 5E2WH 1JGVL 3QXVA 3TNMA 1UACL 4U6HA 1KJ2L 3O6ML 1N6QH 1ZHLA 1KEML 5JDSB 5I1LB 2HJKA 1Q9LB 5BS0D 4WY7H 3NZHH 2FH6A 3S35L 5HYQB 2KZWA 1RHHA 3RZCB 1QFHA 2OQJA 3QQ4B 2P49B 3TN0D 5F7EL 5FK9A 2IBGA 3JVGA 3U9PH 1AXIB 5MEOB 1KNOA 4F58L 4QXUL 4M3KB 3PJSA 4Z78A 5DWUH 4WFGE 2NXYB 2XNAA 5L6YL 4U1SA 3WFEL 4RFOH 4RGND 3UPCA 4WUUA 1OD9A 4CBPA 4OJFH 3O6MH 1CL7H 2B2XH 4QXGL 5ID0A 3VW3L 3MC0A 3KLAB 4ODHH 5C0JB 1U93B 4BFIB 4I48A 4AQ1B 4HULB 4AENA 3IS1X 5DC4B 4UV7L 5E8DL 3BRDA 4PJ5A 3JTTB 3D9AH 1NLBH 1CZ8H 5T3ZE 4HKBB 3G6DL 1X5AA 1H3PL 2NY0D 5KSBA 1RUAL 2DWDA 4OB5L 1CGWA 1K4CB 2NR6C 1G0YR 4NQTA 4E41A 1DVFA 1UCBH 5DHVA 2XTJB 3PDGA 5HGAB 3S37L 4GFTB 4LEOB 3TH4T 3R0MA 3INUH 4LLAA 4X7TA 5IFJB 1B2WH 3H9SE 2YMXL 4OLVH 2YHGA 3MMEA 5F7LB 4XXDA 2LVCA 2NY7L 5C3TA 4PJHE 3KLSA 2YS4A 4N0UB 3CZJA 1NAKH 3GBNH 1IZJA 4Q0XL 3K2UL 3X3FL 4AIZA 3Q5YA 4BK4A 3RQ3A 4EI5B 4NKOB 4MNQD 5I8OL 1TIUA 4IOFC 3P11L 2D0GA 3QAZC 4MXQC 3KR3H 1KT2A 2LU7A 4HJJH 4LASH 4OIBA 4OT1H 2UVFA 2XWBA 1OTUD 3EJYC 4QTHA 3RWFA 5HGGS 5CCKH 5LGJB 3GSVB 1C08B 1U8HA 1XCTA 2FX9L 2PCPA 5IJKC 2PYEA 3OAYH 4LLUB 4XVUC 2YPLB 1LO5B 2DQJH 4IIQC 4YBQD 2FIRT 1P4IH 4YDIH 3BPLB 3IU4H 4RIRA 4KMQA 5DRNA 3GMPB 4ZQKB 4MAYB 5EOTB 2WANA 5IFHH 3NAAL 4XAKE 1KBGL 4R4FH 4UZGA 3DARA 5I1EH 4I0PB 2EDHA 3LPFA 5D7SH 1B0GA 1PG7W 1TJHL 5F6IB 2AEWA 3PNWB 1N8ZB 2VB5A 3GI8H 4HK0B 1FV1A 3QDGD 3U4EA 1VEMA 4CADA 1MF2L 2UV3A 4D94A 3ZKND 3RHWK 3LD8C 1NQBA 4LLMA 3AREA 4QRUB 4W6YB 1A7BA 1GC1C 4UB0L 4YHKH 5K9JL 5GGSB 2R0WH 3OR7B 4FTVE 1T1XB 4EVNA 2VABA 3TT3L 3PHQA 4L8SB 4Y19E 2DYPB 3LN4B 1DZBA 2IANB 5L9DL 1CWVA 3BPNB 4PJEA 5B4MD 1HSAB 4KKBD 5GRZA 3RDTC 4TSCH 2C4FT 1AKJB 2R1YA 4FZEH 4OQTA 1EIBA 2Y6SC 3ZTJG 3PWPA 4HS3B 3JWNC 3MJ8A 1JF6A 1URLA 1DQML 1MCBA 1BX2A 5CGYD 4LP5A 4KROD 5FKPB 3KYMA 1AQDA 2OK0L 4LQFL 4Y1AD 1FH5L 1AFVL 2IAMD 3REWA 4PRHD 1TNMA 3W5MA 3WFHB 1CICC 1DBBH 5TDPB 5D7IF 4JFED 3LV3A 1NJ9A 1IAIL 1Q8MA 4YHIB 1IM9B 4GG6F 1FBIL 5A43C 3NZ8B 5TGBB 1I1AB 4HUWA 4EN3A 5KAQG 5DD0L 5LWYL 1LP9E 3CDGA 3Q3GB 3U46A 2IH3B 2COQA 1CDHA 4UOJA 1VFBA 3T4YA 3UJIH 3EOBB 1D6VL 4HEPG 2HKFL 4XCNB 4HBCL 4BH8B 2V9QA 2DS4A 3L3JB 2Y5TA 3IDGA 5F1IA 5DI8B 4PRPD 3L3DB 1S9WB 2XV6B 2QKIA 1T7VA 5MP6L 4H5SB 2G5RA 1AO7D 1E4XI 5DS8A 5HSFA 2B4CL 1KJ3L 3ARSA 1WK0A 4TSAH 2JCCB 5FYJU 3MRPB 4HV8A 1RAMA 3MRIB 5C0BB 2ITDB 4HFUL 4AL8L 3LS4H 4G6AD 3DSFH 1QVOA 3WXWH 4P2QD 5CWSB 5KSAC 1OAZH 1RFDH 3W39B 3KPSA 3HZKB 5FDWA 2PW2B 4LFHD 5E5RB 2FLBT 1GHFH 4YHOH 4ZDHA 2KH2B 2PXYD 5DEGA 3L3OB 4NO3B 3ZE2F 5I2IA 2QSQA 5K9QI 3VRLE 2BP3A 2OXGA 1XFPA 4LLDB 3SDDA 3TO2A 4F15C 4D9LL 5C0NC 4OCRL 1HIML 1KJ3H 2CLRB 1A6VH 5C0AB 2B1HL 2H26A 2VLKB 4HF5H 3MBEB 1EVUA 1M05B 4JZJA 3CNKA 1E27B 1AIFB 2CKBL 3FN0H 1CQKA 3SE4C 4N5UA 4KJQC 4R2GB 1JZ3A 4NM8L 5KJRL 3C8KB 5EUOA 4WV1C 3B9KA 2P5ED 1QFPA 4OM0H 2RJMA 4ZUTB 3RKDD 3MJ9L 1MCNA 3S96B 3PG2A 5ID1A 1JWSB 3CVIL 3I02A 1FO0A 1MRCH 1ZK9A 4K9EH 3WHXA 4JRYB 3MRHA 2O5XH 2PNDA 1UH2A 2AJVH 4JHBA 1XR8A 3BP5B 5L2KD 5HI3D 2BJML 5E8NA 4XBPA 2AJSH 1IGCH 1MAJA 5DRWA 3MOAL 4NQEB 3RIFK 1M6OB 2F5BL 1F45A 5F7NC 4KPHL 3OX8A 4EDWH 3U36A 1INQB 5EIVA 3GMMB 3I50L 1R0AH 4AJ0A 1VKXB 4RFNB 3CLEL 1T89C 2EDQA 4OCMC 1NUDA 1AGEB 1QZ1A 3L3GA 3QJHA 3TO4B 3WNLA 4FQIL 3RUGE 1OP9A 3HNVH 2QR0B 4XCCL 4LNVA 1N7ML 1I4FA 4O5LH 4NM4L 4HW6A 4U31A 1RZGB 4G9DA 2EXYD 3F58L 1YEJH 2DQUH 1EAJA 4L4TA 4U3HA 5DSCB 1FQ9C 4LCCC 3DBXB 2CDEA 1I3VA 5KS9A 5DA0B 3VA2C 3QA3B 1ZV5A 5DXWA 2F53D 3MR9B 1CVSC 1MVUB 4KFZC 1UJTA 1HXMB 3QG6B 4O4YH 1D9KD 1AD9A 1F4WH 4ZOBA 5I17B 4MD5A 5EUKA 4QHLB 2H32A 5CGMA 3ARDB 4HCRL 4Y5VA 3WJLC 3SY0B 4N1HB 4Z76B 5IHUH 4K7FB 5E6IA 3Q1SH 4JKMA 4PYGA 4ALAL 1YY9D 1ZHNA 1QBMH 3OJ2C 4CMMB 1N64H 3G9AB 4MNHB 3D2UD 4KI5F 4YHML 3C9NB 4IHOB 5IM7B 9CGTA 3OAYK 1KV3A 3QG7L 3DXAA 5F21B 5C0EA 5HY9B 1TCRA 1CGSL 4R6UA 3B6SA 1F58L 4G8GA 1XCQA 2A6DB 3BD5A 1D5IL 2HT2C 2DLIA 5FO7B 4G9FA 3EDFA 4R96B 3BD3A 4WHTA 5ISZB 3R1GL 2GJ6E 8FABA 5AG8A 1ZA3A 4KDTC 1UYWH 3QUXC 3KYKH 4TRPL 5I8CA 2IMNA 5EOCH 3WS3B 3OQ3B 1CLYL 2W9EH 3IJYA 2A2QT 2HTLC 4WUKL 3VXPB 5KSUA 3I85A 5IB5A 3MUHL 4WI6A 2EDOA 4U7SA 5F9AC 2BVEA 3VXTB 5FFLA 1KCKA 5GZND 5SWSE 5A40E 4LKCB 5I0DA 2X4SA 3DTXA 1ZXQA 2NPLX 3MA9H 2FBJL 4MJIB 5FHAH 3BFOA 3MYZA 2UZYB 3C8DA 4P46D 4HIXH 3AS3A 1GGIH 5IMLA 3K80A 4MJ2A 3T3PF 3BE1L 2FEDD 4XPBH 4KRPB 5TQ0H 3QIBB 1CVRA 2DQCH 2OS7A 3LKRA 3MCLH 4XP1H 2DN7A 3STZB 2A83A 5TDOB 3VXMB 3GSUB 5CP3H 1CCZA 4X6EA 4YR6A 5AZ2L 4GQ9L 4OLWH 3UTSB 3MLRH 5DUML 1QRNA 1MLCA 1BM3H 3QISA 2VKWA 5IQ9A 5C0CA 4NQVA 3DRTA 1DJSA 1RURH 4HKXB 3LB6D 3ZDZF 4M61A 2FBJH 4U6TA 5TFSL 3L1OL 1CFTA 4NN7C 1KYOJ 5T1DL 3ARYA 4HC1A 1YEHH 3X13A 3RWCB 5FB8A 3MGTB 4P2CG 5ICZB 2EYSB 2AJYL 2I5YL 5DTFB 4HXBL 3UTTB 3FTGA 4QT5B 4XNYL 2X1QA 3R4DA 5EFIA 4U1MB 2FL5B 4M6AA 4JDTL 2AK4A 5E99H 4JQXC 5F9JB 4FXKB 1AHWC 5D7IB 1T22A 1A1MA 5EIIB 3KS0J 4GG6B 3KPOA 5FYJL 1SEQL 5DO2D 4HUVB 4HFWB 4F7EB 3JWDH 1RUMH 2CO7B 2D3VA 5EN2B 5DJZB 4JFFB 4YHYC 1R5WA 1U0QA 2AXFA 2E5EA 4LHUG 1G0DA 1RK1A 4HZLA 2BOCA 2VSDA 1KEGH 3FRPG 4ODUB 4U3XA 2AAVA 5CEXA 2D4DA 2H8PA 5J4MA 1XMWA 5AZEL 4IRJB 5I8KL 3GHBL 1CXEA 2DD8H 1EO8L 2QV2A 1YQVL 2G9HA 1B4JH 5JHLL 4J3UA 3NBNA 2J12B 4UQ2A 5HJ3A 2HT3C 4LSTH 3KWWA 2YRPA 5I8EB 1N2RB 4LRIA 4TQEL 4XGZB 1J8HA 2R39A 4FOMA 2R2BA 1AGCB 1OPGH 3C60A 3JUZA 3ARFC 1U8OA 1QQDA 4IRSB 3TIDA 3MV9D 1UXSA 3GGWA 5ILTL 2EE6A 1SVZA 2E27L 4ODBD 4XVTH 3QIUC 1IAOB 3GMOA 5D6CB 4UI2A 1AD0A 1U3HB 5JTWA 4MS8C 4K3DH 1X44A 1SJHB 3OHXB 3T2OA 4BK5A 1G7MB 1YJDL 1S78C 3REVA 5GGUA 1UFUA 3QO1A 5D1XA 4YQXH 5T1LA 4ONOA 4BA8A 1G7PA 5LAXB 2O5YH 1A0QL 1RJZA 1A6UH 2ZUWA 1LK2B 3AB0C 4M03A 1HDMB 1WFUA 2D9CA 3ARGD 4H1LA 1S7QA 5A16B 2UZIL 4PP2B 1H5BA 5C09B 1KB5B 4XNQA 4GUPB 3HCVA 3MGOA 4LSPH 1D5MA 3TBVA 3FB6A 3VFGH 2D03L 5LQBH 5FF6A 1JWMA 2IPUG 1H0DA 1OAQL 4BFEA 4O02H 2KQMA 3QFJE