3SGDI

Crystal structure of the mouse mab 17.2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
218
structure length
218
Chain Sequence
b'DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGSHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light Chain
publication title Crystal structure of the complex mAb 17.2 and the C-terminal region of Trypanosoma cruzi P2 Beta protein: implications in cross-reactivity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 57
structure length 218
sequence length 218
chains with identical sequence L
ec nomenclature
pdb deposition date 2011-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgdI02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgdI01
1G1YA 4JM2C 4ZQKB 4D0CB 3MUGA 3LZFL 1LO3H 3VGGA 2DQTL 3NFNA 1FNHA 3C2AL 3MV8A 3VU2A 3LS4H 1HHKA 5KANG 2W9DH 4RAHA 5CP7B 1OAZL 1OGTB 4JFFE 4JFEB 3GSQB 1RK0B 4IRJC 3CC5A 3MFFA 3TJEL 5LAXA 2I07A 4O2CB 2VLLB 2VISB 2R8SH 1NFIB 1ZSDA 2WMPA 1BFTA 5IV2B 4WU7A 1TVBB 4X6FA 1JPFA 3VXUD 1TZGH 3OG4B 3FQNA 1JYVA 3W5MA 3QIWA 1VADB 4K8RC 4BQ8A 3QIUD 2IBZX 3OKYA 2EDYA 5F7DA 2XI9A 2DYPD 2FBJL 5TH2B 2B2XH 5SWZD 6FABH 4D9LH 4WW2A 1DQQA 1JYXA 5HHOD 5JW3H 1F4XL 4QCIB 4IOFC 2R0WH 2BNRB 5IMLB 2B1HH 3KG5A 4U3HA 4ZODA 1I3RA 5F7EL 1L0QA 4U6YB 1X5LA 5JNYA 4HBCH 3L7FB 4YFLF 5E9DA 5HI4D 2PXYD 4YXLH 4LU5H 1Y18B 5I8KL 4Q2ZB 4UT6H 4LPTA 5ELIA 1A7QL 3H9HB 3GSVB 3L5WB 1N7MH 2NY5C 4HX1A 1NDMA 4BH7B 4Y1AA 1EUUA 2DJUA 3X11A 3RZCC 2PYED 4L4TB 4R2GD 1GGUA 4CDGC 5KSUA 1M05B 3FAXA 1CLYH 1UZ6E 2FZ3B 3T0EC 1U93B 1FCGA 1INQB 3KPLA 3MJ8A 2KUTA 2OL3H 1ZHBB 4UDUB 1HSBB 2GI7A 3QWRD 5BVJA 4HUKB 4KKAC 1GHFL 1JVKA 4P46A 2YBRB 1CFVH 3A67L 3WS6C 1IEBB 4XVTH 1BQLH 1S8DA 3QFJB 1JZ4A 4WTWA 2HLFD 4I9WE 4A6YH 3BN9C 1YECH 4TVPH 1XF5B 1R5IA 4Z7UB 3VFNB 4QRQA 1KYOJ 3JTTA 3PG2A 2BX5A 3TJHD 5BXFA 1A9EA 5ERWB 2BSTB 4NUGH 3X17A 1ZV5A 4LP4A 5DFWH 4Y4KA 5I1EL 4PLNC 4NSKB 4NJAH 5FYLL 1EVUA 2Z93B 5EN2A 4PJHB 3FQRB 5EC2B 3WSQL 4Z5RA 1J0ZA 4HF5H 3RBSA 4KDTC 4WHTB 1QQDA 1Q38A 3FRPG 2X1WL 3N50A 3NCJL 4RMVA 1U3JA 3MCG1 5D5MB 4U1LB 1JF1A 2EXWC 3CFIC 4GAJH 5BRZE 2FD6L 4GW5B 1PG7W 3I6KB 1KIPA 4KJWD 3VGEA 2W0LA 3SEPA 3OKEB 4ZS7L 5B8CB 4TVPD 4AENA 1P84J 3F5WA 1OCWL 2HVJA 1DLHB 4JHZA 4MCZA 1HDMA 3DMMC 3MNVB 1WZKA 4HGWA 1H9VA 4KHXL 4X7TB 3VI4E 4NRZB 4RFOH 3ARTA 1IGIH 2APBA 2V2WA 3C5SB 3DRTA 3GBNL 4N1CA 3WO3B 3GSNB 1ERNA 3EDFA 4X7FC 4XCNB 5CILH 4KRPB 1VPOL 4DGVH 3JUYA 4L8BA 4ZFZB 1NGZA 5HI5C 2HJKA 3QHFH 2HG5A 5FKAB 4M4PA 4K8RL 4NM4H 3H7BA 1EEQA 3U2SB 4PGEA 3C6LB 1CICC 3H9SE 1VENA 3TGXA 1YY8B 3TO2B 4HJGB 1ZT4B 5GS1C 2IAMD 1Y6NR 1IAIH 1C1EL 1E4WL 4ZUWB 3GGWB 1K9TA 1QLFB 4MLSA 4O9HH 2G9HA 1RHHA 4U1SB 4PJHE 1ZLSH 5CJ8A 4HS8H 5FA4A 1HK6A 4M93B 3GIZL 2Z31A 4ZXBB 1MJ7L 3IXAB 5IVXA 4G6AD 4KTEH 3RGHA 2E7BA 4GG8B 2EO1A 5D5ME 4N1HB 5B3JF 1BBJB 3KXFB 5CFHA 3MXWL 4JPVH 2HJFA 2NY5L 3NFPB 5L2KD 4YWGH 1I75A 4PB9L 2FEEL 3U82B 5L8LB 3BWAB 1FCCA 5CIPB 5FO7B 1Q9OA 4MWFB 3EYSL 3STLA 4XCYB 1N26A 4ZUVA 3DUSA 4U6VL 3MRMA 5H2BB 5L8KB 3DX9B 1HEZA 3C08H 4FXKB 1WCQA 3MA9L 2F54E 1JP5A 2YSSB 3HC3H 3O2DL 2DLGA 4LSTH 4OQ1A 1FAIL 2Y7QA 4O2FB 5IBUG 3V79C 4KJYB 1BOYA 4JPKH 3Q3GA 5GGVL 2ZJSH 3VD7A 4HWZB 4P2OB 4F7CB 5HVHC 2WNGA 1CFTB 1Q9KB 5LWYL 3VMNA 2P5ED 1QPPA 1FC1A 5DQ9A 1IT9H 4LMQE 4NQDD 4PBVC 4G8GA 1DEEB 3I6LD 5IB2A 4NT6A 2QV2A 4OBRA 3HAEG 4PJGF 3GMMA 3RWDA 4MNGA 2DLIA 2BVQA 2VDNH 4F58H 3GKWL 4YDIH 3MUGB 3R0MA 1RUMH 1UCBH 3BPOC 2Q76A 3MV8B 1WICA 4GQ9L 1HZHL 1HHKB 3RKDD 3WCYA 3KXFE 2KZWA 12E8H 1X5KA 2Z92A 3AREB 2CK0H 3ILQD 1DFBL 2QADD 3CC5B 3MFFB 3MJ7A 2NCMA 1QSZA 5LAXB 3FFCE 2I07B 3QULB 5FDYA 3RWEA 3VG9B 4TRPL 4UB0H 1ZSDB 2YK1H 2NY3C 3MRRA 4X6FB 1JPFB 3C6SB 3FQNB 4G5ZL 5HVGB 3QIWB 2J6EA 4W81A 3BIAX 3FO2A 2NXZB 3DUHA 2R0ZL 3LOWA 3WFBH 2EYSA 1SYVA 5GS0C 4WW2B 3QUZA 2Z8WC 3BGAA 1C12A 1UA6L 3LY6A 4U7SA 3QDJD 1RFDH 4M02A 3MACH 1RIUL 1RZ7H 1CBVL 4LHJB 3V4UH 2LAGB 3ESVF 1R6VA 3QCUL 3C9NA 5E9DB 5AWNL 3RL2A 1A3RL 2F58H 1JNLH 1ZEAH 5EPMA 5CJOL 4XHJD 3KPSD 2FYYB 4HIHA 4YBQD 4UILL 4GRMA 3VFSA 4WFHD 2WIMA 3BXNA 4HX1B 1NDMB 4UT7L 1OAQL 3RQ3A 2L7JA 4Y1AB 3V0VA 4MQXC 2XZQH 2J5LC 3VXRE 3X11B 3SDDC 2MQ3A 3LDBC 3QUMH 3NH7H 3L95B 5E99H 1KT2A 1NCCL 3P30H 3VH8G 4EN3D 1AO7B 4LCYB 5CJXA 1HH9A 4OV5B 1DL7L 1WAAE 3JUZA 3KPLB 3MJ8B 2GKIA 2XY2A 5FM4A 1Z9LA 3E3QC 5BVJB 5E24E 1KCKA 4RRPA 3S35L 3N9GL 3KHQA 3UEZA 3G6DL 4KY1L 4NHUB 1PVHA 4GXVH 4LKXB 4RZCA 1CXIA 1HYSD 1R5IB 1IGJA 3CPLA 2OJZL 2WUCH 3LPWA 4QRQB 2EYTA 3JTTB 2YPLB 5BXFB 1A9EB 2WBJA 3BFOA 4ZYKB 3UBXA 4DKEL 2Y5TA 4NDMA 3LS5H 5EN2B 4PGDA 1FV1B 2VDOH 3KYKH 1QG3A 3G5ZB 3BKCL 1QQDB 4U05A 4P4KD 3RVUD 2CUHA 1WZ1H 5A3IC 3HI1A 4GRLC 1JF1B 2F8VA 5AD0B 5DRXB 2GY5A 4V1DA 1AQDB 3VFTA 3DGGB 1RJZA 4TSBL 4QNPE 4Z76B 1S9VA 4AENB 5E8EA 2WINB 3OJDA 2V7NB 1PBYA 1L0YA 3PABA 3F5WB 2HVJB 3S5LG 1U8NA 1HDMB 1QLEH 1KGCE 1JYWA 4HGWB 3T1WA 1MCDA 1HXYA 4LOUD 2OMNA 1AFVH 5FK9A 2JK5A 3D3VD 1PKOA 3S37X 2V2WB 4WEBH 4WI9A 2BERA 3DRTB 2Q1EA 25C8H 2AI0L 3FT4A 1OP5K 1ULVA 1FIGH 2AK4A 4L8BB 4UNUA 2GSIB 1NGZB 3DOSA 2HJKB 5DD1H 1G9ML 1GZQA 2BJMH 2Z8RA 3H7BB 2AJYH 5C09D 1SM3L 4PGEB 3P0YH 4Y4FC 4LSVL 1JFQH 5GS0L 1I9IL 2YPLE 4BK5A 5CGYC 3VFWB 4L9LC 5I74C 1IGML 1EHXA 3KJ4B 4WJ5A 4NO2A 1T0MA 3EIFA 2G9HB 1KF9B 1NSNH 4YBLB 2VE6B 2FWOB 3EFFA 2Z31B 5IVXB 4X6EB 5CBEA 3TT1H 3P3YA 4O5LL 1IARB 4ZUSA 4CU8A 3KYMA 1MCLA 4JREC 2AJVH 1EHLL 5C9KA 5ENWA 5F93C 4TN9A 5D1XC 4XRCA 3BDXA 4D8PA 1TJGH 4HFUH 2D4FA 1DBML 4CAGA 3WFDH 4WVRA 4Z95H 1Q9OB 3MRPA 4KI5F 3STLB 4N90E 5M95B 2DM7A 2VMFA 1Z3GH 2F19H 1J1PL 3MRMB 4MS8D 5B21A 3ZYOA 2QSTA 4C83B 1HEZB 2CDFA 2XTJC 1QSFD 3FN9A 4IRSB 4LLQA 4FQLH 2DKUA 1T21A 2CD0A 2VLME 1DJSA 2Y7QB 3CH1A 1JGVH 5GGTH 4LVHC 2BVPB 1S7XB 5DGRA 1CQYA 3Q3GB 3GZKA 3WJLC 3W5NA 1OSPL 3FB6A 4M1DL 5E5MA 1NPUA 2Q8BH 5CBAB 4M43L 2VDRH 5E4IA 3Q6GL 5DQ9B 5EO9A 4YFDB 2DQHL 4NO3B 1MSPA 4G8GB 3MZGB 3N85H 3IDXH 4A2LA 2GK0A 2AP2A 5IGXL 5TDOA 1D5IL 2MCG1 2LABA 4Y4HA 2G75A 4HC1A 4UBDD 1ZVHA 4KV5F 1A0QH 2Q76B 4LSDA 4APQB 4HWEH 1LDSA 1S3KL 4K3HA 5L7XH 2AEPL 1EAJA 4YDLB 2NZ9C 3ZT5A 3VXPA 3MJ9A 3IXTA 4NBYB 2XZZA 5I8CB 3W9DA 3ZL4H 3RWEB 4K9EL 3O6MH 2NY7H 4XBEL 4G42B 2VDQL 1IFHH 4K7FA 3WJJA 4HEPG 1KB5H 4U0QB 2F74A 5C0JA 1FL6A 3G6AB 5C0AD 3KYOB 1U8IA 4XXCA 4JN1L 1AGDA 3BJLA 5E95B 4XH2A 2IWGA 4JKLA 4MAUH 1FYTA 1P7KB 3NZHH 4CKVX 4WHCA 3VD4A 4EI6B 1C12B 1ZOXA 4XP5L 4DUVA 3O9WA 4NQSA 7FABL 1MCFA 3MLTA 3DBXA 3C5JA 3RL2B 4DFHA 1T80A 4FNLH 4G6KL 3MNZA 5JXAH 3KR3H 3STZA 4HIHB 4G6FD 4GRMB 3VFSB 4UNTA 3IKKA 4B0MM 8FABA 3ZYJA 4HAGA 4DCQA 5F8RC 3LH2H 4HUNB 3V0VB 1C5DB 4HPOH 2A77H 4OUUA 5DJAA 1YYMH 43C9A 4DW2L 5BOZG 4HG4J 4Z78A 4JFED 4ODSL 1HH9B 1OPGL 4ETQB 3OXSA 4XI5D 1QHOA 3QI9B 1DVFB 1JGLL 2MSPA 5MEPA 1NLBL 4JCMA 5E6YA 1MFDH 5TE6L 1GIGH 4AEHL 1RZJC 4RZCB 1U3HC 4K3DH 1HKLL 2EYTB 3NABH 2R1YA 1CGXA 3OAYH 3ZDXF 2DLHA 2WBJB 3ES6A 4MYWB 4QXGH 5HDBF 1YEFL 3UBXB 3G6JA 2Y5TB 2KQMA 4PGDB 3V5KA 3X12A 5I17A 2V5TA 2BNRD 3SKJL 4P23C 4JQVA 3OHXB 1YPZF 3HI1B 5EH1A 3TA3C 5FYKL 2H32H 3WFCH 3V4VL 3HMWH 5IWLC 3VFTB 3KVQA 4U1JA 1H3GA 4YH6A 1C5CL 5KSVB 1S9VB 4IMKA 5E8EB 1LO5A 5L0QB 1KLUA 5CUSL 4N1EA 2JCCA 1N0XH 4L4TD 4PJIA 1W72A 1RZFH 2AK1H 3AVEA 1CLCA 2LVEA 1X4XA 4KK6C 4WW1B 1E4XI 4JDVB 2VZSA 5FK9B 5SX4I 1KCRH 4JFOA 1RJLB 2OXHA 3FT4B 2FSEA 4LSRL 2AK4B 3REVB 4LEOA 2BDNH 4YC2C 5ACMA 3QRGL 4XC1H 3QFJD 4XAKE 4IIQA 1AGEA 1FZOA 4OLVL 4DVRL 3TH2T 1JPST 4UTBL 3TNNA 2BRRH 1MJUL 1XAUA 2HWZL 2WM0A 1MRFH 4DN4L 4O58H 1N4XH 4G8EA 4F2MA 4WJ5B 4NO2B 1ADQH 1FO0L 1R3JA 1JGUH 4WRLA 3C60A 3EYVA 1HKFA 3EFFB 5CBEB 4XVSH 3HR5A 3LEYH 4ZUSB 1FJ1B 2E9WA 2J1KA 4NJ9H 3DWTA 3D0VA 5EULV 5D7KE 4YAQA 4XRCB 4D8PB 4FQCH 1S7WA 4C56B 3EYQC 5DHXB 1INEH 3BKYH 3WFHA 3Q1SL 2AEIT 1JWUB 3PV6B 4NHCH 1J86A 2C3VA 5HYSB 1TTGA 2VZUA 3HS0B 2D7QA 4QXUH 1J1XL 1NGXA 4PRPA 1KN4H 2E27L 3O0RL 1MFBL 2ZPKH 2CDFB 4B5EA 4LLQB 1YC8A 1K4DA 2O5ZH 1T21B 3BPLC 5ALBH 2DQFB 3BP4A 3O6FC 1HWHB 2EEAA 3L3JB 3RX5A 4K2UH 3ZHKA 4ZNEE 4KRPD 5DD5L 1RZJL 1OM3H 4ZAKC 2WZPD 1XGUB 1RU9H 3UC0H 2C4FT 4PJAB 4Y19D 3GSXA 5E5RB 4QRPB 3FB6B 5EIQA 4OB5L 4EUPA 1AC6A 5BJTA 1Q0XH 1KYOK 3C6LD 1NJ9B 5CIPH 3KPQA 2HKFL 2VH5H 4ALAL 2FIRT 2IEPA 2OK0L 1CDJA 2GK0B 3KYNB 5TDOB 1G7JB 4PS4L 3T4YA 2DQCH 4JLRB 2ZUUA 2G75B 5HVWA 2DQIH 3CJJA 2XWTA 4YE4H 4ZXBD 1UVQA 1F2XK 4ZTOH 1S7UA 3L5IA 2BSRB 3JWOC 3PP3H 4X4ME 3VXPB 2E9BA 3SQOH 3IXTB 5AYUL 5KZCB 2M2DA 3W9DB 1KG0A 1KJ2B 1P84K 3WEXA 1OTTD 3T0VA 1K5NA 4QF1A 2F74B 5C0JB 1FL6B 1S7TA 1A6UL 3L1OL 1RUQL 2VAAB 4DGYL 2VDML 4Y5VC 5DUML 1I8IB 5JO5A 1UEMA 4NC1E 1AGDB 4KK8C 4N9OB 3SO3B 4YX2H 1H3XA 1NGPH 1DQLL 1U8JA 4XH2B 3MYZA 4D3CL 2XV6B 1A5FH 5DZLA 1CVRA 2JB5L 2NY0B 1TQBB 1CDYA 3D85A 4LSPL 3QEQA 3TYGL 4PJAE 3O9WB 1CE6A 4KHTH 4NQSB 4P2OD 1ZLUK 3DBXB 2L0DA 3C5JB 4MA3A 3HRZA 3UJIL 3MNZB 1EV2E 1QOKA 1EMTL 3STZB 1R5WB 2NTFA 4GMTL 5IFAH 2VL4A 5HGAA 5DJ6A 4PRIE 1MVFA 5D2LA 1ZT1B 5TDNA 1UXSA 5KSBE 1J18A 4PRHA 3JWDC 4ACPA 3FMGL 3PF2A 4GAGL 1LO4H 4OUUB 5DJAB 2APFA 2PXYC 3L6FA 4OAWA 1BIHA 2RAMA 3MV8D 5DURB 4F7TA 4Z78B 4G6MH 1B90A 4HIXH 3ARED 2NY2B 4XMLH 1ZE3C 5MEPB 1P9MC 2HFEB 3I6GA 2B4CH 5DFVD 5L6YL 5E1AA 4NRYB 5E2TL 4JJ5A 1JMZA 3QIWD 3QT2A 1CL7I 2VABB 1NCBH 2NLJA 2NXZD 2LFGA 1I7UA 1Q0YH 1TJIL 2HLFC 3X12B 3KLAB 5I17B 5CZKA 1FG9C 2VR4A 3S6CA 5K93A 4Z77A 3UTSA 3LRHA 4TUOA 5EIIA 3MRHA 2XZCH 2VLRE 5E9DD 3SDCA 2W1NA 2Z4QA 3RKPA 3RI5F 4Q6IC 1UKSA 4JJHA 2DWDA 1WQVT 3IDYB 1CK0L 5CEXA 4C4KO 3QDME 3VFUB 4G80B 3R1GL 5SX4H 1LO5B 4KAQL 3J8F7 2VZ3A 1KLUB 1YEJL 4Y1AD 5ADOL 1GPOL 4CNIA 2JCCB 2FRGP 3JWOL 1FHGA 1CLOL 1W72B 3OKOA 3BUTA 2UYLA 1AO7D 1NANI 1V7NH 4LDLB 3H6JA 4MHHI 1P1ZA 1DBKL 4UINH 3ULUF 4GAYA 4KPHL 5CKAA 1NGYB 4OT1L 3SE8L 4JFOB 1CYGA 3VWJC 1U8KB 3EBAA 4M48H 5DEFB 4KC3B 5ID0A 4LEOB 4XBPA 4P46D 4Z0BH 3UBXI 2GSGA 3MRIA 4IIQB 3QQ4B 1AGEB 1FZOB 3B2VH 1XMWA 1MAML 5EU5B 3LQAH 3LKRA 2YPLD 4F2MB 1A2YA 4JM2A 4Z7OE 5DK2B 1GYAA 3RNQA 1VDGA 2QHRH 3EYVB 2NX5A 3PJSB 4IOSD 1T5XB 1LO3L 5BZWB 2VXTH 5DF0A 3T04D 5DJYB 2YXMA 4FQIL 2NY6B 3FZUD 2GJ6B 2IAMC 1HIMH 4GS7C 2W9DL 5FUCE 3FT3A 3WIHL 4E41A 3PHOA 4IRJA 3RUGB 4YAQB 4CVXB 5F96H 3O4LA 1MAKA 4UOW0 1BBDH 4XXDA 1S7WB 2QKIB 3JWDL 5EBWB 3WFHB 2Z9TA 2VQ1A 4G6AC 2C3VB 2ARWA 2Q87A 4GSDH 5CINL 1QBLL 4PRPB 2X9YA 4FFVC 4NBZB 3BSZL 1YNKH 5FGCB 4DZBA 5I1GH 1G0DA 3FB8A 4BJLA 3MZTA 2JJTC 3D39A 5F3HA 5GRVK 1K4DB 2NXYC 3E2HC 2B2XL 2DQDH 2Q3AA 3BP4B 4D9LL 3WO4C 5IB4B 4X98A 4B41A 3BRGC 5HJ3B 5A2FA 2P49B 2B1HL 3CDFA 2HFFB 4JG1H 1AKJA 3C5ZB 3QXTA 4HBCL 1DQJB 3I3DA 2QHLA 1DEDA 3ARUA 4EUPB 5BJTB 4R4BB 2Y9RT 1QP1A 2RGSA 1QO3B 2HT4D 5HPOA 2HT2C 2BOBA 1NLDH 4WDIA 4UT6L 3S36X 1LDPL 2MHAA 2VC2H 2RR3A 2R56H 4LCUB 3QFDB 4Y16B 3L5XH 2R29H 3JTSA 1IQDA 3RZCA 2XG4A 4P59H 3LKOA 4HZAA 3OSKA 1XIWC 5HYEA 2Z31D 5D6CA 1UVQB 2R39A 4R8WL 1S7UB 3T0EA 5EU7E 5IFHH 1BVLB 4LPWA 4TUKL 4BUHA 3CSGA 1MJJA 3WN5B 3B2UD 4Z7QF 2OL3L 1RK1A 1ZT7B 3KPRE 4NRXB 2FH8A 1KG0B 5JXEC 3BDYL 1H3TA 4WV1B 3WS6A 3KPNB 4U1MA 2HFGL 4HS6A 2D3VA 1BQLL 1K5NB 2L4OA 4MNQE 1S7TB 3T09A 5I75C 1AGFB 1YECL 3I2CH 1QRNA 2QADC 3BPNB 3DNKA 3MYJA 2GITA 5T3ZE 5JO5B 4IRSD 1U8JB 4AYFA 1P6FA 1YJDH 4NPYB 3U0TA 2DBJA 4JR9H 4P5KB 3JV4A 4KDTA 3D85B 5HGBB 4QRRA 3QEQB 4OCWH 1CE6B 1FZJA 5T5FL 5ACLA 3HRZB 5I71C 2EH7L 2FB4H 4G8GD 4D9QD 2NTFB 3OKLA 4PJ7F 1KTDA 2BXZA 1EHAA 3C09B 3ZTNH 5DWUH 3RWHB 1H3UA 1UXSB 5T1DL 3QNYB 4QGTA 3DMMA 3ULVF 2UUDK 1GAFH 3QUKA 1KJVA 2CLVA 4OAWB 3L6FB 3QDGA 1MCHA 5FV2A 4YBQC 3SGEH 4APQD 4F7TB 4RFOL 4FZ8H 4JFXA 2ZNWA 4FZEH 1IGIL 1AC0A 1B4JL 2VSDA 3MLXL 1JMXA 1J05B 4NFBA 4L4VA 3MA7A 4NKOA 3K81A 1MOEA 4MXQD 5LXGH 5D70H 3I6GB 5SWSB 1IC7H 2DM3A 1X5IA 5E1AB 3TFKD 1CICA 3BZEA 1OGAE 4JJ5B 2RCSH 5GS1A 1F5WA 4ERSH 4C4KT 1ZANH 3ARBC 3RZWA 2NLJB 4JO2H 4ONOA 4G9DB 1DANT 1TTUA 5HSFA 1CGUA 4AQOA 1EA9C 4X5XA 4HCRH 3QUZD 4JFDA 2LTQC 1HYSC 3DVGA 4HBQA 4KTEL 4WTZG 4BK4A 4TUOB 4JHWH 4Y8DC 3UJTL 2FL5A 3O3UN 4Y5YC 3SDCB 3T8XA 1W0WA 4NZTL 4JPVL 3IAPA 2DWDB 3VGFA 4Q7DA 3EUUA 5KVFH 1G9NH 4YWGL 1PKQB 3NGBB 5EIVA 5IIEB 4YHZH 4OIIH 1GGYA 5KBNC 3IDJA 5HHPA 2QSCH 5I6XB 3QB7C 4OIBA 1CGSH 4N0CD 1JUFA 1DZBA 5E8PA 3OKOB 1CXKA 3MUJA 3C08L 4URTB 3BGFB 5J1TC 1K6QH 3KGRA 4MAYB 4QRSA 3HC3L 1CXFA 1DE4A 3UTTA 2X4OA 1DVFD 4GAYB 5C8JA 4EEEA 3PGCB 3U7YH 5JDJA 4Y5XC 3G04A 5B3JE 4GT7A 2ZJSL 4U7MA 5ID0B 4XBPB 1RZKH 4G9FE 3TESA 2GSGB 4GBXC 4XMKL 3UTZA 4LOUC 1NH6A 1CG9A 3FTGA 5F1NA 2CMRH 5EWIH 1IT9L 4XPFH 3WNPA 1DR9A 2B39A 4PJFF 4S2SB 4QXWA 4YR6B 2ATPB 1N3NA 4LIQH 1RZGA 2MCPH 3EJYC 2WBJD 4HD9A 1A2YB 3F7PC 1RULH 3K4DA 1AR1D 3OMZA 4G6JH 3RWCA 2VDNL 3MLYH 5I66B 3RNQB 3VGHA 2NX5B 4YDIL 2I60H 3ARZA 3L3GA 3DHJA 1RUML 1UCBL 1XGRB 5BS0A 3FT3B 1T2XA 1WWWX 3DYMA 3IS1X 4Q9RH 5GHWH 4E41B 3U79A 3PHOB 2CK0L 4IRJB 4N5EC 3PDOA 2DLEA 1A6WH 2APVA 2H6PA 3S88L 1SYSA 1VERA 3JV0A 4XXDB 4XNUH 5C07E 1TLKA 4OCYH 5D1QB 2NQCA 2APTA 2V2TA 4UB0L 4FQXC 2V7HA 1RUAL 4JG0H 1E4JA 5HDOA 4QRUB 4HG4K 4PJGE 1OP5H 1MPAL 1I9EA 2P24B 3FB8B 3D39B 3PHQA 1B0RB 3FONB 1Y6MR 4RMQA 3LEVH 5LJYH 3WFBL 2Y23A 4PB0L 3DXAB 2AJUL 4FA8A 3WNNA 2A83B 5C0CA 2QQLL 5FYLE 4P49A 4X7EC 2XTLA 1YDPB 2AK4D 2R15A 3MACL 1KCVL 1ORQA 1RZ7L 1NC4B 2ZG1A 1IEAB 2F58L 2P46B 1JNLL 5ITFA 1EK3A 4MLIA 2BOBB 4WDIB 2DKSA 2UWEA 1VESA 3KLHD 4J12A 4I2XE 4GFTB 3JTSB 4JRYA 1IQDB 4GO6B 5B22A 3RZCB 3SDDA 2XZQL 2P5WA 3LKOB 4KJPC 3UDWC 1CD8A 4X4XA 5DHVH 5TF0A 2JE8A 5D6CB 2FX9L 3NH7L 1F13A 2PR4L 4CGTA 3BUYA 5DRWA 1HHGA 2AAVA 3T0EB 1GCFA 2CLZA 5ALCH 1RMFH 3ILPA 4WFGD 3U7WL 3HNSL 5K9QI 2B1AL 3D48R 5JHDA 5CP3A 1RK1B 1FSKC 1R3LA 2Q20A 1F4WL 4C56D 5KJRL 1JZ2A 3FO0L 2VZOA 2GFBA 2V9QA 1AE6L 4KKCD 4K7PY 3QWOA 1S7QB 4RFEB 4GRWF 4MJ2A 3MYJB 2WUCL 3P9LB 2GITB 1YMMB 3EYUH 4JY6B 3PNWB 2XQBH 4PJ9C 3GSRA 1N6UA 3K8KA 4KUCD 3TWCH 1ZHLB 1AHWB 2VDOL 3VG0L 3JV4B 4Z7VF 3EO9H 1V8HA 4PY8J 4QRRB 5CD5C 3FN3A 4FQJH 4C59B 3HC4H 5HHXL 2ZUWA 3GI9H 4QRPD 3VRIA 4CVWA 4GRLA 5DD0H 2E7MA 1KJ2H 4N8CH 4U6XA 1XF3A 2AJ3A 2B8OT 3CXDH 1XZ0A 2CRZA 2P44B 4MB3A 3OKLB 4DEPC 1KTDB 2I27N 4HXAH 1JCKA 4JFPA 4PJCA 3IETA 3TCXA 1L7IL 3DMMB 5DMGC 3O11A 5F6HJ 3QUKB 1KJVB 1T66D 5MHSD 4NZRH 1X5YA 1NKOA 4XGZA 5K9JL 2XXMB 1ONQA 4JPWH 4PTTA 4JFXB 3C87A 1AFVL 3G5XA 5EUKB 5EZLA 1IAIM 1WWBX 2F53B 5I76A 3MRJA 1CDIA 3MA7B 5KZCD 3UO1H 2Q7YB 4NKOB 2R1XA 4PJ5E 1J1OL 4U1HA 2KDGA 1FVDB 3P77A 4OZIF 2AJYL 5FYJH 4ONFH 5JIPA 2DMKA 4Y4FA 1CICB 5E94A 4XI5C 3BZEB 2OSLA 1JFQL 1YMME 1RZ8A 4CN6A 4L9LA 4LLWB 1S78C 2A9ML 3F7RA 1Y0LA 3DYPA 4R97B 4AL8L 3CLFL 3CDGB 4X5XB 2NY0D 4BQCA 4K23L 3P4MA 5C9JB 1NSNL 4JFDB 5KG9B 4PJEF 4TYUA 3IVKB 3PP4H 1FL3B 2BOCA 1F4HA 3F65A 3MXVH 1F6LL 2YUVA 3O9WD 3PWUA 5D6DC 4M3KB 5DUBA 5C6WH 1UYWH 3G5YA 1MWAL 3T8XB 3RVVD 1W0WB 3CDCA 3MV11 2HRLA 4MJ5A 1HYRC 5D1XA 5FHBL 4HFUL 1AGBA 4JRXA 5FYJD 3LRSA 1M6OA 3MRDA 3ARVA 3WFDL 3T2NL 2W91A 3QXDB 4ZTPH 4F9PC 5IB5B 4ZG1A 1AI1L 5L8JB 1K8DB 2E7LC 1WFOA 5GRZA 5DURD 4HQQH 4QRSB 3SGDI 3UTTB 2NY2D 2F53E 2X4OB 3DVNA 5C8JB 3L3IA 5SX5K 3G04B 3WJLA 4KK9D 5FUZL 5HVHB 1A22B 1TQCC 3CUPA 5A2IH 2BY3A 2SEBA 3HG1E 1KTKE 1CG9B 3FTGB 4JKMA 4KMLB 5JMOC 4I5BA 1A7NH 4J3UA 4OF5A 2IPKA 3N85L 1E27B 2B5IC 1WTGT 5EOCL 3QJHB 4RAVB 1N3NB 1MJ8H 1RZGB 4KI5E 4HLJA 5FYJU 3JWNC 4JANA 3LHPH 4YZFE 3O2WH 1S5IH 2D7PA 2OTWA 3VA2C 1J11A 1WSST 3NA9L 5EG6C 3L3GB 3BPOB 1WBYB 3SN6N 5IMMA 2A0LD 4KQ4H 2DN7A 4X6DF 5IFJB 2ITCB 4HJJH 2EC8A 1EX0A 1T7YA 3PGFH 1Z2KA 2LU3A 4LLAA 4YHIA 2LQRA 2H6PB 3O3EA 3AMKA 2Y6SC 4DQOL 4PJDF 4ZFGH 3O6ML 1X7QA 2V2TB 1A7RH 2EXYD 4P2RA 3OKKA 4FQHA 3UX9B 1KB5L 2VLJA 2ADJA 3ZO0A 2WBKA 3F8UB 2CGRH 2V7HB 5IW6A 5FUOH 1U95A 1C8PA 3LD8C 5D72H 3EDEA 5DVLA 2K3TA 5E08L 4FFWD 1H3PL 2X4PA 3UZEA 3WHE1 4NO5A 3PHQB 1OAUH 5B8CC 3SGKC 1YNLL 3THMH 1BGXL 5IHUL 5K59F 5IVOA 1YNTA 2WWMD 2HT3D 4MAUL 3RAJL 1C16A 4KV5E 1NFKA 1I1AC 1FO0A 1Z6JT 1LVEA 2CDGA 5HI3D 3ESUF 3HC0A 1RSFA 2OYPA 1FVCB 4P5TA 1RVFH 2YD1A 1EH9A 4I8DA 5EOTA 1HI6B 3ZSSA 1U8MA 2NTSP 3KPTA 5FGRA 3BKMH 1RIHH 4HWUA 4TOYH 2UWEB 2O93L 3IS0X 4MD4B 3OQ3B 3FQTA 1ZLVK 1FORL 2J5LB 5T3ZH 4HPOL 3SDDB 3LDBB 1PD6A 3H3BC 4UUJA 4X4XB 3RI5K 1YYML 2NY6D 4LLDB 1T3FA 2GJ6D 3BUYB 3VFRB 4X80H 5DK0A 2MQCA 3RA7H 3MREA 3IFLH 3ILPB 5CD3B 5JHDB 4PY8I 4FMFA 1R3LB 1KEML 1PX4A 4M93C 3WLWD 5A16A 5J57B 3GMNA 2X70A 1AQKH 3IAQA 2XN9A 1IJ9A 1U3HA 1TITA 5F97E 3QWOB 4PRPD 1UGNA 1AIFB 1GGCH 4K3DL 3FRPA 3EOBB 4PGJA 1BFVH 3NTCH 3AS3A 5DC4B 4XNYH 3LKPA 3BWUC 3HNTL 2X4QA 4QXGL 4JAMA 4OZFH 3MSPA 5F6HI 4AT6B 3U4AA 4YDVA 2VTFA 1ED3B 3E8UL 3T77A 1LK2A 3JXAA 3CVHL 3RY6C 4P23A 5J1SC 2FEEI 1T83C 4FFYL 15C8H 3C5ZD 3FB7A 4GRLB 3TA3A 4MNGE 2X1PA 5HYSG 2AJ3B 3V6BR 3QNXA 3PWPA 1XZ0B 5IWLA 4LPVA 3HMWL 5E6IC 3TIEA 3H7LA 3H42L 2GTZA 5D2NE 4OCNC 4P2OC 4Y16D 1TETL 2P8LA 1L7TL 5E2UH 4I3GA 5DRNA 4LP5A 3T08A 1ODAA 5DC0A 1N8ZB 3ZDXE 1OAXH 1RZFL 2Q6WA 5HDBE 3B8YA 1ONQB 1SMAA 5EZLB 2K7QA 3BZFA 1KCRL 2ZZUT 3LZFH 5ITBH 5I76B 1ITCA 3MC0A 2DQTH 2EE2A 1QFWL 4FFZH 3C2AH 3SGJC 3RWGB 1YPZE 1UWEH 3P77B 2FEDD 1OAZH 4XC1L 5I9QC 4WWID 3T2QA 2X1OA 2QJDA 3QUXC 4GKZA 5EZJA 2VDKH 3TJEH 2OSLB 1RZ8B 3SBWC 4L9LB 3TBSA 3HCVB 2BRRL 1WZMA 1MRFL 1Y0LB 5C08E 1N4XL 1ZLUH 3T4AA 2V9TA 3MBEB 3WIIH 4LAQL 2EDNA 3P4MB 4J4PC 4CL7A 1A3QA 1ORSA 5EA0H 2H2PD 3BISA 3D85D 4K7PX 3ZKMD 3QEQD 3L3HB 5C1MB 3NOIA 1U91A 2FBJH 5DUBB 1KCUL 2QL1A 3G5YB 4NJ9L 4JREB 5GSRA 4L8CA 4Z7WA 4MJ5B 5D1XB 1QVOA 1XR9A 5IKCA 1F4XH 1GC1H 1MF2L 1F45A 4KTYA 1AGBB 3GM8A 4KKLD 4KWUA 1INEL 3MRDB 4J3VA 3VXOA 3ZHLA 2BVOA 4ZUUB 3S4SB 4PRHD 5F7HA 1JPSL 2V17H 3LEXB 1IGTA 1JHLH 4WFFE 4EIZC 5I8KH 2XTJB 2B0SH 1DSFL 2B4CC 1JGDA 3VCLB 1FDLL 3R06B 2DMCA 1VKXB 4JO1L 4KVNH 5ALBL 3O6FA 1J12A 4NZDA 5KAQG 4P3DA 1MIMH 2W07A 3DVNB 4LVHB 4OF3A 1VSCA 1NEZG 4JHAH 3V6ZA 4ZAKA 3B9AA 4PLKC 3UXFA 1PZ5A 3HAEA 3L3IB 4PJCF 4PGCA 1F2QA 3BVNA 1VFBB 3CUPB 5SWSD 4POZD 3TC9A 2SEBB 4UV4H 3GRWL 1Q0XL 3QO0A 5B39B 2VH5L 4L3EA 5F7MC 2IPKB 1QFOA 4I0PC 5E8NA 3MLRH 4RDQG 3DHMA 3CFBA 4OFPA 2V5YA 1PJ9A 2DQCL 4KUZL 1VFUA 4CMHC 4JANB 3TPKA 3WMSA 2DQIL 2MFNA 2OTWB 1ZLWK 1WGOA 2WSKA 4YE4L 5IMMB 5IBLC 3KWWB 1TCRA 3OPZH 3VI4F 3SDCD 5FYLH 4YHIB 2HTLC 5FO8A 4L29A 3SQOL 3O3EB 4V2CB 4BSWB 2AQ3A 1R3HB 5ISZA 5HDQL 1V3LA 3NCJH 1U92B 4P2RB 3I50H 2VLJB 4M7LH 3SPVA 3OB0H 1CD0A 5IW6B 1CIDA 2FD6H 1U95B 3GUTB 4Y5VA 4M7KL 3SDAC 1M7XA 4ZS7H 4NO5B 1NGPL 4FTVE 3ZYZA 5ID1A 4MAYD 1YNTB 1OCWH 5DC9B 3FO9A 3LQAC 1C16B 3VXUA 2P48B 4FOMA 4ZOEA 2VLKA 3MRCB 5FYLD 1FO0B 4MX7A 4HXBL 3BYTA 2CDGB 4XPGL 4G43A 3HC0B 2C7UA 5HGDA 3QPQD 3OGCB 1EERB 5FB8B 3MLVH 3GBNH 1EJOH 4R9HA 1QSEE 1WFTA 5HHOA 4OLXH 1RJYB 3MROA 3S97C 4NOBA 3VH8A 4F57H 3WIHA 1LD9A 5IFAL 3BEVA 5D7IF 3BZ4A 5J13C 1JZ5A 2IADB 4K8RH 1KIQB 4OSUL 3FQTB 4H0IA 2NX5D 2PXYA 4OZ4A 4UUJB 3OXRA 1FN4A 2HRPH 1JHKL 5C0EA 1T3FB 4JO4L 3WIFA 1C1EH 3KJ4C 3MREB 4DK6A 1NMBH 4E41D 4IRJD 5CJ5A 3O4LD 1QR4A 4YBLC 4GKOA 1MLCA 1LEKA 1DDHA 5A16B 1P9MA 3GMNB 2X70B 2ZP0T 5D1QD 1IGCL 5BZDA 3CGTA 5A2JH 2XN9B 4PG2C 1DUZB 5F7KC 3BYYA 1U3HB 3B9KC 1RV6X 2P7TA 3X3GL 2NY5H 4OM0L 3UTQB 3P11L 3ALWA 1T04A 5IQ9A 4K8RD 1RUPH 3QWRA 4PB9H 3D39D 4D0BA 3LKPB 5KW9L 2X4QB 3DXAD 4FXLA 4JAMB 3WE6B 4YDVB 2ZCKH 4U6VH 1WUNT 3BJ91 3OKNA 4IOFD 3WXVL 4JEGB 4U2ZA 4MQ7A 4CU7A 3PXHA 1LK2B 5FEBA 3MA9H 4P23B 3BP6A 3DVFA 4YDJB 3FB7B 3S5LA 1WTLA 3IF1B 3O2DH 4Q6IA 3TA3B 1FAIH 4MXVF 1BVZA 3JVGC 3PWPB 5TPWL 3EZJB 2EDRA 3I9GH 2OL3A 4QOKE 3MGOA 3EDJA 4JZNB 1Q94A 2X41A 2P8LB 3RZCD 1M71A 3ZT7A 1A6AA 5DRNB 4HKZA 4A6YA 4JFYB 3QXUA 1JF6A 3T0ED 4HHAB 5IVZA 3GKWH 3EHBC 4WO4C 3MBXH 3VWJA 2R4SH 2UZIL 2F5BL 4KKAD 4CW1A 4OLEA 1X9QA 1LO2L 4M48L 4YC2B 5T5NG 3NZ8A 4GQ9H 1YJDC 4U6HB 4APQC 1T89C 3DUUB 2HLAA 3DETC 1XGTA 1YMMD 3NCFB 3LQAL 1AGCB 4ZPTA 3QEGH 4TRPH 4LGRB 4OZFG 5ICZA 2Y07L 3T4AB 1I1YA 5F9OL 4NKMA 4G5ZH 1CQKA 4S11A 1T1YA 2VXTL 3IFOA 1NCUA 1O0VA 2X2YA 4QRRD 3V52L 2IAMA 2WUBL 3OB8A 3ULUE 2R0ZH 1HIML 1U91B 2QTEA 5DVNA 5KOMC 4L8CB 5GSRB 3N1QC 3LQMA 1E4KC 3INUH 4YK4C 3I02A 1NFDA 1XR9B 1NBQA 4XC3L 2DM2A 2UUDH 4ZDHA 1UA6H 1BBDL 1DCLA 1G7HA 2P43B 3VXOB 1RIUH 5C71A 2IGFL 2VN4A 3U9UB 4DUWA 1CBVH 2BVOB 5AWNH 1B2WL 5IBUB 4GSDL 4YHKL 1A3RH 4YGVA 3DMMD 4MCYB 4NNPL 3X13B 1YNKL 5I19L 5L2KA 5I1GL 2JJTA 3DO3A 1JGDB 1BZ7A 3BPLB 4XP9L 1LMKA 4KXZH 4JZJC 1MHHA 4LEXL 3EOTL 2F53D 4H0GA 5GS2D 3V7AE 3V6ZB 1JTOA 4ZAKB 4EKXA 5I1JH 3VXSA 5HI5D 1DBAL 1A4KA 4PGCB 3BVNB 5D8JH 1VACB 5DTFB 2YXFA 1CICD 3QO0B 4R7DA 4X83A 3QI9C 1LNUA 2ZCLH 4IS6A 4PIRF 2DWEA 1NLDL 3MCLH 1N6QL 1OARH 1GGBL 3JV6A 2VC2L 4DTGL 1D3CA 3N9GH 5E8NB 3SJVA 2PW1A 4DZ8A 2NY1C 4KKBC 2R56L 1HQRA 3L7EB 1HWGB 2P5EA 3L5XL 1G9NC 5J89A 4JFDD 4K3GA 4YLQT 1XIWA 3PWVB 2OJZH 3U0PB 3SKNA 3OGOE 1PYWA 3GMOB 3TBTA 2CQVA 5IFHL 2QQQA 1DUYB 3BN3B 2PO6C 5GGSY 4DKEH 2OP4H 3W81A 4TSAH 3B6SA 5FO8B 5JXEA 3BKCH 3OV6A 1XFPA 1JNHA 2N1KA 3WYRA 5ISZB 4H20L 2R4RL 3VMPA 1UM5H 3SPVB 3DO7A 1YZZA 4MJIA 3V2AR 1MCOH 3GMQA 4Y5VB 1RZKC 1JYNA 3M8OL 4TSBH 5ID1B 1G7QA 5L0QC 3UTTD 3T2PA 1YJDL 3FO9B 5KANI 3MRLA 3SE9L 1J8HA 2VLKB 3ROLA 2NNAA 5TGBA 1BX2B 4G43B 2R2BA 3VGDA 5I30L 4Z7QE 3MJGX 1A6TB 1CE1L 1U0QA 2OR9L 3ULSA 2X4TA 1N59A 2JKXA 1NGQH 3MROB 4LASH 3QDJA 1LD9B 4ETYA 3ZTNL 5DWUL 1G9MH 1BD2E 3BGMA 3EO1A 2E8YA 4NYLA 2A6KA 1SM3H 4S1QL 4LSVH 4OZ4B 1I9IH 4WI3A 1GAFL 3TYFA 3OXRB 4FABL 5GS0H 1JWMA 1QR1B 1VB9A 5C0EB 2A74A 1EBAA 1IGMH 3VJ6B 2FATH 1IQWH 2XWJA 5E7BA 3WIFB 4FZ8L 3P40A 2EIBA 4LLMA 5CCKL 3GJEB 1QA9B 1BFOA 2FBOJ 5D1ZC 1MLCB 1LEKB 3DX8B 1DDHB 1P4IH 4O5LH 5BZDB 1I8LC 5D93C 3MRGA 1EHLH 4B50A 4CVZB 4N0UB 2AEQH 2VSCA 3ALXA 4PJ7E 1RURH 1SJEB 1T04B 5IQ9B 5LQBH 3ARBA 4ERSL 5H35A 1ZANL 1VFOA 1J0IA 1KIRA 2OLDA 1G7LA 4PTUA 5GS0D 1G7IB 5HGGS 4H25B 3ULVE 5DJCB 3UYPA 2E8ZA 4E9LA 5B4MC 3OKNB 1SJHA 1VA9A 1YEDA 4PJBF 4MQ7B 1NCAL 2ZNXA 4K7PL 1S9YA 4Y5YA 4NC1C 4Q6IB 2AVGA 4TQEL 3SE3C 4S0TD 2EC9U 1PLGH 1X5HA 1ZHNB 2JB6A 3RY4A 5KVFL 4HK0A 1G9NL 5IM7A 4NCDA 4BFGA 2W59A 4RIRA 1J0JA 3MGOB 4ZFOA 4M1DH 1Q94B 1U36A 3F58L 4JRYD 3PDDA 3SDDD 3TNMA 2DQHH 4PJFB 3RWJA 2IF7A 1Z9OA 3ZKND 4JRWA 1D5IH 2BRQA 3BQUC 1K6QL 3A6BL 2CJUH 1A8JH 3I84A 5JHDD 3FOLA 4NIKB 3VWJB 2H41A 3OAUH 2XA3A 4Y5XA 4YEEA 5DVMA 4UU9A 1MELA 1JF5A 5I1IH 1LEGA 3BHBA 1QFHA 3NZ8B 4NUJB 2H8PA 3CFJA 4GBXA 1RZKL 1HCFX 5EBLA 5EBMB 1CR9L 4H1LB 2AJZA 4N0UE 5I8EA 3LKSB 3TBWB 1OHQA 1XGTB 3S3PA 4F9LC 4OIAA 3IDUA 3HMXL 4ZPTB 4K9EH 3D5OF 4XBEH 9CGTA 2MCPL 4DWHA 4L8DA 1I1YB 4HUWA 2FR4B 4G6JL 35C8L 4PV9B 4ORZC 3RGVC 4GLRI 1MFAH 1T1YB 3NPSC 4JN1H 2C26A 1FH5L 1JZ7A 2JF1A 2RB8A 3EOAA 3ZTJH 1CT8A 3IDGA 5AG9A 1D5ZA 1NUGA 4GRLD 4Q9RL 5GHWL 4JDTH 3I02B 5GGRY 1A6WL 1F8TH 1NFDB 4Z8FH 3IDMA 3VWKC 4XNZC 1A6PA 4XNUL 1IEHA 1FAKT 4QY8A 4GKSA 4OM1L 5HYFA 4FQXA 5JLZA 4P2QA 4U6TA 3A6OA 4WGVB 4PJFE 3WBDA 1BZ9A 2DKMA 4ZFFB 1WBZB 2NXYB 3E2HB 3KNBA 4OFDA 1HN1A 2VAJA 1XF2A 3C8HA 1MHHB 3WO4B 4ELKA 3VFOA 4LLUB 3D1MC 1X5JA 3VXSB 2YZ1A 1QSFA 4QHUB 1R3IL 4DW2H 4ODTL 5DFTA 4AM0A 1OD7A 4S1SH 1JPGA 3Q2CA 4Y4FD 5DMYA 4HIEA 2DQGL 1JGLH 3DURA 1LNUB 4IJ3C 2WK2A 5CGYD 4IS6B 4EI5B 2DWEB 3BIKB 2VDLL 3JV6B 3SJVB 5TE6H 5F88B 4ZO6A 1T1XB 2QR0A 2DQUH 2AQ2A 1NCDL 3BE1L 3UDWA 1HKLH 1XIWB 3QXVA 3VI3F 1EFXA 1CU4H 1JRHI 2JIXA 4FXGB 4NQVB 3HUJF 1BQHG 1PYWB 4CADB 3TBTB 2Z0BA 1LE9B 1RMFL 5F3BA 3PQYE 2BNQE 5D1XD 5E8DL 3B6SB 4Z7VB 5F1IB 4B7LA 1MCIA 4JRXD 3NCCB 4PR5A 3SKJH 1JNHB 5GGTA 5FF6A 2CH8A 4JFFA 1UH4A 2VR5A 4M62L 3V5HA 5FUCC 4MJIB 5FYKH 5I75B 1CVSC 4LKCB 3NACL 1G84A 1U42A 1WISA 2XTJD 4NOFA 1A47A 5SX5H 4PJ9A 2ENSA 4P9MH 2XQBL 3W11C 5IQ7L 4GJTB 2P8PA 2Y5EA 1G7QB 3BDBA 1MHPH 3QUYC 1NBVH 5CUSH 1GL4B 4Q6YA 3KPPA 3MRLB 1Z5LA 4YHLL 3VA6A 1ZKAA 3GJFK 5FECB 1ZVSA 1KJ3H 3EO9L 3ROLB 2QQNH 4JFHD 5LCVL 3CD4A 4QWWD 5TGBB 4FQJL 4EXKA 1U8QA 3HC4L 4U4BA 5SWQA 3GI9L 2R2BB 4AY0A 1I7RA 4ELMF 1EGJL 5F9WB 3FB5A 4M6OL 1KJ2L 5I71B 4N8CL 1Z9SA 1N59B 5CLWA 2O61B 3UPCA 2HT3C 4OZGA 3RWFA 4YO0B 5FYKD 2R23A 4HT1L 3BO8B 4GMSL 2DBLL 3QRGH 2R9HC 4GRWE 4OLVH 1P4LA 4P57A 4DVRH 4OKVA 3V4PL 3OBAA 4OD2A 3TYFB 1KB5A 1JWMB 4UTBH 4NZRL 2A74B 2XWJB 1B3JA 5F7NC 3T0DA 3H2WA 2NZ9D 4LLMB 2K7PA 4J1UB 4Z7VE 2EEDA 3DROA 5F7LB 3V8OA 2GW5A 1LP9F 3MRNA 2ZUQB 2D7OA 2NY6C 5C7XH 4R7NA 5CP7A 4P2RD 3HKFA 1OGTA 2VLJD 3HZVA 5E03A 3MRGB 3GSQA 5EU7C 1RK0A 3HI5L 4PUBL 4AEIL 2YKLL 1FGNL 2YUXA 5FHAH 4O2CA 2VLLA 4X9HA 4AH2B 1X4YA 3BD3A 4HV8A 5BCAA 4E0RB 1IAMA 5F6IC 5FYKU 1TVBA 2LTQB 2E27H 2HTKD 1MFBH 1SJHB 1YEDB 4JPIA 3CNKA 1VADA 5D6DA 1UM6L 3WXWH 2N56A 4HKXA 4Y5YB 3MOBL 4ZD3L 4A2MA 1QKZH 4TPRH 3SKOB 1YY9D 3O41A 2CKNA 1MCWW 4XZUA 4HK0B 3QQNA 5GS3A 5IM7B 6CGTA 3Q6FB 4OZIE 1BAFH 2IBGA 4U6YA 5JUEL 1BEYH 3L7FA 1EZVY 1N5AB 3C5ZC 4OB5H 5DA4A 5T1LB 2F9BT 5TE4L 1QBMH 1MNUL 3NCYP 4ALAH 5BRZA 2E7LA 2P8MA 4ZO9A 4NQCE 2OK0H 1I7TB 5GZNC 2VXUL 3QHTC 4JE4B 1NCNA 5EO0A 4PJEE 3VD3A 3RFZC 4BH7A 2H45A 4Y16C 4JN2A 3UP1A 3HNVH 4YNYB 5F89B 1MCSA 3ULUH 1M7IA 1N6VA 4Y5XB 1TZIA 1QRNE 4UU9B 1LEGB 4X6BB 2VXVL 3BHBB 3HRPA 1TNNA 4K94H 1NL0L 4GBXB 5EBLB 2XN9D 3I75B 2BMKB 2YUZA 1YEGL 1U3HD 3AUVA 5J1AA 1INQA 3SKUD 1YEKH 3CVHA 4UDUA 3RVWC 5AYUH 4HUVA 2C1PB 3IGAA 3MV9B 4WI7A 2H32A 4WV1C 2YBRA 2IANE 5IJVA 4BFIA 4HUWB 1F4AA 3LHPL 3CMOL 1OL0A 3O2WL 1XF5A 5I2IA 2VDMH 1EHNA 2X09A 3VFNA 4UV7L 3BPNC 3H9SA 3N1MC 4J3OC 3N1GC 4R4FL 5ERWA 4P23D 3IDGB 4HJJL 4XHQA 3VFGL 3TA3D 2LV4A 2JB5H 3N1PC 3TCLA 2YA1A 1K2DA 3O6LH 2D03H 3PWPD 4PJHA 3FQRA 1B4RA 3OL2A 2PKDA 4LSPH 3QDGE 4ZFGL 4QY8B 4GKSB 4FQXB 5D5MA 5JLZB 4P2QB 2CGRL 5INDA 4GW5A 4GG6F 3BH8B 1DLFH 2EEBA 3FL7A 4L4VE 4N9GB 4DJMA 2X5PA 4GMTH 4KK6D 5B8CA 3OKEA 3QCVL 1IZKA 4FRWA 3K4AA 3SGKA 1XF2B 4U1IA 1K8IA 1OAKL 3P0GB 4ELKB 3VFOB 2WQ8A 5EUOF 5T33H 1I1AA 4X6DE 1ADQA 3U1SH 2FDBP 1BIIA 5DHYA 3WKNA 4MMZC 1GH7A 2F54A 1JPGB 5JW4M 3UPRA 4HIEB 5EU4A 4PJDE 3T0BA 1JZ8A 1S9XA 3U83A 1TIUA 1MWAB 2RHEA 4ZFZA 4TOYL 5JQ6L 5ANME 3NN8A 3DX6B 3VXME 1U3YA 2ITDA 3VFMA 1GC1C 2QR0B 2PCPA 5GRUH 5T3ZL 3U2SA 1B6DA 1EFXB 3TM6A 2X9XA 1YY8A 3ZTJG 5I15H 2JIXB 5K59E 4JFZH 4EXPX 4OTXL 4X80L 3RA7L 1MFCH 3GGWA 5F3BB 1QLFA 3DARA 4MJ6A 1TJIH 4U1SA 1FSKB 5ESQB 3EYQD 4ZXBA 4LCWB 4PR5B 1M4KA 1AQKL 2C3WA 3MOAL 1DQDH 1V7MH 3P73A 1OOAA 1IAII 1BBJA 2D31A 3KXFA 4JFFB 5DD6B 1T7WA 1LO0L 2R0KL 1CGTA 3I3BA 3HHRB 3FFCA 4PJ9B 4M5YH 4X4ZA 3BWAA 3R1GH 4GKNA 5CIPA 2PETA 2WAHA 5FO7A 2VR9A 3NGBC 1J7VR 4MWFA 3O6FD 1YEJH 2J8UF 5ADOH 4X6CF 1GPOH 3KPPB 3JWOH 2BP3A 3O81A 4ZAKD 5H2BA 1CLOH 4IHOA 1TVHA 4FXKA 3RY6A 5JW4Q 4XPTL 1U8QB 4YXKH 1T83A 3HLAA 3BGFC 1I7RB 2YSSA 3T2OA 1F3JB 1DBKH 1PSKH 4KPHH 4B7IA 3VXTA 3S4SG 3MCKB 3SE8H 4AK1A 1ZLWH 4DEPB 2R23B 4P2OA 4M1CC 1CFTA 1Q9KA 5BS0E 3IDNB 1PX3A 5KS9F 5DD3L 1MAMH 4OKVB 4OD2B 4QLRA 1KB5B 4K55A 4O02H 3ULVH 1MCNA 1VGKA 1DBJH 5HYJE 4DUXA 4ORGA 3DROB 4NNYB 5ITBL 3VXRA 4ZOBA 4LCWE 5B39G 5BQ7B 3SGJA 1PW3A 2OQJB 4FFZL 4FQIH 4ESKA 4KROB 3MRNB 2F8XC 5ISZD 1UWEL 4R7NB 3HZVB 3QUXA 3WIHH 1WAAA 1REIA 3AREA 5GRJL 5IBTL 2DIAA 5MERA 2VDKL 2DI7A 3SBWA 1V3KA 4WTZA 3GNMH 3JWDH 3QULA 1MUJB 5I1CL 4KK8D 2PW2B 3S98A 1H5BB 5D1QC 2DJ4A 3RVXC 4HV8B 4J4PA 5CINH 3WIIL 1QBLH 3UYRL 1T0NB 1M1SA 3C6SA 3BSZH 4HZLB 2VLKD 5EA0L 4JPIB 3ALPA 4HKXB 4D9RE 5FGSA 3O41B 4CUCA 3B3IB 1IC4L 1JWSA 2P5WE 4XZUB 1GC1L 4Y2DC 2BSSA 2ICWB 1JZ6A 2X4UB 2HA1A 4XCCL 4LRNL 5GGQL 2GIYA 2CIKA 4LQ1A 2V17L 5BRZB 1JHLL 2FYYA 2P8MB 4KVCL 4OFVA 2B0SL 5GRYA 2E3VA 4HGKC 4OZHF 1LDPH 1MAJA 5DUPH 3G08A 5CLTA 5EO0B 4KVNL 1IM3A 5AAWA 1MIML 5FXCH 4JN2B 3SO5A 4JHAL 4MJ4A 1M7IB 4N0YL 1TZIB 2YD5A 1FLRL 2CXGA 3L95A 4R8WH 1TQCB 3GHBH 3L3KB 4LK4A 3SDXF 1AO7A 3O6KL 4LCYA 3QIBC 3MUZ1 4TUKH 4OV5A 5J1AB 4UV4L 3CK0L 3CVHB 4U31A 4W68A 3ZKSD 2B5IB 4HUVB 2CPCA 3RWIA 1QBAA 4XP1H 3BDYH 5FM5O 4E42A 2X40A 3IGAB 4LVOC 3WUWG 2HMIC 2H32B 2D7TH 2HFGH 3MLRL 5IJVB 4NHUA 4BFIB 2RFXA 4LKXA 5J8OA 4P5MA 1JJUA 5I2IB 3RP1A 1T03H 3T0XA 3H9SB 1U8LA 2YPLA 4MD5B 5F44A 2X10A 3OPZL 1OT1A 3A6CL 4ZYKA 3TCLB 5ICXA 1K2DB 1FV1A 4PJCE 1AHWC 3G5ZA 4H1LH 4UNVA 4K71B 5JPNA 2E6QA 5T5FH 1OQOA 4JY5L 3ET9F 1S5HA 3I50L 5IOPA 4M7LL 3SCMC 1JI2A 2EH7H 1IKNC 5INDB 3LD8B 4J2XA 5IEKA 5HD8C 3SDAA 1FZMA 2WWKT 5AD0A 5DRXA 5IMOB 1J8KA 1AQDA 3W82A 5D7IB 3DGGA 4XP4L 4Z76A 1TJHL 1CXHA 2WINA 3P2TA 1OB1B 2V7NA 4Q9BA 4XNMA 3U36A 5T1DH 4U1IB 1K8IB 2DICA 2ICES 5GIRA 1DTUA 3VWJD 1EZVX 1I1AB 1A3LH 3KLSA 3FT2A 2ZUTA 1BIIB 5DHYB 3UTPE 4PGZA 2GHWB 2F54B 1OSZA 1B4JH 3MLXH 2VOTA 2BNUA 1FGVL 3MLVL 3UPRB 1EJOL 5EU4B 1S9XB 4OLXL 1OP3K 2KKQA 4XMPH 2FLRT 4F57L 3TN0C 3QJFA 2GSIA 4MQTB 4JFQA 3NN8B 3UPAA 1XF4B 1AY1H 4J8RB 2ITDB 3VFMB 4JVWA 4H88L 2PCPB 1I1RA 4QKXB 4N8PA 4Y4KC 1OVZA 4F15C 3HA0A 2IQAA 5HYIA 2HRPL 3C8KA 3VFWA 3V7AG 3KDMA 4H26B 4LPUA 4ZPVA 4R97C 1NMBL 4KI5C 5L88H 4MJ6B 1J0YA 2VE6A 4NQEB 2FWOA 1GZPA 3NAAL 1KPVB 1KXQE 4RQQB 1JV5A 3STBA 5IP4A 4X6EA 4LCCB 4PG2A 4Z7UF 5FGBC 5GRVL 3B9KA 3P73B 3UJTH 3X3FH 2D31B 3OJVC 4NZTH 1O7VA 4FFVD 1RIVL 2H2SD 1G7PA 3U7AA 5D7IE 1RUPL 3KS0H 3ZYIA 4PJXF 1FVEB 3FFCB 2NXYD 2AXJA 4GKNB 5D7LB 2XY1A 4KMTL 2IJ0C 3CLEH 1EEUA 2JLLA 2EE6A 1FC2D 2ZCKL 3QO1A 2D0FA 3RVTC 1MY5A 3VXSD 4C83A 5I1LA 4ODHH 4IHOB 1TVHB 4IRSA 2K1MA 5IK3B 3HLAB 5TQ2L 3WL9A 5LBSH 2EDBA 5GRXG 1RJCA 3VXTB 3JVGA 2HT2D 1SVCP 2BVPA 1S7XA 5E6IB 4EI5D 3I9GL 3SJVD 4XMKH 2G60H 4H5SB 2RBLA 5CBAA 5I1HH 2VWEE 1XIWD 4NO3A 4FP8L 3MLPA 1VGKB 4MA7H 3TBYB 4G7VL 3D9AH 2QQKL 1FL5A 3MLUH 4WO4A 3DV4B 4NQEE 4ORGB 3O8XC 3MBXL 1U58B 2R4SL 3VXRB 5JXED 5BV7B 1EO8L 4APQA 1T89A 5I9QB 4MXVE 3QUXB 4MJID 3PV7A 5MERB 3S88H 2LU7A 5I8CA 1MHEB 1ZA6A 3QEGL 2XT1B 4RGNB 4G42A 5D7LE 3UAJC 2G5BA 1ND0A 3G6AA 5EC1A 3KYOA 5K9KA 1RUAH 4TUJA 2DB8A 5EO1B 4GXUN 3FOMB 1J8HD 1Q72L 4UOW1 1G9MC 1MPAH 1XGYL 2UV3A 4FQ1L 3TVMC 4U33A 5DRZA 3GMRB 1E4XL 1KJMB 4PB0H 2AJUH 1E4KA 1M7DA 4X9GA 5TF1L 1MHCB 1P7KA 3INUL 2R2HB 4K3EL 2QQLH 1JWSB 4EI6A 5F7FA 1HSAA 2BSSB 4TVSa 4TSCL 4NP4H 4HWBH 1KCVH 2AJXH 1VEOA 5T3XE 1I9JH 2ZKHL 3NCMA 2G5RA 1G6VK 2CIKB 3LN5A 1QSVA 4X0KA 3U9PL 3CFDA 3ZKXC 3GK8L 3KLDA 4MNHB 5D2NC 3G08B 4JZJA 2YWZA 1IM3B 2DAVA 5JOFA 1C5DA 1SMOA 1XGPA 3HE7B 1P7HL 1UWXH 2FX9H 4PREA 5I1JL 2PR4H 1YYLH 4HCRA 5D8JL 5TE7H 1F90H 3ZKNC 3P4OA 3NFSL 4ETQA 3U7WH 2ZOKB 3VXNB 3HNSH 2E5EA 2B1AH 3QI9A 1DVFA 5AG8A 2ZCLL 1F4WH 5GQBA 5KJRH 3ARBD 3MCLL 3TO4C 4I0PB 1F11A 1OARL 2PYFA 3RWIB 1W0VA 4RGNE 4E42B 3FO0H 4Z18A 4GW1A 4CMHB 1AE6H 3V8CA 2RFXB 3AB0B 3TZVC 5JW4R 4P5MB 2D4DA 5DJ8A 5I0ZA 2CRIA 1U8LB 5JOPD 3BP7A 1KTLA 2EKSA 2PO6A 4RMSA 2JELL 5I73C 5IF0A 2OP4L 1C5BH 5ICXB 4OLYH 3ZMRA 2XYCA 4TSAL 3VG0H 2D0GA 1P5VA 1W0YT 5HHXH 5JPNB 3LB6D 3OHXA 1S5HB 5IOPB 1UM5L 5T1LD 5DYOA 3RTQC 3W39A 1G6RB 3OAZH 5IEKB 1MCOL 5L9DH 3SDAB 1FZMB 4U1GC 1IBGH 4WW2F 1T22A 2XPGB 5KSVA 4XNMB 2ZG3A 3U36B 3HMXA 1KOAA 5DMKB 5J9PB 5GIRB 3HPJA 1L7IH 2W0FB 4K9EC 3DIFA 5CEZE 5EU6E 3AROA 4WUUE 3FT2B 5K9JH 4GBXD 4AQ1B 1FBIH 4WW1A 1TENA 4JDVA 1OSZB 2CLRB 2BNUB 1IC5H 1NGQL 3JV5A 3FQUB 4WFEE 1RJLA 2AKRA 4LASL 1J1OH 2W0KA 3REVA 3MV9D 3EJYD 3QJFB 5J13B 4JFQB 1GOGA 2EC9T 2RJMA 1KULA 4RNRB 1A6VL 1MCJA 1JPTL 2C1OA 3SE4C 4OFKA 3CFEA 3VRLF 2IQAB 3GMPA 1KIUA 3QXAA 2A9MH 3C8KB 4X8XA 2GUOA 3KDMB 2FATL 1IQWL 1D9KC 1HHIB 4ZPVB 4AL8H 4NGHH 3CLFH 3K8LA 4N5ED 2XNAA 1P2CB 4K23H 3MBEC 4H1LG 5D1ZA 2LU4A 4LHUB 4AMKL 2A6IA 5MENE 1ZK9A 1GZPB 2R1WB 3Q0HA 1JV5B 4WWKC 1P4IL 1RY7B 1JL8A 1I8LA 4FQXD 3B9KB 1MWAH 1FJ1A 5IT2L 4P2QD 3B4NA 3DRQB 5DVKA 2ICEA 4DKDC 2AEQL 3E6FA 4X4MA 4YFEA 1G7PB 5MI0B 5CGMA 1RURL 5FHBH 3DSFH 4C56A 5LQBL 3E0GA 3FHAA 3PV6A 1JWUA 2BFVL 1V5JA 4KFZC 3T2NH 4X8JA 5HYSA 4PGBB 3HS0A 1MI5E 4FG6C 3AS2A 3QSKB 3QO1B 1AD9B 2AXFA 1AI1H 4X9IA 4YZFF 3ME0A 4RBPH 5I1LB 4L3EE 1OF2A 5AUMA 2ESVB 5E00B 4XBGB 3RL1B 5C2BL 2DQFA 3WL9B 4DAGH 5DHVA 3GO1H 3SE3A 1WIPA 4LMQI 2J6EL 3L3JA 1PLGL 1X5XA 1FFRA 2OS7A 2DDQL 5FUZH 1XGUA 4J6RL 4QWWC 4PJAA 2J4WL 4U2YA 4YHOL 4QRPA 3D25B 4KJPD 3QA3B 1NJ9A 1EFXD 1QFUL 2JIXD 1SBBA 2YEZB 2VXQL 1BQUA 1CL7L 5EOCH 3KYNA 2BXYA 1G7JA 1FL5B 2CJUL 4JLRA 4WO4B 5HHVL 5KSBA 4PJBE 1JI1A 1RZIA 3NA9H 3OAUL 3GHEL 4LCWD 5I1IL 2D7NA 5E7FA 1KEGL 2HVKA 3WUZA 1KLFA 4OV6F 1F3DH 3O45A 4YPJA 2BSRA 5DMIL 4JFFD 1FRGH 1CS6A 1N0LA 2P1YA 1H8NA 5FM5M 4F9LA 3VXUE 5TQ0L 1EGJA 4DQOH 1KJ2A 1ZA6B 4PJ9D 2LAAA 1DQML 4RA3A 3FRUB 4UIMB 2G5BB 2XG5A 3AC0A 1YQ2A 5DXWA 1ND0B 5IVXF 3RDTC 4AZ8A 4HH8A 3RGVA 5EC1B 5K9KB 5SWZE 4TUJB 1MFAL 5BMFL 2VAAA 5CD5D 4PLJC 4Q9QL 5HHOE 5E08H 1I8IA 1H3PH 1MRCL 2ESVE 1PQZB 1YNLH 5DRZB 1BGXH 5IHUH 2A9NL 4DOHE 1WIOA 1M7DB 3B8SA 1FNSL 4YK4B 3HTLX 1U6AL 4JDTL 3RAJH 1H8OA 3D69B 4Z8FL 1F8TL 2EDKA 4NFDA 2HTKC 1HSAB 3K1KC 4ODWB 4AIXA 5F9JA 2VB5A 2DJSA 1TFHA 5GZOC 4PRDA 1NEZA 4HS3B 5DMGD 1HXMB 3GI8L 4PJ8B 1YY9C 4I3SL 2YRPA 3LN5B 1R5WA 1OTSC 2PYEE 3LIZL 4X0KB 3QPXL 3BX7C 3CFDB 3QDMA 1ZT1A 1UEYA 4OCMC 2M1KA 4JZJB 1JNJA 3OWEA 1FORH 4S0SD 5JOFB 1OT2A 1B6UA 4OJFL 1XGPB 4PREB 2NY4C 3ROOB 5D7JC 1D5BA 1RPQA 4FHBD 5C0RL 3P4OB 4S1SL 5I16A 2BHZA 4L4JA 4QEGA 1KEMH 1WK0A 3DV6A 4M9OA 1S78D 1ZTXH 4Y0GA 1F11B 2PYFB 1W0VB 4S10A 4F7PB 2NY1B 2J7LA 5E56A 1A7OH 4GW1B 2HFEA 5C0DA 1UG9A 2Y06L 3BAEL 2DQUL 3QXWA 4NRYA 4U1KA 4I9WD 5DJ8B 1AXSA 5CZVL 3RY5A 2R69H 2VABA 4MDJA 1CU4L 3AS0A 5EB9A 4AIZB 4YHNB 4LSQH 3HNTH 2JJSC 1KTLB 2EKSB 3BP7B 2PO6B 2YA2A 4XPAH 3LV3A 3OKDA 3B9DA 5IF0B 2BCKA 5C0FB 3LPFA 3KLAA 5CSZA 3ETBF 3E8UH 4D0DA 1N2RA 3T65B 1L4IA 3CVHH 5C0NC 4FFYH 1C7SA 4TVPE 1GRWA 3ULUC 5DYOB 4NM8L 5JTWA 3OKMA 3EDDA 3W39B 1D6VL 4K94C 5BRZD 4NQXB 1WWAX 2FH6A 1T22B 3H42H 3VFUA 1I7ZA 4P9ML 5AAMA 4G80A 3QUYA 5EOQH 2O5XH 5IHZA 1V3JA 1EEZA 1MHPL 1NBYB 1NBVL 1TETH 3VI3E 1L7TH 5KVDL 5JZ7D 3HPJB 3HUJE 1XGQA 3UJJH 3DIFB 1KJ3L 3ZE1F 4UMGA 2QQNL 5I1KL 2APXA 1QBBA 2DD8H 2ICCA 5F9DC 3UTPD 2NPLX 5DJXB 2VRAA 5DQDH 2F8OA 1NGYA 1LP9B 1U8KA 2AKRB 1QFWH 4HLZH 4P99A 5DEFA 5JIIA 4ZSOB 3E6HA 3KPMB 4LCIH 2EDEA 2Z8VC 4M6ML 5BVPL 3QQ4A 4XP6H 1WEJH 2C1OB 4R4NC 1SQ2N 3CFEB 5EU5A 1UB5B 3H9SD 1CD1A 1DQTA 3GMPB 3QXAB 4M4RA 2GUOB 2X4SB 1BJ1H 3AY4C 2EICA 1C7TA 3DYOA 1A7PL 3L3OB 1MIEH 2XNAB 4LAQH 5DK2A 3PJSA 4I1NB 1VEPA 5D1ZB 1T5XA 2A6IB 2Y6SD 5BZWA 5DJYA 3TBVA 3VDBA 4ELME 2GJ6A 5J6GB 1SY6H 5C7XL 3QCTL 5D93B 1KCUH 1FFOA 2M26A 5AEAA 3RUGA 2ICEB 4CVXA 3E6FB 1MF2H 3KPRA 2QKIA 4QO1A 5EBWA 4OGAC 5FHAL 2ZSWB 1MFNA 4DFIA 2XKNA 4X8JB 4I77L 3PGDA 4TNVF 3MGTB 4MNQA 1JPSH 1I85C 1I1AD 2WLZA 2AXFB 2YN5A 3EFDH 1DSFH 2EZ0C 2VDPH 1OF2B 1FDLH 5AUMB 5DS8A 3WXWL 3V6OA 4JO1H 2F54D 5DHVB 1QKZL 4TPRL 1RUKL 5CSBA 5IVNA 4XB7A 3S96B 5IB4A 1LP9E 3W2DH 1WC7B 4NQDE 1KV3A 5HJ3A 4ZSOE 3QQ9C 5AYQA 3I6LE 1BAFL 2HFFA 4KH2A 1KELL 1BEYL 3C5ZA 1DQJA 4HUUA 3EJZD 1IE5A 3GRWH 4KQ3H 4R4BA 1QBML 1QO3A 2X89A 4P2CG 1W2KT 1MQKH 5F71A 3BQUB 3U48A 4PRIB 4LCUA 5L2JB 4KUZH 1IGFL 3QFDA 4Y16A 4PG9A 1GGIH 4BH8A 3H8NA 5KSBB 3HNVL 3P9MA 4NQED 1RZIB 3ULUL 5GJTL 3Q5OA 4G3YH 5FDWA 3LKNA 4OZFA 3L3DB 3L5HA 2HVKB 4K94L 4D94A 3O45B 1BVLA 3KXFD 3QR2A 4W6YB 3WN5A 1BPVA 1YEKL 2BK8A 1ZT7A 4M61A 4NRXA 3EYOA 3AM8C 5M94B 5E1HB 3FQWA 5D71L 3FFCD 4WV1A 2IFFL 2MPAL 3KPNA 4OLZL 5HDQH 3GB7A 5I1AB 1WZLA 5D7LD 1MCWM 3RGVB 4JGMA 1AGFA 4XWOC 3WDHA 3NPSB 5JOEA 2OR8A 3F6LA 4M7KH 1OGAA 1GOHA 3QDJE 2MKWA 2GT9A 4O51A 3OAYK 3CFKA 3F7YB 5BV7H 5KSAC 1L6XA 3PIQB 1TMCB 4NPYA 3O6LL 2D03L 3ULVC 3VWKB 4P5KA 4XNZB 5E6ID 3G5VB 4HXBH 3KPSE 5HGBA 2YHGA 4XPGH 3PL6C 1YN7A 5F9JB 2CIIB 4XVUC 2H9GA 2VLRB 4PRDB 5I0DA 1NEZB 3U6RB 4I13B 1U8OA 1B88A 1DLFL 3LVEA 3HI6H 4Z7NF 4KUCF 4YQXL 4K3JL 3RWHA 3BW9B 3QDMB 4PRNA 4OSUH 3OX8B 5DJ0B 1TNMA 3QNYA 1KBGL 2EYRB 3VXRD 5T33L 2NW3A 1CGVA 5HTSA 1JHKH 3U1SL 5DJDB 4JO4H 1D5BB 5HY9A 1QD0A 3NA4A 4YUEL 4YHPB 3LKQA 3QUXD 1J5OL 5I16B 1J05A 4IJ3B 3S37L 3DV6B 3SKMA 1FNLA 3WNLA 2UZYB 1IGCH 1NGWA 2AV7B 4XNXH 5C0DB 3RBGA 5SWSA 3SGEI 1KXVC 1CXEA 4J3SA 4J4PD 2CKBH 4P48A 5EFIA 3X3GH 4GG6E 5GRUL 3WV0A 4U1KB 2ED7A 1FQ9C 3AU1A 4OM0H 1AXSB 3P11H 1UT9A 5E2WL 5FOJA 5I15L 1XH3A 4MDJB 4YDKH 1JK8B 3OR7B 1OTUC 4JFZL 5KW9H 2EDHA 4G9DA 2FGZA 3LV3B 4Y8AA 5EUOE 3OKDB 1MFCL 1I9RL 2BHYA 2BCKB 5EORL 4U1NA 4DN3H 3WXVH 2ED9A 3QYCA 3FCTA 1VFAB 1MCEA 5CSZB 4D0DB 1N2RB 3DJ9A 1CWVA 1DQDL 1V7ML 2VN7A 5EZIH 5GISL 3OKMB 5TPWH 4KGJA 2VIRA 5DEGB 5C07A 1H0DA 1PKQA 1I7ZB 3EW3B 4M5YL 3QUYB 5IHZB 5IIEA 1EEZB 1S9KC 3IRPX 4W4NA 3D3VE 4MVBD 5KS9B 1MLBA 3ARYA 4PLKD 5C92A 5JIHA 1XGQB 3HE7D 2XFXB 1XCTA 2IALB 1KGCD 4HAFA 3GKZA 4PJGA 3M17B 1YN6A 3S35X 4YXKL 3RNKB 4I18C 1QUNA 4MAYA 4WU5B 3DECA 1HH6A 3P0VL 1PSKL 5D96B 5JIKA 5C09E 2UZIH 3PGCA 4P3CL 2F5BH 5DLMH 1T1ZA 1G1CA 1LO2H 4I0PD 1G6RH 4BQ9A 4MZ3A 5DDHA 3WNOA 3E6HB 4XPHH 1U9KA 3HZYA 5KN5B 1UJ3C 2FLBT 3EGSA 1WIUA 4NZUH 2B20A 1P7QA 2BY0A 4NN5C 4HIIA 4KRLB 1CD1B 5IBLD 4S2SA 4O02L 4YR6A 3ULVL 1YQVL 3K2UH 2ATPA 2AV1A 5DSCB 2J8UE 5ILTH 4X6CE 2Y07H 3NIDF 5F9OH 2HTLD 5I66A 3CH8A 1K3IA 4I2XA 3GFUA 1DBJL 3F12A 5GJSH 2FX8L 3WKML 3MRBA 2Q7NA 3V52H 3TBVB 3VGAC 2WUBH 4NNXA 4BKLA 1XGRA 3ZKQD 3BMWA 1FFOB 1OW0C 3B5TA 4GXUM 2X9WA 4U49A 3PP3K 1MRDL 4F7MB 2AGJH 4RA0C 4RMTA 3SDAD 4XC3H 4ONHA 4S1DC 2CUIA 3GNML 4ONGL 3KPRB 3G6JF 5D1QA 5DVOA 2IGFH 1QSFE 2XKNB 1B2WH 5F6IB 3PGDB 2FECI 5HPMB 5KS9E 4YHKH 4MNQB 5GGUA 4OQTH 2FJFB 4N90D 1U8PB 5K33A 1JBJA 2H2SC 4NNPH 4QRUA 4XVJH 5I19H 4OZHB 1OP3H 2P24A 2COQA 5DS8B 3CAFA 1B0RA 4XP9H 3FONA 2OZ4L 3DXAA 2VLMD 2W65B 1I3GL 4LEXH 3EOTH 4RX4D 4WHYH 2A83A 4HLZG 4Y2DA 1VGEL 1YDPA 1DBAH 2JCCF 4G6FB 5CJBA 4PJIF 1NC4A 1IEAA 4HUUB 4RAUA 2J2ZA 5A1AA 4PV8B 1N6QH 4EI5C 1GGBH 4DTGH 4EBQL 3BRFA 4BSVB 5DUPL 1OY3B 4PG9B 3VRJA 5GGSA 1LWRA 4BH8B 1EJ6A 2ZOLB 4LHUD 4N0FA 3P9MB 4LPXA 4XWGL 4XCEB 5FDWB 3LKNB 4OZFB 1A1OB 3GHBL 3QIBA 3B9KD 5DGQA 2X4NA 5JPMB 5CWSA 5C0AE 4WY7L 4LL9A 4M61B 2D9CA 3EYOB 3FQWB 3O2DA 4XP1L 5IR1B 2GK2A 4PJ5A 3GB7B 2D7TL 2DIBA 4H20H 2C4XA 3RJDA 4HULB 4NWUL 2R4RH 4G8IA 2PTUA 4I48A 1S7QA 4RFEA 5IB1B 4OZHE 4OZGE 4MB4A 3P9LA 1T03L 1YMMA 1OGAB 1ZXQA 3M8OH 4JY6A 1F6AA 3PNWA 3RUGF 4X5WB 1I4FB 1U8HA 2ESVD 2GT9B 4O51B 3V0WL 1FNEA 2DMBA 3CFKB 1BLNA 1ZHLA 3SE9H 1AHWA 2IG2L 1MCCA 3CX2A 4QHLA 3SDXE 3CFCL 1YN7B 4FN0A 5I30H 1CE1H 2H9GB 2OR9H 3SCMA 1IKNA 5F9WC 3S34L 3REWA 1U8OB 3V7MA 3P4NB 1KLGA 5D7SL 3OG6B 2GY7B 5ESVB 2VQUA 4OD3H 4PRNB 3EHBD 4JFEE 4WO4D 3RU8L 1KFAL 4POYA 4S1QH 4YJZL 5DO2C 1HILA 3D0LA 4E5XB 3HZKA 4FABH 2NW3B 4OD1L 1A3LL 3CU7A 4LNRA 3QEHA 5T5NF 5HY9B 3MODL 5EUKA 5CCKH 3LKQB 3BT2L 1ZHKA 3DETD 5AZ2H 3VW3L 4O2EA 2J8OA 2F53A 1BQHA 5EBGA 3SKMB 1EXUB 2Q7YA 4XMPL 3BH9A 3TN0A 3QQ3B 3GDBA 1FVDA 5DI8B 1NGWB 2ZUQC 1AY1L 1CZ8L 4G9FB 4KK5C 5IROC 4M03A 5EFIB 3HG1A 3AU1B 3RIAF 4PJXB 3W0WB 2V9RA 1AXTL 3T3PF 2CSPA 1XH3B 4LLWA 2MTPA 3RPKA 2BNRE 3H0TA 3CDGA 5L88L 1KENL 5C9JA 3U4BH 3TV3L 4U1NB 5JQHC 5KG9A 3IVKA 1FL3A 3FCTB 5CSGA 2YD2A 1NCAH 4K7PH 5FGBA 1VHPA 4F8TA 3X3FL 1IILE 2XACC 3MOQA 4MXWL 3BP5B 4TQEH 1T20A 4KRNA 4PJ8D 2IC2A 3FFDA 5C0BB 1U2HA 2A73A 2ZCHL 4J3WA 5CS7A 4L4TE 5JHLL 5I18H 2VIRB 5C07B 1H0DB 3IKCA 3LB6C 3QXDA 1OQXA 1ZGLA 1S9WA 1D6EA 3F58H 4F33A 3VXQB 3CLEL 1MLBB 5GXBB 5IB5A 1FNGA 1K8DA 5J3HC 1XCTB 4ODHL 4PJGB 3IFPB 1YN6B 2MQ0A 3A6BH 5LBSL 1HH6B 3QFJE 3QI9D 4F3FA 1UXWB 1YMHA 1MREL 4HPYH 4Y19B 4OI8A 5D2LF 4HMEA 1ZS8B 4IRZH 1T1ZB 4Z7UE 2NY1D 4KKBD 5DDHB 1NCTA 5F1OB 4J3XA 1CR9H 3HZYB 3PE9A 3K2MC 4XAKD 2G60L 3EGSB 5I1HL 4PJXE 4Q9CA 3W0WE 1P7QB 4HIIB 2VYRE 3HMXH 3ARRA 3TH4T 1E27A 3QJHA 4RAVA 3K46A 2AV1B 4BQBA 4MA7L 3D9AL 2PO6D 1EAPB 3MLUL 4NN6C 35C8H 4I2XB 1WJ3A 3O8XA 3F12B 5GGRA 3MRBB 5HHNB 1FH5H 1X5ZA 1WBYA 4NNXB 1BFSA 4BKLB 5HGHB 1ACYL 5IFJA 2ITCA 2AS5M 5C0BE 1A6ZA 3PWNB 3CIQA 4LARL 5D7KD 4ONHB 2N7AA 3BD5A 4ZS6D 4OM1H 1T4KA 1X6NA 5C86A 5KVEH 4MDIA 1BP3B 5GGUB 2NZIA 3IT8D 4PP2A 3WS3A 3ARPA 3WFZA 4U3XA 3TVMA 1YEHH 5D9SB 3DSNA 3S3SA 2J88H 3KAAA 4Y19E 1HQ4B 3UYOD 4BZ2L 3MV7B 4Y2DB 2BC4A 3IRZA 1WT5C 2ADGB 3IJYB 1DANU 4M6NL 1R3IH 5DQJB 4NP4L 4HWBL 1GJIA 4ODTH 2AJXL 1BF8A 3GBLA 1FVCA 1I9JL 2H1PL 3W9EB 4RAUB 2GJZB 1HI6A 2DQGH 5DA0B 2HH0H 2YPVL 1Q9WA 1UQSA 2X4RA 3SOBL 2VDLH 4UIKL 2L7UA 5D2NA 1S7RA 3NFNB 1EUTA 4MD4A 3VRJB 4RMUA 1NCDH 5GGSB 3BE1H 5D1ZD 4N0FB 4YFLI 3O3DA 4OLUL 4LLDA 1YYLL 2R0LL 3MUY1 3QZWG 3QIBB 5TE7L 3VFRA 4KKNA 3B9EA 1IVLA 1F90L 4JKPL 5CD3A 4I3RH 3BD4A 2X4NB 5E8DH 5CWSB 4M7ZC 4JM2F 4WU7B 3TO4A 3I85A 4LVOB 4HUXA 4PJ5B 1YPZA 2ADFL 3NIFF 2KQNA 5BW7C 4G8IB 3TZVA 1IAKA 5F7DB 4M62H 5JR1L 4I48B 5B4MD 3U0WH 4L5FL 2VKXA 1AIFA 3NACH 1A21A 4NCC1 2K9UA 2ARJQ 3EOBA 1DQQB 2AABL 2DS4A 4LHUG 1F6AB 3ARGC 5IQ7H 1U8HB 4PY7A 1FNEB 5C08A 1I3RB 1BLNB 4NWTH 4WHYG 3MV7E 4AT6A 2HYMA 1C5BL 1IC1A 4KDVA 4OLYL 5JNYB 4YHLH 2YC1A 1ED3A 4KZDH 4QHLB 5LCVH 1L9NA 1J9CT 3QG6A 1EGJH 3ARDC 3RTQA 3PUCA 4M6OH 3SCMB 2NMSA 1O7SA 3LCYA 4NZJA 4FQ2L 3REWB 2BHUA 5L9DL 3D87B 1IBGL 4HT1H 1KLGB 3BQUD 4GMSH 2DBLH 3MV8E 4PRID 5IJKC 5KSUB 4QGYA 4KJQC 1HILB 3D0LB 3V4PH 4W4OC 4ZOCA 3HZKB 1IMHC 3NMEA 1N8ZA 3AMLA 5J12C 4LNRB 2Y36H 3QEHB 1FBIL 1ZHKB 4P46B 4RWYH 4KGLA 1S8DB 4O2EB 4C57C 1SJVA 4TNVK 1IC5L 2C9AA 1BQHB 3NIGF 5FCUH 1H15A 3BH9B 3TN0B 3RWGA 4OUOA 1P4BL 2VZTA 3MMEA 4KROC 5ACZA 3RGVD 3HG1B 3SE4A 4Y4KB 1R3KA 3L9RA 4F15B 3HI5H 4PUBH 4X7SH 3RIFF 5CZXC 4AEIH 1FE8L 2YKLH 3HCVA 1FGNH 3V95A 4Z5RB 1D9KA 1H8SA 1H5BC 3H0TB 4NGHL 3MBEA 4HMDA 4GH7B 5E9DE 3VWKD 1UACH 4WWKA 4XAWH 1UM6H 3L3HA 1WV7T 1KIPB 3MOBH 4ZD3H 2VLRD 2IMNA 1T20B 4Y1AE 3FFDB 4S1RL 2A73B 2OTUA 3DSFL 4IM8A 4X7CC 1ZVYA 4MCZB 1QLRA 3IKCB 3QDMD 1YEIH 5JUEH 4ZUUA 3S4SA 1AO7E 2P42B 2ADIA 1ZGLB 1S9WB 1D6EB 5ECJE 2BVEA 4V2BA 5TE4H 3VRLE 4F33B 2J12B 1MNUH 3LN4A 3LEXA 4OF7A