3SGDI

Crystal structure of the mouse mab 17.2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
218
structure length
218
Chain Sequence
b'DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGSHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light Chain
molecule tags Immune system
source organism Mus musculus
publication title Crystal structure of the complex mAb 17.2 and the C-terminal region of Trypanosoma cruzi P2 Beta protein: implications in cross-reactivity
pubmed doi rcsb
total genus 57
structure length 218
sequence length 218
chains with identical sequence L
ec nomenclature
pdb deposition date 2011-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgdI02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgdI01
1E6JL 3INUH 4U1NB 2QADD 3EYSH 1UENA 4N0UE 2KQNA 5FDYA 4WI7A 2XA8H 5I8OL 2JK5A 2VAJA 4X80H 2G9HA 2R1XA 1TTFA 4HK0A 3FT2A 4JN1L 1NC4A 4NC1E 2IH1B 1FCCA 1RMFL 2ZUVA 2I07A 4MA8H 4M5ZL 2A77L 4N8PA 3T2OA 3G5ZB 1DUZA 4WNQB 5A40E 5I30H 1KB5A 4AJ0A 5JUEL 1LNUA 1YUHA 1L6ZA 5C3TA 3L3DB 4L3EA 2VDNH 4DZBB 3MV8E 4MA7H 5D96C 2IQAB 5SX4I 5A2IH 4OQTL 3V52L 5FYJD 4GSDL 3FT4A 3TBVB 2BOBB 4R0LB 4YHKH 4YGVA 3KVQA 3IKCB 3LV3B 4GRWH 1QBAA 1U92A 5GS0D 2A1WL 3RY5A 4OCSH 5DFVC 1BGXL 4M4PA 5CBAB 4ONGH 4ZOBA 3EDJA 4KRNA 3A6CL 1JRHL 2VZOA 3FB5A 4PJ5D 3QG7L 4F7PB 1JPSH 2XQYG 4LBEA 2YK1H 5IKCA 2ENYA 2NX5D 4POUB 2VLMD 3MA9L 2V5SA 1T89A 3P11L 1MLCB 3BZDA 4JY5H 4X99B 1NCWL 1TNMA 5FK9B 2P8PB 3PF2A 3VXTB 1CF8L 3EO0B 3SE4A 1W72H 1HQ4A 5I18H 4GXVH 3IJSA 1TIUA 5H37H 1QSFE 1NMAH 3BDXA 7CGTA 3B5GA 3H0TB 5D72H 2DKSA 2DLFL 2V2XB 4NP4H 1IBGL 1A1NB 3MNVB 1C12B 1SVCP 4GW4B 4W68A 1ZA3B 2KDGA 2R0ZL 2QQQA 3O3AB 4LP5A 5HYIA 1J8HE 4ZAKC 1IT9L 4M7LH 5LGHL 1DBMH 5ANMA 1NC2A 2NY6C 1NC4B 3UYPA 3IJYB 3QT2A 1XGYH 5DJZA 3M8OL 1T89C 2HFTA 2VMFA 3LCYA 4J8RA 3TYGL 5K9JL 1FORH 1YNLL 5C2BL 1KEGL 1DUZB 4TULL 4WNQA 2DWEB 1YEIH 2VLKD 3QRFM 3FN0L 1LILA 2Y7QA 4EUPG 2DQEL 1MJUL 3K7UA 1MCPH 3EYQC 3H42L 5B8CC 4U6TA 3MCLH 3AS2A 3EOBB 3TBVA 5KN5A 2DKUA 1X4XA 1KLUB 4UT7L 4AL8H 1KJ2L 2FWOB 4DKEL 2W59A 2X89D 1CD1A 3O2WL 1FHGA 3ULUF 3MRCB 3NZ8A 3QUMA 2AJZA 1C16B 1IC7H 3EGSA 5EO9A 5TE4H 1GJIA 3OKOA 2VLKB 5FO8B 4NHUA 1QLFA 3HN3A 5HVGB 5DK3A 1CFNB 3GI8L 5J57B 2AK4D 2A2QT 2MCG1 3I85A 1SJHA 5FK9A 4NJAL 2WQRA 3DJ9A 4OD3L 3KHOA 2X9YA 3VXUE 3BXNB 1FL3A 3RUGB 4MXQD 1ZMYA 1IGJA 3CLEL 1CFTA 5TF1H 3BP7B 2GSIB 2VERN 1ZA3A 1UM6H 1X9QA 4M1DH 1ZSDA 1ONQA 1Q9KA 2W91A 4ETYA 1BM3H 2OS7A 3STBA 3GK8L 4OD1H 3U30B 3D6GA 4HT1H 3WXWL 1CE6B 2BJMH 5EFIA 5DJZB 1U8PA 5IJKC 3L6FB 2CIKA 3TO4B 5CEYA 4LVNB 3KDMB 2DWEA 3AREC 1TMCB 1P7KB 2YPLA 15C8H 1XF4A 3C5ZC 4K8RH 3RU8H 3G04B 3TH3T 4G43A 1GL4B 4UILL 3EW3B 3H7BB 4YHOL 4QHNB 1CXFA 4BK5A 2P7TA 3MNZA 1IZKA 5J3HD 1H0DB 3IAQA 3QHFL 5C0FB 3P77A 5JHDB 3IVKB 5E5UB 1HHKA 3MV7A 3BWAA 4R96A 1FFOB 3DROA 3LKQB 5ID0B 2QSCH 5DVOA 5EBGA 3D0VA 1AP2B 2EYSA 3MLYH 1EHXA 2XNAB 5FO7A 5FO8A 5GGTL 1AJ7L 1SY6A 2B2XH 4G80B 4Y8AA 3OAZK 3WS6C 3U0WL 1DANU 1RULL 2J88H 4I9WE 4ETQA 3UTPD 2VL4A 1DANT 4MD0A 4KQ3H 1HSBB 4PUBH 1X5IA 1ZA6A 3MNWA 2YPKA 4YHOH 3CVHA 1ACZA 1I9RH 1ZLSL 3AUVA 1QLRA 1C7TA 4MJIA 3X12A 2D7PA 4IHOB 2AXGA 3PXHA 3O4LD 1CFTB 4N1EA 4N1HB 4G7VL 3O8XC 5E6ID 3G08A 4POZD 4MJ2A 1ZSDB 5EOTA 3VFNB 4PJ5A 2QR0B 5IMLA 4XGZA 3SDAB 1HQRA 1KPUA 3A6CH 2YPLE 5C2UB 2W07A 4ODVL 3P2TA 3MLUH 3FRUA 3V2AR 1MHPH 1NBZB 1ERNA 5TPWL 3ZDXF 1P7HL 3U0WH 4EN3B 5FYLL 5D1ZB 1F4YH 2OI9C 1NCWH 4K3HA 4V2BA 4F37K 3GM0A 3R06A 4WENB 2AS5M 2N7BA 3A6OA 4X9FA 5DVKA 5HYQB 2J6EH 2R4RL 3PE9A 2BFVL 1ZLSH 1H3PL 2Z8SA 4JHZA 4KJWD 3FQWB 4ZD3H 4RMQA 1U0QA 3QFJA 3FB8A 5JHDA 2BNRA 1ROWA 3FAXA 4DQOH 4FOMA 1F90L 4JFXB 1GGCH 1HHKB 4WU7B 5JW4M 4OF8A 4R96B 5ICXA 1V7ML 1QPXA 5E6IC 3V5DB 1MIMH 3SDYH 2GTWA 4Y2DB 2R8SL 4OQTA 3TLRA 5CILL 4G80A 1AD9B 2FX8L 4CADA 5DJ2A 7FABL 3O45A 4DGYH 2HKHH 2MKWA 2Y23A 5E5MA 4KROD 4PGBB 3IDMB 3HNSL 1Y0LA 4FQQA 3I2CL 1BOGB 1PX3A 1HINL 3QXDA 5JW4Q 2YPVH 4MNGB 4MJIB 2NQCA 4JPWH 2Q76A 3BAEL 4Y1AA 4UV4H 3ZE0F 5ACLA 3P73B 4JZNB 3SDAA 4PTUB 5KVFL 3L3GB 2LV4A 3MRFB 4XTRD 2J6EA 3QUYB 5ALBH 3X11B 3D48R 2ZUSA 4PJ7A 1NC4D 4RISH 3LKOA 1J7VR 4MB4A 2UY6A 4A2MA 1PQZA 4UT9H 3QIBC 5IBLD 4P3WA 2I27N 3RVXD 2E27H 4JFEE 35C8H 2DQDH 4CJ1A 5HHQA 4H1LH 1VEPA 4PPTA 3IFLH 5C0CB 3RGVB 2X42A 4U7SA 5D6DC 2WANA 4GG8A 2G2RA 5ICXB 4JFQA 1J18A 1A7BA 2X1OA 5IB2B 4GFTB 5IVXF 4YUEL 2GTWB 2ZG2A 4OT1H 3IXAA 4Z7NE 4W4NA 5D1ZC 3TVMD 4CADB 5GZNC 3DV4B 1BZ9B 3TBTB 3J7HA 4HV8A 3BT2H 1RIUH 2E27L 4JFFB 1UM4H 4Y4HA 3IU4L 1N5AB 4NZUL 5CJOL 1JZ6A 1K3ZA 3PP3K 3NTCL 5DI8B 3RL1A 3W9EB 5FOBB 1BOGA 4UTBL 5HHXH 2H9GA 5I1KH 3S9DB 1CU4H 4MNGA 1Z3GL 1FZJB 5L9DH 3WFHA 5IHZA 4XBPB 3VRIB 3ROLA 1K9TA 4HIIB 5MHSE 3NCYS 3UPAA 5IMOA 43C9B 5JIPA 5EZJA 1F4HA 4LSVL 3WMSA 1CZ8L 1HNGA 5MEND 1A7PL 1S5HB 3LKOB 2DI8A 3I02B 3PL6C 1UWXK 1PQZB 1NFDA 2E9BA 4D9LL 5H35B 5BOZG 1UM4L 2JLLA 3SE3C 3SO5A 4V1DA 2FH8A 3S37H 4GG6B 3HCVB 5TFSH 4ENED 3RA7H 1ZT7B 2BNUA 2EKSB 4PR5A 3MBXH 3QJHB 1ZHLA 4AK1A 3DX9A 4GAYA 4X7DC 1K5NB 4U3XA 2VQ1B 4XC1H 5D4QA 3C60C 5F1KC 1FO0L 4GG8B 3L1OL 4XNUL 4NC0B 2WIMA 1X5ZA 3RGVD 4Y1AE 1N5YL 3LQAC 3QDJD 5F9JB 1MRFL 1Q9WA 1Z5LB 3ZKXC 3HS0A 4HUWB 1WZMA 5IQ7L 3OAUL 2ITCA 2R2EA 4R4FL 4AMKH 5HGGS 1G7QA 4OF0A 4GJTB 2EDLA 3H8NA 4UBDC 3P0GB 5CEXA 3TWCH 3ZMRA 4Z8FH 1LP9A 4JFYB 3UTSD 1WSST 4XBEH 2ZNXA 4HFWB 2AXFA 4RGMC 3KPLA 4ZNEA 4HK3N 5JO5B 5HHME 4RGNC 3OKDB 5EU5B 5J4MA 5JQ6H 3E6FA 1E4WH 1J1OH 4H0IA 1G7HA 3DRQB 2XWTB 1EEUA 3ZKMD 4B0MM 1V7MH 3VD5A 2YEZB 2CKBH 1BFVH 5DGQA 3F58H 5MP6L 3WO3B 5MERB 4WTXA 3FZUD 5CJXA 3I02A 1ZWIA 2W1NA 2PF6A 4DGYL 1JUFB 2AI0H 1KTDB 3LN4B 3OGOE 5F97E 4PJEA 2BNUB 2EIEA 2OL3H 4U0RC 2Y25A 3T04D 4C58B 1CLZL 4HBQA 1F4WH 2V6HA 3QUYD 4MNQD 5I1GH 5EZLB 2VITB 2APWA 3C87A 4LKCA 3BMVA 5DYOB 1J1OL 3VFMA 1JNNL 1EDQA 4JRXA 2CDGB 5F7WC 5KG9A 2X10A 5HHOB 5D9SA 1DBBL 5KTEL 1P4BL 3EAKA 2N1KA 3FQRA 3LH2L 5IQ9A 1MAKA 1OSZB 3N0PB 5EC1B 5D7LA 1RJZB 4NQXA 5E9DA 1XGPB 2ITCB 4M43H 2R2EB 4FMFA 4GKZB 1G7QB 3X13B 1DQQB 1CXHA 4XH2B 3V7MA 4KZDL 1P7QA 5HHPB 3D39D 2VNCA 5I0DA 1LP9B 2RHEA 4IRZH 2OTWA 1EJ6A 1F4XH 1UA6L 3NPSC 1A21A 2VWEC 3KPLB 4NQUA 5EORH 4I4WA 4GLRI 2MPAL 4PJIF 4EI6B 4OZHF 3NAAL 4I3RL 4OZFG 4DK3A 1P4BH 3HUJA 1T0MA 2I07B 1VKXB 4QWWD 3G5ZA 3LH2H 4JKPL 1MCHA 3GSVA 3ALXA 3HZYA 2GJ6A 1B2WH 1RHHB 3N1MC 1PLGL 4QHUA 2YD8A 3L3DA 2OJZL 3LKRA 4GAGL 4L3EB 3S98A 4WW2C 5AYUL 1ORSB 1D5MA 2DDQH 1HOCB 3VGAC 2I9TB 2IQAA 1G7MA 1ZWIB 1ZEAL 4Y4KB 1TPXC 3IDXH 3U2SA 4E41B 1WCQA 4U1IA 4G6KH 3VG0H 1U92B 5F7FA 1OT2A 4JRYE 3O2DL 4OV5B 1JE6A 4OZFH 5INCA 1JZ2A 3Q6FB 2EZ0D 3CFIC 3ULUL 1YQVL 4UINL 5EZLA 3G5YB 4XMKL 3MQIA 3AREA 4KI1A 3MJGX 1GZPA 4EN3C 2BP3A 5DYOA 4HLJA 2B8OT 5IKCB 1QUNA 2ICES 5D7LE 3ULVE 3B9AA 1X5AA 3P9MA 1NFDF 1G7LB 5CSGA 2P24A 4O02H 5T3XH 5E08L 2WWMC 4QRPA 2Z93B 1A9EA 1AR1C 3ELAT 4GG6F 2A6DA 2XIDA 2H8PB 1QPPA 4NQXB 3WCYA 1NEZB 3MRIB 1HHHA 3MRQB 4GKZA 2NW3B 4HWUA 3QDGB 3E6HB 2L4OA 3ZDYE 4P4KB 4F7EA 4WU5B 5C08A 3MNVA 2OJEA 5ISZE 1JK8A 4UUJA 1S7UA 2R1WB 3CD4A 2HMIC 2Z9TA 4FS0A 3HUJE 2OTWB 1MFBH 4R97B 3ARGC 2DQGL 4DGIL 3RWGB 3ARSA 3O6FD 5ANMB 4X7CC 1FPTL 4CGTA 1NC2B 1FAIL 3H9SE 3IDYB 2FEDC 2C1PA 2OQJA 3DVIA 5D2NA 2XY2A 3S36L 1VKXA 4R9HA 1N5YH 5IFJA 2I60L 1RHHA 1NKRA 3KYOB 4AH2B 2BSSB 1I8LC 3EJYC 4N68A 3WS3B 2GK0A 1N59B 2A38A 3SDCC 5DWUH 4JREB 4A6YH 1HOCA 3D1MC 2I9TA 1QEWB 4ZUWA 5GSRA 4G9DB 3MLVH 4Y4KA 1K8IB 3U2SB 1DQLH 2CDFB 2NW2B 4U1SB 2ATKB 4XWGH 1BX2A 3WO4C 2FWOA 2AEWA 4MNHA 2B39A 5FCSH 3TN0C 3CU1A 1FL5A 2E9IA 4YXKH 4BSJA 3QRGL 1C16A 4M7LT 3AREB 5EO9B 3TT3H 5M94B 4YHYB 3RIAF 5T3ZH 1QLFB 1T2QH 5C08D 4YHZL 3MCKB 2Q6WB 5I15L 4NQSB 5DQ9A 3TJHC 3I6KA 5I71C 32C2B 3PWPD 1INDH 2AXHA 2R29H 3QP3A 3T0VA 2CK2A 1UJ3C 4ZTPL 1PAMA 1O7VA 2A6DB 2V5MA 5FUZL 3ETBF 2NW3A 1P1ZB 5I17A 1YN6A 2ITDA 4QOKE 1KN2L 5DK0B 4MCYB 4GRWB 4XRCA 3RI5F 3NZHH 4QRUA 5CHNA 1JGUL 3TCXA 3QUZD 1A6PA 1EAPB 4PREB 5ESQB 4PJGF 5T3ZL 2OQJB 3SKJH 3UC0L 12E8L 1IC5H 3TFKD 2RGSA 5GGVH 3B9KA 5IB1B 2CIKB 4U6YB 4M00A 2ZUWA 5FUOH 3VXPB 2W9DL 2C3VB 1P7KA 4AH2A 2VQTA 2YPLB 3PHOA 4FXKA 4YBQD 5E9DD 3I75A 2HJFA 3WBDA 1U2HA 1UQSA 4XNMB 4BQ9A 1AKJB 2VIRA 3CXHK 3ULUE 2NY6D 1FRGL 4U1SA 5KSVB 2BY2A 3S35H 4MDJA 3P77B 3IVKA 3LHPL 1P5VA 1A1MB 2FGWH 3BWAB 3QDMD 1AQDA 3EO9L 2ED7A 2VR4A 2BVYA 5TDNB 4EI5C 3V5KB 5ID0A 4JPKH 2E6PA 3OR7A 1MLBA 3GHEH 2EYSB 3WIHH 4YAQB 2MOVA 3BN3B 3F6LA 5GGVL 3T3ME 3IDGB 4XZUB 4Q6YA 3LS5L 2Q6WA 2VDNL 5T1DH 1T4KA 3ZE1F 32C2A 5D7KD 1K3IA 4GSDH 4LPXA 3VWJB 2DTML 1RK0B 4YR6A 3S5LA 1NBYB 2YPKB 1JZ5A 3BGFC 4WFGD 1X6NA 2DBLL 2EEAA 4CW1B 5B38G 5EOCL 4BQCA 3TESA 4PBWD 2ITDB 4KQ3L 1OAYH 3EO9H 2GK2A 3VFRA 5I75C 3G08B 3RAJH 2WP3O 2GAZB 4HJ0D 2PTTB 4Z7WB 4PJ5B 5CHNB 2CIIA 4Z0BL 1HQRB 5KSBB 4NCC1 4PREA 2WBJB 5DHXB 4LCCA 3LS5H 4L3AA 4NSKA 4MAUL 1EEQA 1FDLL 4WGVB 2VLKE 1TVHB 2XA3A 4KRPC 2JIXD 5EN2B 3FFCB 4AIZA 4PJAE 4NP4L 3DUSA 1AIFB 4QNPF 4XNMA 2VXQL 2UWEF 3GI9L 1A1OA 2OYPA 1NGZA 5KSVA 2EYTA 4FQHB 1U3HB 5CEZD 4JFXA 1A1MA 5L88H 3MLTB 1U95A 4GS7B 3ARGD 4OLZH 1A7NL 2ESVA 2JJUA 5IM7B 3V5DA 3OR7B 2HMID 5GS0H 1ZHNB 2RBLA 4U0QB 1K8DB 4WFFD 4Y2DA 1MHEB 3BH8A 2O5ZL 4WHDA 2Q86B 3ARVA 5DJ2B 1QD0A 3D2UA 1RZJL 2IADB 4LHUG 1RUML 5IESH 3PWVB 5C09E 3IDMA 2Y06L 1VERA 2VXQH 3S5LB 2HFGH 5FYJE 1FVEB 1YEHH 4WJ5B 5IB4A 1Y0LB 3QG6B 5I1DB 1XGUA 4OIIH 2OK0H 5DZLA 3S36X 4DJMA 5T3XD 3MRJB 3QSKB 4JFFE 5DMGC 2UZIH 4TVPH 4N0UA 3GMLA 5FYLE 5EC2A 3WHXA 3GI8H 5T1LB 3WFZA 5DRNB 3X11A 3NN8A 2XTJE 5HYSG 5JR1H 1T2QL 4PJ7B 1NEUA 4L8BB 4OD3H 4GAJL 1FC2D 4OZGB 4G3YL 1QNZH 2OTPA 1QTYT 4OAWA 4BQ8A 1DDHA 1YEHL 3VWKC 5C8JA 4ZFGL 1A7RL 2W60B 4HS3A 5L7XL 1LK3H 3DVGA 5E8NB 4ZYKA 1ZLUK 3RGVA 1O5DT 3QXTA 4WCYH 4MVBC 4Z77B 2OR8A 1TVDA 4HUKB 2BY3A 3MLTA 4IMKC 1U95B 1JNJA 2NY1D 2AXJA 3PWPB 4NHCL 4PRDA 5CWSB 4LASH 1K4DB 4APQA 1FQ9C 1REIA 1I7ZA 4X8JA 1FC1A 3E2HC 3FB6A 4W6WB 4HV8B 4OT1L 2NXZD 3WS6A 2L7JA 4JFFA 5ITBH 1R3JA 1A4KB 2L0DA 5DI8A 1FVEA 4WJ5A 3P4LA 3ZKNC 2NY4C 1JNLH 2WBKA 1RK1A 1FZJA 1QSFA 3LKSB 2AJYH 3TA3B 2Y07H 5JIKA 3VRIA 4N0UB 2DQJH 2AEPL 2VQUA 4YDIH 3KAAA 2F53E 3HB3D 4NQCD 3U7AA 1BVZA 2LTQC 5EZJB 3SGEI 4LNRB 4OGYH 1JPTH 1MFDH 1QLEH 1TDQA 2ZCKL 1X44A 4PS4H 3QPXL 1UJ3B 2XZZA 5AWNL 5IFAH 5E6ZA 1RI8A 2FGZA 2GFBB 4X7SL 3CAFA 4ZTOL 1WCBB 4S1DC 3LVEA 5IIEA 1A7OH 1P84J 1ZT7A 4TQEH 2FB4L 3QFDA 5FXCH 1X7QA 2YD4A 3RA7L 1ZHKB 4YO0A 2YWZA 2XG5A 1OP3H 2ID5A 3IU3A 1TZHB 4HWZB 1QYGL 4PJXB 4MXVE 5EWIH 4AYFA 2NXYD 3W11C 1PZ5B 3QFJD 3A6BL 4PRDB 2FHBA 5CWSA 4ESKA 2XICA 1DFBL 2P5WE 5F9JA 4H8WL 3CXDL 4LOUC 4APQB 1E4XL 3G9AB 4BFGA 5C6TL 2GHWB 3QPXH 3GSXA 4E0RB 3HS0B 5LWYH 4AEIL 4X8JB 1QFWH 4XNYL 4PRAA 1IQDA 3SGJC 1GXEA 4I0CC 1HH9B 4X83A 4O9HH 3RWHB 4G5ZL 4HPYL 1RZFL 2BVEA 2P5ED 3L7FB 4LSPH 2FECI 5DJAA 3PABB 3TA3A 3ARBB 3VGAB 4GBXA 2V5TA 4KC3B 1UYWL 2XWTA 1LO5B 3P11H 3FQNB 1CDGA 1L9NA 4OCWH 3MV11 3U7YL 1FP5A 4GQPH 2NY3B 5BXFA 2CLVB 4LCUA 4ZQKB 4M7ZC 3F12A 5IVOA 1JV5A 1B6DA 3GB7B 4NQED 2AAVA 2DLFH 2X6MA 3E3QE 4OLWL 2A74A 3CVIH 1AGEA 4YHKL 5FM4A 4ZUUA 1LVEA 1RJLB 3D39B 5A2LH 3W11D 3NCJL 4KMTH 4OFYA 5C92A 2FX7L 2LU3A 2QQLH 1S5IL 2EDRA 3WDHA 4D2NA 5MEOA 4NM4H 4LVEA 5CGYC 5EIIB 3IU3B 3M8OH 4JRXB 2CDGA 3MRBA 5D9SB 1UCTA 1PZ5A 3SDXF 2WIIA 3JWDL 5IHBA 5CEZE 5TF0A 1IAIH 2JK5B 3KS0H 1WVZA 4F3FB 4HC1A 2YZ1A 3FB7A 2R1XB 5AZ2L 1Z6JT 4Z7QE 4LARH 5HSFA 1XGPA 1KCRL 5C0BE 2DLIA 4OZIE 4PRAB 4H88H 3B3IB 3G6JF 3H9HB 3BVNA 3HI5L 1HH9A 3C2SA 2NY5L 3HLAA 3V6OC 5ID1B 4F8TA 1I7UA 1GYAA 2I26N 2R9HD 2Z35A 1A3RL 4NQDA 1MCDA 2R0ZH 4D8PA 5DJAB 5LXGH 3ARFA 3JTSB 4IRSB 4I4WB 1YMHB 1DBKL 3LQZA 2RQ8A 3L3HA 2HAZA 1ZV5A 2BOBA 4FZ8H 5ACZB 1B4JL 4PJ9B 3QDGD 4P2OB 4N5ED 4WW2B 4KAQH 4Y2DD 3FCTB 3TNNA 3ARDA 2EDKA 2Q87A 2NXZC 1RPQA 2NZIA 3ECBA 2P5WA 3GIVB 1ORSA 3VE0A 1UM5H 2X4TA 3GB7A 5K59F 2X4QA 4LDEB 1RU9H 1YYML 2A74B 4FTVE 4OQ1A 4OZHB 5AYUH 1TQCB 5D7KE 5EZOH 3W39B 3ARZA 5CUSH 5DQDL 4LCWE 5C0AB 5GSVB 3SE8L 1HNFA 3G5YA 3F5WB 5F7KC 5T5NF 5GGUB 1B0WA 2MTPA 3D69A 3IJSB 3QUKA 4X4YB 4JREC 4ZS6C 1Z9LA 2XN9B 3F7VB 3P9MB 2VE6B 1A1NA 1ZVHA 1C12A 2WIIB 4LSDA 4F58H 2Z93A 1A9EB 5KSAB 3CH1B 5E2VL 1KCSL 3RHWK 3VFOB 4XWOD 1HHHB 3MRQA 3T1FA 4Z7OF 1FJ1A 3B3IA 3IJYA 3H9HA 3QDGA 1G9NL 3F65A 4FQCH 3MBED 2XACC 2H2SD 1S7UB 2R1WA 3NACL 2WUCL 2P43B 3RDTB 2Y7QB 4X5LA 3JTSA 1A7QL 3GK8H 1KCUH 2B2XL 3EHBD 2UWEB 5BZWA 2HTLC 5ACZA 1S9VB 5E70A 4JANA 4P2OA 1PJ9A 5AUMB 3B5HA 3AFLA 3ARDB 3Q6GL 1JF1A 5K93A 1LE5B 1ZS8A 4JCLA 4NUGL 4ODHH 5AAMA 3WS3A 5HYSB 2P5WB 1N59A 1U3HD 4MX7A 1OF2B 3BKYH 4NHUB 5JHLL 3GMPB 3VXUA 3RKPA 1CFNA 3JWOL 4X6CE 5E8OB 3IAPA 3V6OE 5D71L 3GSRB 4P46D 1U8KB 3VDCA 4K23L 1Q72L 1KLFA 3BXNA 1FL3B 4APQC 2JJSA 4L4VE 3QUKB 4FG6D 4X4YA 5D7JA 4JPVL 4L8DA 3K2UL 2V9TA 1T03L 4NQSA 3A67H 3BP7A 5DO2D 4B50A 5KSAA 2EE2A 4XAKD 1JGLH 4PJIE 3AB0B 1UH3A 4ZPTB 3L5HA 1IGIH 2Z92B 5DSCB 3LDBC 2D31A 5C0CD 1RZ7H 5HI5D 1OAQL 2F58H 5DK0A 4F2MA 4FXLA 5FUZH 1MRDH 3KDMA 2F8XC 3QUYC 4X80L 4C59B 4NKOB 3UTOA 1FAKT 3G04A 2ED9A 3PV6B 4F7CB 1UXSB 2EDFA 4S1SL 1EAPA 1CK0H 4HDIB 5IW1B 5C0JA 2ZUTA 1T03H 1V7NH 1CLYL 2FL5B 5IROC 4HC1H 2XXCB 4Z7WE 2CO7B 4M43L 2BRRL 3JWDH 1S7VB 2XY1A 2HLAB 3KLDA 4ELMF 5L2KD 5ISZD 4TUJA 2OTUA 2V2WB 3TO2A 4EDWL 1E4KC 4MQXD 5HYSA 2QKIB 4FNLL 3PDDA 2NY2C 1OF2A 4H88L 3S6CA 4NM8L 1BAFL 2DIAA 5I1HH 5D1XC 3O3EA 5E8OA 4QXGH 5F96L 1UADC 3RGVC 4NN7B 4ZUSA 1ZAGA 3MNWB 1OGAE 4XP5L 2BY1A 3QG7H 3CVHB 1DQDL 5FHBL 1DBKH 1IRAY 5ECJE 4HCRH 4NRYB 3IDGA 4XZUA 1GCFA 4EDXA 3X12B 1G1CA 1N7ML 4LU5H 5IVXE 3BQUA 3SY0B 4RBPK 2AXGB 5D7IE 2DF3A 2BHUA 2LVEA 4Z7VB 3VFNA 2QR0A 1KB5L 5IMLB 1TJIH 2CRIA 5DHYB 4JB9L 4D0CB 4JY6B 3R8QA 2KL6A 1BJ1J 2LFGA 3O3DA 4BELD 4FFZL 1I85A 4OF5A 5EZOL 2XKUA 5D1ZA 3BYYA 2WAHA 4JHAH 5BO1L 4ZDHA 2FO1A 2IANA 3ZDYF 3O11A 4NKOA 2PTTA 4Z7WA 3SE8H 1YPZE 5DUMH 3QEQD 5KSBA 5HYQA 1UXSA 2AJXH 1I7RB 1Q9LB 3GJEB 4KK6D 4HDIA 5C0JB 2WBJA 5IW1A 5J1SC 4R2GC 1X4YA 3QFJB 3FB8B 4HWEL 3VWKA 4PB0H 1ZLUH 3M07A 5A1AA 4WU7A 2HLAA 2VZTA 5AYQA 1CYGA 1KB5H 4CMMA 4K3EL 3I3BA 1A6WL 4RX4A 5CAYB 4KUCF 5C9KA 3CDGB 4QRRB 3VD9A 3ARWA 3IDJB 1NGQH 2D7TH 4KI5F 3O9WB 1FAIH 1T5XA 3I6GA 4RMTA 5BO1H 4QTIH 1B6UA 3VD3A 4EXKA 4PGBA 2YD5A 1AQKL 2E8YA 2IWGA 5B38A 4X9GA 4FFWD 5FUCC 3H9YA 4FQQB 1SJEB 2O5YH 3LRGA 5CINH 4A6YB 4PGJA 5TE6L 4NRYA 3D18A 1S7WA 4R2GB 4N8CH 5I8EA 1YPZF 2ZG1A 3L5XL 1QP1A 4Y1AB 3BIAX 4XWGL 5DFTA 3PWVA 3AGVA 3H3PH 4JQVC 5DHYA 2HKFH 3MRFA 2XKSA 4URTB 1WISA 3QUYA 3UDWA 4X6BA 5KVDL 1AE6L 1OAKL 2R0WL 3I9GL 4HQQH 5D1XD 5ICZA 1LO4H 1S7SB 1NGQL 1EJOL 2O61A 3MFFA 1SHMA 3TV3H 4P5MA 3ARQA 3G6DH 2XZQL 5EC2B 3WHXB 1YNKL 1PGRB 4K71C 5T1LA 1XF3B 1XF2B 2WMPA 3RVXC 4ZS7L 3GJEA 1YMMB 3C5ZD 2PN5A 3W0WA 3NN8B 4KI5C 1JI1A 1NLBH 3BIKA 3L3JB 3VWKB 4AMKL 4DKAA 5CSZA 1AO7E 3WN5A 3RQ3A 3VFPA 4CMMB 3QUXB 2IALB 2EH8H 1MI5B 5FEBA 4UQ2B 3KYKH 2W60A 1CDBA 4HJGA 4QF1B 4K7PH 4UILH 3TJEH 1KFAL 4CVUA 1RAMA 2R0WH 3I9GH 3N1QC 3B2UC 3DVGB 4TPRL 5E8NA 5BRZE 1C5CH 4KZEH 4G8GE 3MBEA 4UMGA 1BZ9A 3TBTA 2XZQH 4Z77A 4HKJA 2J2ZA 4Y4HB 4HHAA 3LZFL 4NNXA 1R3HB 3GO1L 1T7VA 3RL1B 1BJ8A 2BDNH 2X7LA 2H9GB 5F8QC 4PRIB 3GSQB 1V05A 3D18B 4JKKA 5ADPH 3OZ9L 3UJTL 4XBPA 5I8EB 2IH3B 1FVDA 1WFTA 1J1XL 3DOSA 1MIEL 1ND0A 4GW1A 3S35L 1A4KA 2CXKA 1NUNB 4X6BB 5GZOD 3GSWB 4LIQH 4YHLL 4JFPB 4OV6F 2Q8BL 3MFFB 4JZJA 1JNNH 3BDBA 3W0WE 3W5NA 5JQ6L 1CN4A 1KIUA 3SGKA 1PKQA 3GO1H 1G6RL 5E2TL 4DN3L 2VZUA 3O4OC 1XF2A 1EXUA 2BERA 1BFVL 4PR5B 2AABL 3W0WB 3CMGA 4MHHG 3UAJC 4HCRL 3QNZA 1JZ4A 4FQXC 2NY2B 5DD1H 1UJ3A 3C6LD 4BZ2L 4OGYL 2X4PA 4E5XA 5JUEH 2GFBA 1KEML 2VN4A 3VFPB 5D8JL 4M1GH 3IDYC 1OAZL 1MI5A 3MXVH 3ARFD 1X5YA 4HJGB 3HC3L 2JJWA 4U7KA 4AQ1B 2EXWD 1UCBL 2E9WA 4DKFL 2ZCHH 3QEQE 1GC1C 4KROB 1ZHKA 1BD2E 4K3JL 5IFHH 1CGSL 3LKNA 4HKJB 3T0EA 1TZHA 5GGVY 2BNQE 3PWUB 3QPQD 1HHJB 1NANH 5DUML 3DUUA 4Q6IC 2X7LB 2WBJD 1ULVA 1KCVL 4DOHE 2DYPD 2G9HB 4EIZC 4YHML 2DDQL 4X4XB 4YDJA 5F9WB 4HWEH 2AK4A 4R7NA 4Z78B 5EU5A 2QSQA 1IQDB 3E6FB 3VXSD 4Z5RB 2AJ3B 3O2DH 2DI9A 2FO4B 4IOFC 4NPYA 3RNQB 3WD5L 4WWKD 3FO2A 1OPGL 5CS7A 1CDIA 5D1QD 5EBMA 1BIIB 4U6VL 3FT4B 1KTDA 1M1SA 5KVFH 1ADQA 1H5BA 3ZYZA 1MAML 2LU7A 1EXUB 4JFHE 1MUJA 2VDOL 3QBTB 2ZZUT 4TOYL 3G5VA 2OJZH 2XQYK 1KEGH 4LKCB 3B6SB 43CAA 2FHCA 1X3DA 4JG0L 4E5XB 3U7YH 4WY7L 2Z91A 3HFMH 3EDEA 5T1KB 3UYOD 5HHOA 4W70A 2D9CA 2NZ9C 5GIRB 1XGRA 5FM5O 3UTTB 3D39A 4Q58C 1INEH 1NAKH 5IQ9B 1YEGL 5FECB 5KAQF 1J05A 1RJZA 1WZ1H 5E9DB 2EIBA 2ADIB 3DI2B 2XZCH 5EIIA 3LKNB 2FNBA 1EFQA 5BS0D 1X5JA 1OAXH 4X6FA 3MRBB 4XH2A 3S36H 5L8KB 1GGBH 5K33A 1LO0H 5C0AE 2QTEA 3BWUC 5TE4L 1NH6A 1MHCA 4HKXB 1NKOA 4F3FA 3VXRD 1KPRB 1XIWA 2FJGA 2V7HA 3DMMA 3F7YA 4IMLA 3OL2A 3MX0A 4L1HA 2P1YA 3S4SB 1DSFH 2H2PD 4Z78A 1QVOB 2AKRA 3O6KL 4G6AC 2AJ3A 4HXBH 3BVNB 2E8ZA 3RX7A 2ZUXA 3HLAB 5ID1A 3O3BB 2FO4A 1I7UB 3HZYB 4Z7UE 5L6YH 4K7PL 3TJEL 1U8JB 4YXKL 4A2LA 5I66B 4JFFD 4D8PB 1QRNA 3ARFB 1D5MB 3VDAA 5JTWA 2X89A 5FCUH 2F54E 1PFCA 3EYUL 3QEQA 1KLUA 3HKFA 2VXSL 4ZOEA 1W0WA 4MWFA 3B9KD 3Q6FA 5TQ0H 5HHOE 3S37X 4D0DA 4HWBH 3ECBB 3EGSB 1IM3A 2D3VA 5DWUL 4A6YL 2VLKA 4N0RA 2ZP0T 4AZ8A 2D7NA 2X4QB 3TFKC 1G7LA 4OZHA 2P24B 5JA8B 5GIRA 1FE8H 3SKNA 4XHJC 1KJMA 5DVNA 1SJHB 1XF1A 4IRJD 5EUKB 3RPIB 3QIWA 5GSVA 1J05B 5HDQL 2IBGA 3OAZH 1MJ8H 4BH8A 1HKFA 3T2PA 3IGAB 4P4KA 4F7EB 1D9KC 1IL1A 1KTLA 4MXWH 4KQ4H 1ZVSA 2KUTA 4HS6A 1MHCB 2GSIA 1UWEL 3P9LB 3QQ3A 4EOWL 4XCCL 5KSUA 3WIIH 1JJUA 5GJTH 3RWGA 1N0XH 4R4BA 5FAAA 3SOBL 1QVOA 2C1PB 1FNSL 4YFLF 3L6FA 4M1GL 4OGXH 4HLZH 4KK8C 5HVHB 1K6QL 1HILB 2F54A 3O3BA 4JO3H 3KYOA 4AEHL 5I66A 2DS4A 1NCBH 1HSAB 3PGCB 4NDMB 4RAUB 5DFVD 2GK0B 4JG1H 1JBJA 4Z7OE 1QEWA 3BOVA 4G7VH 3LIZL 2FX9H 3RWDA 1NGYA 5EU6E 2UWEA 2P7TB 3MNZB 2ATKA 2VB5A 3BHBB 2ZSWA 5C0FA 1BPVA 3MV7B 4LSRL 3EJYD 5LBSH 3OTTA 1AR2A 1LE5A 4XCYB 3T4YA 1AGBA 4FMKA 1AP2A 5CJXC 5JW3H 3SOBH 4WI8A 5IUSA 1RZFH 4LPVA 4RDQG 5IHUH 2GY7B 3GMPA 4YNYA 2DLTA 3VXUB 3MV9E 4CN6A 4U1MA 4G7YH 5KVMC 3SKNB 3P0YH 1P6AB 3MJ7B 2E7LC 4XCFL 5EUKA 4FABH 2E9JA 1HSBA 4WWKC 1ZA6B 1U8KA 3EYSL 2EDOA 3QJFB 3UZQA 3O4OB 3HE7C 1FV1A 2IAMB 1QRNE 2V9RA 1P1ZA 4L8DB 4K8RC 4DGVL 5HXMA 4MCYA 4XMLH 4XRCB 3QHTC 1RUPH 3UJJH 5EZIL 3DMMD 3KPMB 2PR4L 3AS1A 4PGZA 4TSBL 4XGZB 4ZPTA 2WBJC 2IFFH 4BFIA 4R4BB 2Z92A 5SX5K 4FQ2H 2NNAB 2ATPB 3H7LA 3UXFA 3FRUB 1U8NB 3MRRA 1NBZA 4R90L 1U6AH 2E7MA 1HILA 2LU4A 4K71B 1INEL 4Q2ZB 5E00B 4OZHE 4BZ1L 5GS3A 4AIXA 1WZ1L 5C7XL 2QL1A 4LPCA 3T2NH 3BGFB 3ARPA 2VIRB 4OCSL 3TH2T 1QHOA 3RY4A 1OAXL 3EIFA 5DK2A 4DGVH 2HRPH 3W5MA 1PY4A 4K3GA 1DLFH 2D03H 3T0WA 4WO4A 1PBYA 1L7TL 1BQLH 1AQDB 4HAGA 3L7EA 4FRWA 4LRNL 3RWJB 5B39G 2QKIA 4N0CD 2A1WH 2XTJB 3SKMB 1A5FH 1DL7L 1MLBB 1TJHH 3GBLA 1J0ZA 4ORGA 1GGTA 3VGHA 4YAQA 4QNPE 4F33B 3LPGA 5LKNA 4JY5L 3UO1L 3QXVA 2UZIL 4TVPL 4U1MB 1T4KB 2R23A 3DHMA 1LD9B 4PYGA 2J3SA 5C0ND 3VWJA 4JFOA 4U1LA 2JE8A 1B4JH 3W0WD 1RK0A 4YR6B 1FGNH 5TQ2L 2EH7L 2NMSA 1FV1B 3QUML 1P9MA 3EZ8A 3QXWA 1Q1JL 3BQUB 3SY0A 2LAAA 3QIBA 4HWBA 3VFRB 3N06B 3HE7D 1MCCA 3LD8B 2Z4QB 1PG7W 1XGYL 4WEBL 1QR4A 1T1WB 3L3GA 5AG8A 5L7XH 3F8UB 3VXSA 4JFDB 4S2SA 4H0GA 2NNAA 3BT2L 2ATPA 2IMNA 4RCAA 4WFED 2GKIA 4LVOB 1U8NA 4NSKB 5CSBA 4EIGB 1RY7B 4WO4D 5DUBA 4KVCL 2Q8AL 3GJFH 1TVHA 4DKDC 3QISA 4DZ8A 4HGWB 3DI3B 5EN2A 5EOQL 4ZDHB 3DUSB 1YC8A 2B0SL 5HHQB 1AIFA 3K3QA 4UT7H 1I7RA 1Q9LA 1YEIL 1UEYA 4MJ6B 3PWJB 4M6OL 4P2RD 1YYLL 1IGCH 1NGZB 4PRPB 2J8OA 4FQHA 4PJGB 3T77A 4WO4B 4L5FH 4BQ6A 4LFHD 4JFQB 1UZ6E 3L7EB 3WDIA 3LRSB 4PV8A 4C56D 3OV6A 4ORGB 1ZHNA 4NFCA 3WUZA 3DXAB 5C09A 4OLVH 4F33A 3NFPA 4ZSOA 5L8LB 1CG9A 1XCQA 3HRZB 3D2UB 1LD9A 1T5XB 2HTKD 3I6GB 2EXYC 3QWQB 3QWOB 1N5AA 4UV7H 4HBCH 4QTHA 3VXME 3QA3A 5EULV 5I1AA 1SJEA 4A6YA 5I1DA 3LIZH 3L1OH 4XNUH 4KY1H 1QSZA 3GBNL 3MRJA 5FGSA 3ROLB 5TDOB 1EX0A 2VISA 3HMXH 4EVNB 1A7OL 2WLYA 3OAUH 2JF1A 2YR3A 4JFDA 3MV01 2HT4C 1TPXB 4OZGA 2IBBA 5H35A 4OJFH 4JN1H 3TPUA 3S7GA 2AEPH 3MGOA 4YDIL 4PP1D 4L4TB 5C0RL 2ADGA 1WEJH 1XF3A 4H8WH 2APXA 3BPCA 4C56A 3TN0B 3QJHA 4QGTA 5F88B 4PRPA 5I1JH 4LVNC 2CKBL 4PJGA 4XMLL 5CSZB 3T77B 3OG6B 4QKXB 4NN6C 1AJ7H 4X7SH 3LRSA 4FQIH 4ODBD 3OQ3B 4QRSA 4QF1A 1OL0A 5C09B 1I9IH 1TENA 4AENA 3DX7B 2DQHL 1WFOA 3S88H 4OCXH 5DD0L 3MBEB 1N64H 4Q7DA 4MZ3A 4ALAH 3C5ZA 1CLZH 3QWOA 4NNXB 4UAOB 1R3HA 1J5OH 4QTHB 1MEXH 3RUGF 4S1DD 5J8OA 3WIHL 5I1AB 5GRUL 4OCYH 4P9MH 4JM2C 3TJHD 5ADOH 5LWYL 2OLDA 4TVSa 2Y36H 1KGCD 1I9RL 4MAYC 3IYLW 1ND0B 4ODVH 1MNUL 4GW1B 2ZJSL 4GUPA 4RSVA 2YEZA 4LNRA 1H3WM 4RIRB 3QAZC 3NCJH 2DQHH 1II4E 4OBSA 4PRHB 5LCVL 5FO9B 4OLEA 2VLRD 3FFCD 4C54A 1LWRA 3RBSA 4R26L 1X6LA 4M7LL 4C56E 3PQYD 3MRPB 3MTRA 3TPUB 4QRRE 3MGOB 1J0JA 4KV5E 3VFVB 5IIEB 3LN4A 4IOSD 4XNXH 1YNLH 4B5EA 4C56B 2C3XA 4OCWL 3FOLB 1B9ZA 1X7QB 3LN5A 1FDLH 1MJUH 2J6EL 4OB5H 4BSVA 3K8KA 4HWZA 1FBIH 1G0DA 5F3HB 1WWWX 3UTSB 1A6TA 5K9QG 3C9NB 1IAIM 3CVIL 4U3CA 4QRSB 3FQRB 4P2YA 5HI3D 3JV6A 4RGNE 4JHAL 3OB8A 4N9GA 4ZAKB 1EGJA 3IDXL 5KSAD 4P9HC 2DQTH 3L3IB 5ESVA 3ARDC 1HH6A 4PG2A 2NY3C 1C8PA 2R8SH 3SJVE 1HINH 3BSZL 1OTSC 4UINH 4XNXL 2R4SH 3RWHA 4KAQL 1XMWA 1FIGH 3L7FA 3BAEH 5BV7L 2KPNA 4X4XA 1BIHA 2PUQT 5F71A 1IM9B 2AK4B 4R7NB 4ODXB 1WBYA 2BSTB 4Z5RA 3UTZB 3HE6C 4X6DB 3LSOA 3CX5J 3NCYP 2VLJE 2JB5L 1R5IB 1N4XH 2D7TL 1ZGLM 4RIRA 1CTNA 3GSVB 4M7JH 2GJ6B 1ZHBB 2C9AA 3RWEA 4PRHA 1WTGT 3RVUC 4M1DL 3NCFB 4QGYA 4QHUB 4U05A 5BXFB 2QJDA 3OB0H 2XQBL 2HT3C 4OD1L 3ZT7A 2D4DA 4M7KH 1CFBA 3TPKA 5DF0A 4BFEA 5SWSE 3OJDA 4LHUB 2R2BA 5HD8D 3DMMC 1D5XB 2DQDL 4HGKC 4PRPD 5SWZD 2HKFL 3V6ZA 5E0QA 1KN4H 1FYTD 3B6SA 43CAB 1MAMH 4IDJL 5EOCJ 1TXKA 4JFEB 3UMTA 5F3HA 4MS8C 3K0WA 5T1KA 3UTSA 4QCIB 1EMTH 3UTTA 1L9MA 3NA9H 3SJVA 4JGJA 1OD7A 4WY7H 3DTXB 2PXYC 4HH9A 3OAYH 3L3IA 3R0MA 3MRIA 3MLWH 4WCYL 3MBEC 4U2YA 1KJVB 3T4AA 1MFEL 4WU5A 1L0XA 4HKXA 3Q6GH 2EO1A 5F21B 4NQDB 3DYOA 2GW5A 1XIWB 2FJGB 3F7YB 3WJLC 3VH8B 1KCSH 1Z9MA 4PUBL 1SM3H 1IC4L 4ODXA 3LQZB 4LCIH 2AKRB 5C70A 1Z3GH 1JRHI 1FH5H 4K3DL 3LSOB 4PJ9A 3JV0A 3D3VA 1IM9D 1IQWL 4WW2A 3MA7A 1I9IL 5C1MB 1N6QH 3ZKMC 2M1KA 2AJYL 2DIBA 5JW4N 3DX8A 3SPVA 1Q0YL 4ZUWB 5GSRB 1CDUA 4G9DA 5L6YL 2X4TB 1CZ8H 1FNEB 2A9NL 3CUPA 1VEMA 2YD6A 1MQKL 1BFTA 2CDFA 2NW2A 2W9EL 4UIKH 3QEQB 3JWNC 2FECL 2IANE 1W0WB 1OQXA 3MJ6A 1MAJA 1S9YA 3C2AL 3OJDB 4LHUA 5D7SH 5KVEH 1FO0H 4D0DB 4WHCA 2UYLA 1HEZB 3U1SH 3V6ZB 5F6IB 4OCRH 3BX7C 4YHNB 3KYNB 1FG9C 2NR6D 4K3DH 2HWZL 4JFEA 1H8OA 1KBGH 1F11B 2X4UA 1RZ7L 3P4OB 4FP8H 4Y16B 3RJQB 2HA1A 3MCKA 2VE6A 3AY4C 3ZL4H 5HDBE 5E2UL 1M6OA 1GGCL 1G6RH 4ONGL 3CH1A 3QIWB 2GSGB 1MCOH 2EE3A 1IAKA 2AJUL 4PRHE 4BH8B 4PJ9D 4UIKL 4LSSH 1N8ZB 5I17B 1KJVA 1YN6B 3IGAA 3WLWD 4XBEL 3OXSB 3HNVL 1KTLB 3A6BH 2Z8VC 4G6FD 4EUPB 4EDWH 3SJVD 4WEUD 4OFYD 2J4WH 3MGTA 3M45A 3O9WC 4QRUB 3GSUB 4NKIL 5ESQA 4XP1L 3SN6N 4FP8L 1KBGL 1BBDH 1F97A 2EC9T 4W4OC 5BZWB 1VEOA 1MCFA 2XOTA 4QRTA 4ZXBB 4U6YA 2WWKO 4JANB 2EICA 3D3VB 1F4AA 4TVPE 3QIUD 2IAND 2HRLA 5AUMA 1DBJH 2C3VA 3MA7B 3U46B 2HJKB 4FXKB 1ZS8B 3I75B 4ZXBD 3UTTE 4XP5H 4OGXL 2H45A 3NFSH 4MX7B 3DX8B 3SPVB 4XPTL 5EU4B 1FNEA 2QEJA 5MP6H 2GJZA 3ILQC 5EH1A 3TZVD 3BHBA 4MDJB 4RISL 5L8JB 4KKBC 5TJWK 4HC1L 1IEHA 3EYQD 3ME0A 3MV7D 5BZDA 3BDYL 4F7MB 4UT9L 5TDNA 3T65B 3MRGB 4U31A 1MJJA 3GSRA 3T4YB 2UYLB 4EXPX 2QQKL 4K8RD 4NOFA 1B90A 5HYJD 3MCLL 4TTDC 5GZND 1TZGH 3KPSA 1A6AB 5I1GL 5MI0C 5I1EH 4RMRA 1GOGA 3ZTNH 1RZKL 4XNZB 3MJ7A 1M6OB 5C6PB 4P5TA 2XWBB 3K2MC 2P48B 1LDPH 4M3KB 4X98B 3NPZB 3V0VB 4M8QB 1RURL 2P5EE 2IAMA 2D31B 1N8ZA 4TOYH 5A2FA 3OXSA 3TVMC 1A3QA 1I1RA 3P4NA 5F9DC 4IM8A 1I3GH 5I0ZA 3VRJB 1JYXA 2YZ8A 4LARL 3PV6A 3ZDZF 1JMXA 1B2WL 2FL5A 4OZGF 4TSBH 5EORL 2GQHA 1S7VA 5DJXB 3GFUA 4ISVB 4I3RH 4TUJB 3DNKA 1DQMH 3FFCA 4M93B 2EDTA 4Q2ZA 5E00A 1Z9OA 4UNVA 2YXMA 4WFHD 4NQTA 4BJLA 1KLGA 3MLSH 1AY1L 1UKSA 2VABA 4TSCH 4Q0XH 5GS0C 1J88A 1ZANL 5FA4A 1YQVH 1LO2H 3CXHJ 4NQEA 2QSTA 2EYTB 3O3EB 1NCNA 4NQVB 3KWWB 2YUXA 2JCCA 2ESVB 3MRGA 1NEZG 4X4MA 4OFKA 1WWAX 5FYKE 2I5YL 5JXAL 1DLFL 2D03L 2UV3A 1SM3L 1HWGB 3QQNA 4JDVA 4Y5XC 3UYRH 5E08H 1MHEA 1RJCA 3BH8B 1A6AA 4JRYB 4OD2A 3TV3L 1KC5L 1D6VL 4DN4H 5IEKB 2NTFB 4OGAD 2IADA 1MI5E 5GGSY 4JFOB 5HI4C 4KHTL 3HG1D 2ADJB 1HI6A 4MCZA 1N6QL 1XEDA 5DXWA 4LMQI 4X98A 1YECH 5CINL 2ESVD 1YC7A 1DQJA 2NTSP 3O3DB 4E9LA 5EB9A 2BNQA 4GRLA 3HRPA 5I16A 3VI3E 4ORZC 4XNQA 3JV4B 3VRJA 3Q5YA 4FQJH 1ORQA 3TBWB 2Z8RA 1EERB 1T1WA 2AJSL 3TWCL 1XR9B 5KS9E 1U42A 1GAFL 4RX4D 3VXSB 5I1LB 5A2KH 2EC9U 3TZVC 3CZFB 1KOAA 3REVA 3TVMA 1MJ8L 4HGWA 4NQEE 4OAWB 1DDHB 3KXFD 1KLGB 4D9QD 4HS3B 3OKLA 1QRKA 2H2SC 3HNTH 4ZS7H 5EOQH 4YH6A 4MNQA 4JJHA 3QRGH 2PO6D 3WXVL 1H8SA 3VA6A 4TNVK 3VG9B 3EOYG 3EHBC 2R0KH 4F80A 3KWWA 3HHRB 1NCDH 1AGCB 4KUZH 4PV8B 1CDYA 1FFQA 4JO3L 4MB3A 4WFEE 4KPHL 3DXAA 5F7MC 3RX5A 1NCBL 5MEQA 1CGUA 3NFPB 1PEZA 4Z95H 4KZEL 1CG9B 3HRZA 2NTFA 3X14A 5KS9F 2B1AH 2NYYD 4KK5D 2CRZA 1HI6B 3MXWL 3QA3B 4MQTB 1DQJB 1I9EA 1RK1B 2BNQB 3PXJA 3WXVH 3FQTB 5C09D 3BRFA 3B4NA 5HVHC 1KT2B 1E4XH 3ROOB 4KY1L 1FVCB 1RVFH 5SX5H 4ZFZA 3HNSH 2OSLB 3TT1L 4LSUL 4G6ML 5JDSB 2YPVL 3D0LB 1EPFA 5B8CA 5J3HC 3CMOH 4KGLA 1H3UA 3X3GH 4XPBH 3WN5B 1I8MB 1MRCL 3QI9B 4KK5C 2IALA 4L4TA 4PD4J 4UQ2A 3V4UH 4L3CB 1S7TA 3CJJA 2C7UA 3D25A 2BOCA 3BPCB 4NNPL 4HMDA 2E6JA 1AFVL 4KKCC 5IHLB 1SMAA 5IMMA 4MNQB 5DD1L 3FN3A 4YO0B 4X6DF 5F7DB 3CGTA 4PJXA 4BQBA 3GMRA 4R90H 5D8JH 4JM2D 3HPLA 1XZ0B 4NC1C 4QHKI 4WUUB 4PRIA 1NSNL 5CLTA 1ZK9A 3GSXB 3KPPA 4OLWH 3C60D 2VDKL 1U3YA 3VGGA 2YN5A 4N0FA 5FM5M 1FVDB 2VXTH 1MRCH 5DC4B 1R5WA 3MYJA 4JDTH 3GMMB 4U6XA 1L7TH 1A8JH 2PYFA 3S34L 1RMFH 4L9LA 4NZJA 1GOHA 1MCQA 3PABA 4D3CH 2BVOA 1KT2A 2DQCL 3MRDA 4K9EL 4PJXF 4GUPB 4ZFZB 5B3NA 2I5YH 2XKNA 3PNWA 3FQUA 3RAJL 2CRMA 5D2LA 4QOKA 4P2RE 3HAEG 4Z0BH 1MNUH 4C4KO 3OPZH 3DXAE 2XZCL 2CLVA 4WFHE 5ESAA 3ABZA 1WWBX 3MRPA 2FLBT 4EBQL 4MXVF 3VFVA 3MLRH 2DL2A 3L95A 4YBLC 4YDLB 4L3CA 1RJLA 2BOCB 5A16B 5F89A 5DEGA 3OHXB 2YS4A 3FOLA 3O9WD 3PP4H 4GKOA 2VDOH 2UWEE 1NMBL 4QRQB 3U6RA 2VDLL 4BSVB 5F7DA 3RX8A 4RFNB 1NCCH 4PJAF 4Y19E 5GS0L 2K9UA 3BZEB 5C0DA 3PWUA 3GMRB 3AAZA 5IB5A 1OWRM 5DMIH 3DUUB 4G8EA 2GCYA 1OHQA 3JV6B 4N9GB 4ZAKA 3VMPA 5I19L 5LGKA 2OR9L 4DTGH 3BQUD 1QACA 3P30L 3G9VA 4YDJB 5IESL 3DYMA 4I18A 4N0FB 4DWHA 4M6OH 3SDXE 2XN9D 3WNOA 4N90E 2VUYA 1JTPA 2P47B 3MYJB 4TSAL 4CJ0A 1F13A 5CD5D 1FYTB 5HHVL 4J3SA 2VSDA 2ADFH 3RNQA 4XVUC 1VGEL 4I0KA 4F37F 2PYFB 3BSZH 3I50H 3QNYA 4PTTA 5GGRA 3RKDD 2NXYC 3EO1A 4IRSA 4PJBF 3SO3C 5EBMB 3ZYOA 3L3HB 3K4AA 4JO2L 4PGEB 4PJHB 3UTZA 1UWXH 3MRDB 4GAJH 1E27B 1MUJB 5BMFL 1G7PA 1RZKC 5CCKL 5JOEA 1G9NH 4HBCL 2MNUA 4D9QE 1V3MA 3G5VB 4JFDD 2APFA 1D5IL 3Q3GA 3GGWB 1KCLA 5L2KE 4L4TD 4Y19A 3GBMH 2W65B 8CGTA 5A16A 4K94L 3VFTA 5F1NA 4KMLB 3AVEA 3TIEA 5C0AA 3VI4E 4PB9L 1N0XL 4P57B 1A7RH 3WNKA 5GGUA 4QRQA 3D69B 1RHFA 2YWYA 3R0NA 3BZEA 5K9KB 4Y2OA 2XN9A 3F7VA 3LPWA 2B5IC 4XVSL 1B0GB 3QCUL 4G8EB 4OTXH 3Q5OA 5F9WC 3MZTA 4IDJH 2BX5A 1QRND 1KPRA 4HH9B 3NMEA 2PYEA 1VDGA 2EDYA 3ILQD 5F7EL 1NL0L 1GIGH 1FNAA 2MCPH 1YDPA 1FJ1B 5DD5H 4L8CB 3KYMB 4JRXD 4OCLC 1BM3L 1DVFB 3ESVF 1FYTA 1Q72H 4HCRA 1U8JA 1QQDB 4JPVH 4Q97A 1XIWD 5BVJA 2A6KB 4GMSL 2AJVL 3UDWC 5JOFA 4P2OD 2NY1C 1KB9K 2VZ1A 5D5MB 3X17A 1UZ6F 1JGLL 1GGUA 3RU8L 4BYHA 4MWFB 5GRXG 4J1UA 3QQ9C 2RAMA 1SYSA 2K1MA 3FO0H 4MA7L 2EDBA 1F4XL 1MSPA 1UA6H 1G7PB 1JF1B 3J8F7 5T5NG 4POZC 5D5ME 2O26U 4Q9CA 3EYFA 5HHMB 1WIUA 3O0RH 5DD5L 2F8OA 1UH4A 4QLRA 5GRUH 2FX9L 3GGWA 3PDOB 4MGXA 3WFBH 1KJMB 5GGTH 3RI5K 3V79C 5I73C 4XC3H 3QZWA 2R2HB 4P57A 4BZ2H 1SY6H 4M61B 3OR6A 4NO0A 4PV9B 1IEAA 5ANME 1I1FA 3DV6A 3IDNB 1CBVL 3DIFA 3P4OA 4Y16A 4NRXA 4CU7A 3D85A 4PGCB 4ZNCD 1IL1B 1B0GA 4UAOC 1ZVSB 4HS6B 2ICWB 4BKLB 2ORBL 4JHWH 3P9LA 3QQ3B 4XP6L 1WIPA 2PYEB 1FNGB 1JGVL 1YDPB 2X9XA 1CIDA 5C6TH 3S96A 3O41B 3RFZC 3WHE1 3REWA 4F2MB 4HD9A 4HUMB 4IRJB 4EUPA 1U3ZA 1YEKL 4JR9H 5IJVA 1ZOXA 1YJDH 3PGCA 3LRHA 4NDMA 3AMLA 4RAUA 5HYJE 4PJDB 3VFWA 2PR4H 3MSPA 4F7CA 5H37G 4QYOB 1NGYB 2Z0BA 1AC6A 2D7MA 5I74B 4PJCB 4BSWB 4QRTB 4ZXBA 1EEYB 5ALCL 2DQEH 5IG7B 2ORBH 1A6UL 2VDQL 4NRZA 2NYYC 2OTUB 3ULVF 2V2WA 4JFDE 3TO2B 1OPGH 4XCYA 1P84K 4HJ0C 3EYFB 1AGBB 3WJJC 5SX4H 3DVNA 3PV7A 4JFZH 2H1PL 4WO4C 3RZWA 5EU7E 1T1XB 3O6FA 3QUZB 1Q1JH 2GJZB 4U6VH 1FLRH 4FQLL 3VMNA 2AJXL 4WWKA 4J3UA 1N26A 5JZ7C 1MOEA 1OM3H 1LEGB 3MO1A 2R2HA 4ZUSB 2A83B 1N4XL 1OOAA 1SEBB 5GRYA 1DL7H 4PV9A 1I1FB 1NAMH 3DV6B 3IDNA 4Y4FC 4KVNL 3PG2A 2VR9A 3D85B 3VFGH 5I6XC 3VXRB 4N90D 4LNVA 1TZGL 2XWBA 3KPMA 4Z7VA 4EI5D 4W4OA 1LEIA 4D0CA 4BFIB 4JY6A 5CIPA 1WAAF 4M62L 2MQCA 3O41A 3VXRE 3BPLB 3QUMH 4PJFF 3MRRB 3LEYH 4Y16C 5IT2H 1F3DJ 5EPMA 4NUJA 4KKAC 2IANB 5BS0E 5HD8C 3WXWH 5DURD 1EMTL 1QSEE 2BCKB 1I3GL 1S3KL 4KJYA 3O6KH 5DRXB 3BPNC 4LIQE 1EEYA 4P9HL 3P4MB 3TBYB 4ZAKD 2IMMA 2BJML 2FLRT 2DM3A 1SBSH 1TCRA 4D94A 2DMBA 4U3HA 4PBVC 3NBNA 4N1CA 3MROB 2VLRE 2FATH 1P4IH 5BVPL 2Z31C 5FA4B 3CDGA 2C26A 4NQEB 4QRRA 4PS4L 2DMCA 3HMXL 2R23B 1KENL 1IC4H 3O9WA 5AWNH 5IFAL 3MLYL 2E3VA 2ZWLT 5HBBA 1A0QL 5I73B 1S78C 5B38B 4GXUM 1CICC 3T08A 5DQDH 4F58L 4LQFH 2CXGA 1S7WB 5GS1C 6FABL 5IEKA 1IAII 3QIBB 1NLDH 5C6WH 4YPJA 4EZMA 2CR6A 1ZVYA 4XPGL 5MHSD 1OW0A 1TQBC 1LEIB 4RMVA 5IVZA 1Y18B 2FATL 1H8NA 4OLYL 1CQYA 4S2SB 4MA1C 5ERWA 1NDGA 3WJLA 1OTUC 4XVJH 4KHTH 4OM0L 2P5WD 4NN5B 1S7SA 4KWUA 5DUBB 3ZDZE 2O61B 3KR3H 3N50A 3THMH 3CFDA 1JYWA 3N85L 4Y5VA 2BNRE 1A7QH 3NH7H 4POYA 4B53A 4XC3L 1KV3A 4YFDB 3WIFB 3WNNA 4CL7A 3I3DA 4MJ6A 2IGFL 2CRYA 4KJYB 5I1LA 2EECA 5FIEA 2YD2A 1FNSH 5D2NC 1F4YL 4OCNC 1NLDL 3SDCB 2VLRA 3T09A 3TVMB 3TBYA 3QDJA 5E8DL 4ZSOE 4JHWL 1JGEA 3UJIH 3SO3B 2BHYA 1S8DA 1LDSA 4KK8D 4TYUA 3S3JA 3OKLB 4M48H 2HN7A 2VDRL 2NPLX 4JM4L 3DGCR 4Z7UF 1XCQB 2VLJD 4R97C 5J1TC 4LLQA 4JRWA 3RKDC 4LSRH 3S5LG 2DRUA 2P8LB 1YJDL 2IAMD 1AGCA 4S10A 5T3XE 4KKBD 5I71B 4ZMAT 3U9PL 5I8OH 1YN7A 8FABA 1SYVA 1VENA 1JYNA 3GSQA 5CGYD 1NGWB 4K23H 2EE9A 4PJ7E 2IH3A 3DPBA 2HFEB 4EVNA 1JF5A 4O2EA 5HPMB 4H26B 4I8DA 5IVZB 7FABH 4K3JH 3Q1SH 1UVQB 4JFZL 3UBXG 3ARFC 3B8SA 1RJYB 3GSWA 4MDIB 4JZJB 1RZJH 4TVPD 3RIFK 3ROOA 1PKQB 1FVCA 5GGQL 3BFOA 5DUPL 2NY5H 1NAMB 4IRSC 2MHAA 1PD6A 2OSLA 4FQ2L 3TN0A 5FF6A 4NKQB 3RGHA 4I3SL 5F88A 1A3RH 3QNZB 5LCVH 3V7AG 4CKVX 4P99A 1MCWW 1N0LA 4N8VB 4LRIA 4P4RB 2X9WA 5SWQA 3BJ91 1UFUA 1JPFA 1WBXB 4KJWC 5CZVL 2DM7A 5IF0A 4O00A 2VH5H 3T2NL 5IJKA 1N3NB 4HIXH 1FZOB 1NUFA 3QAZB 3QIWC 4YEEA 4AENB 2WSKA 1GHFH 3WDJA 1DVFD 5E7FA 4JLRA 4OB5L 4LLQB 4C4KT 1BQLL 2ICWJ 4HAFA 4D9RD 4M03A 1HHJA 5DD3H 1BBJA 3HPLB 1TJHL 1N7MH 1KELH 3K80A 4LU5L 1MFCH 4YX2H 5C0CE 4QXUL 2WP3T 5J56B 5EA0L 1UEMA 5DMJB 1AI1H 5BJTB 3VCLB 5L2JB 3HFML 4QY8A 3IU4H 2BSED 1J1PH 4H1LA 3DX6A 1AY1H 4Y4FD 3EYOA 1NFDE 4PJDF 25C8H 4ONFL 1U8LB 5I1KL 4Y4KC 1LO2L 4O2EB 5HPMA 2UY7A 4H26A 2E7HA 4NHCH 3LKPA 5TQ2H 2WNGA 4NPYB 4U6XB 1UVQA 2M26A 4OF6A 5A43C 5FO9A 4L9LB 3S3PA 3FO2B 1RJYA 1T22A 3DYPA 3QR2A 5GS2H 2YA1A 4U2ZA 5CP7B 5GHWL 4PRID 4Y7MA 1BIIA 2Y72A 4LSVH 2A6JB 2APBA 3GNML 1PSKL 1H5BB 2XKNB 3PNWB 5EA0H 4M7JL 1KXVC 5D2LB 5E4EB 5DD6A 1R0AL 2Y1VA 3LN5B 4K9EH 1JWSB 2P45B 5TFSL 2XQBH 5JPMB 1ITBB 3U7WH 1OSPH 3CCHA 5SWQB 2Z91B 2Z8WC 1A6TB 1YY9D 2B0SH 3KLHD 3C9NA 1XGRB 4HIHB 4U1KB 1DE4B 1JPTL 5F89B 5DEGB 1N3NA 3LPFA 3OHXA 4XP4H 4GW5A 4MS8D 5DR5H 5FECA 3L9RA 4KXZI 1VACA 1HH6B 2VUOA 3VD4A 2ADIA 4DOHB 4NWUH 5FUCE 3GNMH 4X6FB 1M7IA 2EO9A 4HWBL 5AAWA 1BMGA 3AAZB 4O2CB 2BZDA 3DLQR 4P3CH 2AK1H 2V7HB 3DMMB 4IMLB 4XXDB 4WFGE 3S4SA 5I9QB 3BE1L 4L1DA 3WL9B 1WBYB 3PWPE 4E41E 3UJIL 1R5IA 4IRSD 3DGGA 3HAEA 4RFEA 1ZHBA 2R0KL 3RWEB 4WGWB 5GS1A 5IVXA 3NGBC 3MR9B 3QNYB 1R3IH 4N9OB 3U1SL 1QRNB 4K8RL 1YNKH 4LQ1A 5KANG 3EOAB 4DW2H 1DBAH 2PTVA 4NWUL 5CP7A 1I8KB 1W2KT 3VRLE 4EOWH 4PJHA 4JRXE 4MB5A 1FH5L 4BH7B 3SGDH 2R2BB 1E27A 5D7IF 2LTQB 2CLZB 1FO0A 6CGTA 2FIRT 1D5XA 4Z7NF 2GEEA 1IM3B 3FO1B 3OX8B 3CCHB 2A9NH 2E7CA 2C3GA 4GBXD 2NY6B 2DAVA 3BESR 1QKZL 4HIHA 1SJVA 3AM8C 4U1KA 1NCUA 2OX5A 4ZO8A 3RRQA 3SJVB 1IMHC 2H32A 5CD3B 3DTXA 3RPIA 4W6YB 5F1NB 2YPLD 3L9RB 3AS3A 5GJSL 4P2QD 2OP4H 4PB9H 3T4AB 2L7UA 2PCPA 1NBQA 3KLAB 1KIPA 5IHUL 4WUUD 1JFQH 3DO3A 1MCEA 5KSUB 3VH8A 4OCXL 1XCTA 4NYLA 1F58L 2LQRA 5KAQG 2AP2A 3K1DA 3WL9A 2FJFA 1A14L 5CZXD 3NZHL 1TJGL 5TPWH 2N56A 2F54B 1JL8A 3LQAH 2M2DA 1T80A 1HSAA 5GS1B 5BVJB 1RZIA 2RR3A 3BO8B 2BSRA 3KXFA 5AZ2H 5ADOL 2VAAA 5BV7B 2XRAH 5T33H 3BIBX 3PUCA 4PRBA 3RWDB 3CUPB 1OTUD 1OCWH 3QCVH 3ZTJG 4BH7A 2ZSWB 1IKFH 4F7TA 4U1GC 3TIDB 1TNNA 1S9YB 1SYSB 4K94C 2J8UA 4QXUH 2NX5E 4DAGH 5HTSA 2ED8A 2K7QA 1KEMH 4DUWA 1BQSA 1HEZA 5E8EA 1BZQK 3NFSL 5E1HB 1Q94B 2IPKA 4ZUVB 1F11A 2X4UB 3MC0A 4YNYB 4GRLD 4WW1B 3PDOA 4K07A 3O0RL 5E6IB 2H32B 1G9MH 5CD3A 4XI5D 2WQ8A 4YFLI 2EDWA 2GSGA 2XRAL 3QZWB 3Q48A 3WIHA 1WITA 2CK0L 2R69L 4V2CB 1SBBA 4Z7VF 3QJFA 3UBXB 3UEZA 2OL3A 4OZFB 1JHLL 1XFPA 2YRPA 4KJQC 2OXHA 2DTMH 2H6PB 2PCPB 5D2NE 1X5XA 1A5FL 4PJEE 1DTUA 1OY3B 3MGTB 4JQIL 4P46C 3SDAC 1AD0B 3BD3A 4MMZC 2FR4A 3GSUA 5J6GB 4RA3A 3WEXA 5F3BA 3KXFE 2BY0A 1QG3A 4CVXB 1GOFA 3IS0X 3MV9D 3B5TA 2UUDH 4XPHH 1HZHL 3U46A 2HJKA 4U6HA 1EGJH 2BSRB 3KXFB 3H3PL 3BJLA 3ES6A 4G6AD 3FMGL 4IOIA 4OZIB 1G84A 2VTFA 3VGFA 4CMHC 4QYOA 5EU4A 1ZT1A 5GRJL 5DK2B 5D6DA 3TIDA 3JZ7A 4YE4L 5E94A 1RSFA 3NACH 4F7MA 3B2VL 4ZXBC 5DC9B 3P3YA 2B4CH 3RWJA 3SKMA 3RTQC 1UB5B 3WFDH 1P9MC 3PGDA 1T1XA 3KPSB 4ZUVA 1IAOB 4B41A 3H3BC 4WW1A 2YKLL 1OP9A 3V8OA 2DMKA 3UZEA 1A64A 1DR9A 2H1PH 2VC2H 1RIUL 4U1LB 4ODHL 1R6VA 2D9QB 1SEBA 2H26A 1NAKL 1F3RB 1UWGH 2VXUL 2OL3B 4OZFA 5JOPD 4M8QA 1JZ3A 4ELMA 1C5BL 4NQCA 3EOTH 1OD9A 4TPRH 3GRWL 2HFGL 4RZCA 3P4NB 1CLCA 3MACH 3IT8D 4NQDD 3AMKA 1N6VA 2YXFA 4KMQA 1N2RA 4AM0A 2Z4QA 1Z0MA 4HXBL 4C57C 1BF2A 2J8UE 4OF7A 4XNZC 3ZDXE 5HYEA 5INDB 3HNTL 5J6GA 3T0EE 4JGMA 1MCRA 4UT6H 1NUDA 2BDNL 3NGBB 2BVQB 1BWWA 3E8UL 3UJTH 3WUWA 1EBAA 5F6HJ 4NUJB 4DZ8B 4TUOB 3SKJL 4FQJL 3UC0H 5F70A 2CD0A 2JJVA 4P49A 4XVSH 5ETUB 4YHYC 1L7IL 3AU1A 2BCKA 3ES6B 4IOIB 2X1WL 1AXSA 1BREA 4JN2A 4P5KB 2VKWA 4ZUTA 3PWJA 1FCGA 5DRXA 5ILTH 1VPOH 1UACL 1FN4A 1EHAA 4Z7UB 1OAQH 2F58L 4NQVA 5E94B 5D7IB 1BFSA 3BI9X 1PEWA 4BK4A 4TNWF 3HG1A 2W9DH 1P53A 5DMKA 3FTGB 4UBDD 1OTTC 1RIHL 3U30C 4ZSOB 5E2WL 4JRYA 4OD2B 1NBVH 1NDMB 1WWCA 4N0CC 5IBUG 3IRZA 3MOAH 4FFVC 2ADJA 2R15A 3H3KA 5T1LD 3FO0L 5H8DA 5FYJH 3UZVB 5IOPA 2PO6C 1JZ8A 1A6ZB 3QCVL 4Z18A 4GRLB 2ZPKL 4APQD 5TDOA 2VISB 1I1AC 1BEYH 4XNQB 4P4KC 1TETL 5GS2D 3RTQD 4M6NH 3V8CA 3EJJX 3S88L 1UT9A 5F9OL 2FYYB 1FFRA 3EYVB 3WIIL 5JW4R 5GGTA 1SY6L 3UCRA 1D9KB 2MJWA 3CFDB 3REVB 4Y5VB 2Y5TA 4R2GD 1KACB 2UVEA 4OM0H 4L29B 2IPTH 2ADGB 2J5LC 2R69H 3H9SA 4JVWA 3N85H 1V3LA 1A3LH 4ZUTB 4GKSA 3JTTA 3OXRA 4M3JA 5LQBL 3B8YA 5LAXA 4Z7UA 1JGVH 3RP1A 3OMZA 1I7TA 1X5KA 4NQCE 1TETH 4WEMB 4P4KD 1PYWB 3V4UL 1JPSL 5EU6B 4JR9L 3DARA 1FIEA 3DX7A 1RFDH 2KH2B 4M02A 5MEQB 4XCFH 4I18C 1GRWA 1KYOJ 5L2KA 4UNUA 1Y6KR 3C5ZB 3X14B 3CXDH 2AEQH 3C5SA 3D9AH 1CDJA 4JM2B 4CNIB 1VB9A 1NCTA 3NIGF 1FBIL 4OUUA 1DJSA 5D72L 5C3LD 4G5ZH 1AC0A 2VDKH 3MPCA 3FQTA 3QNXA 3N9GH 1KYOK 4K7FA 2HFEA 4FFYH 1OGAB 4G42B 2NY7L 2O5XL 3GMNB 3L3OA 1C7SA 5JDSA 4JKPH 1Q0XH 1T6WA 3L5WA 4RMSA 4U1JA 4HK3J 5IP4A 5B8CB 1FIGL 2ZCLH 4E41D 3WNLA 1HKLH 2CJUL 3QI9A 4XVUD 2C1OB 1NAMA 2NXYB 3IB4A 1S7TB 1D9KD 2C7UB 1QZ1A 3B83A 4M5YH 5FF6B 2COQA 3QDMB 1LO4L 4LVHB 1CR9L 3W9DA 3R4DA 4OM1L 4NFDA 1JPFB 4UOW1 1PYWA 4UB0H 1XZ0A 2R0LH 4HXAH 4XPAL 1FZOA 4K55A 3G6AA 1IEBB 1TCMA 4LHJB 1FZKA 3KPPB 5ESVB 1OARL 4X9BA 5L2KB 3C08H 4PJ8A 5E99H 4GMTH 1HKLL 5FGCB 3P0VH 2W0FB 3JV5A 3NCMA 1E6OH 4JM2A 2F53A 2QV2A 1ZLVH 1QOKA 3PGFL 4QOKD 4J6RH 2PTUA 3GMMA 1U8MA 5CCKH 1I9JL 1Q38A 2CUIA 5BJTA 5JMOC 2HH0H 5DD3L 1UACH 1CR9H 4H1LB 1IM9A 3KJ4B 4RQQA 4K2UH 2C3HA 4L3EE 2Y4SA 3EYOB 2BSTA 4K7FB 1C5DB 2YBRA 1U8LA 4X6DA 3QDAA 3V0WL 1HIML 1VFBA 4ENEC 4MA3A 4N0YL 3MLWL 1KENH 4U49A 4KQ4L 5F72S 3ZLQC 1DN2A 4QOKB 1QFUH 1OGAD 1CGWA 3QWRD 3HI1B 3MUHL 2X70A 1MH5A 2B1HL 2G5RA 4LFHG 1RZGA 4KTEL 1DEDA 1QSVA 3BPOC 5FGRA 3P40A 3C6SA 4RGOH 5DD6B 3QDMA 4OIBA 5F7EH 1I1AD 1ZE3C 3O2VH 4CUCA 4RGNB 4RMWA 3UTTD 1T20A 4HULB 1HIMH 2FJHB 4M6NL 4QCIA 5J13C 3SGKC 2IPUG 3VFSB 4NCC2 4MYWB 1DE4A 2VSCA 5ISZB 4CVZB 1P4LA 2AABH 1FZKB 3BD4A 1IZJA 1S9WA 4QO1A 3U48A 5FM8A 4I18B 4TQEL 5C07D 5KVGH 5KVEL 3TBSB 1LEKA 1EHLL 1MI5D 4R0LC 4LOUD 4XPFL 4O2CA 3PHQA 1YZZA 2NXZB 1WC7A 4KTDH 5GGRB 2EXYD 1C08B 4LLYA 3T0DA 1NGPL 1GIGL 4ELKA 1JWUA 2NR6C 1C5DA 4PGEA 4P5TD 1BLNA 4NO2B 1VFBB 5HPOA 3NCCB 3HAEB 5KOMC 5EZIH 3STLB 3ZZ1A 4NN6B 5EBLB 4ZFFB 1P5UA 3HI1A 3SE9L 1RZ8A 3BEWA 4YWGL 1MH5B 4TN9A 2Z31B 1U58B 3VXOB 3V4PL 1WJ3A 3VXSE 4YXHL 5TDPA 1Z9SA 4Y19B 4LEXH 4LSUH 4UDTB 2V17H 3VFTB 2FGWL 4FA8A 2CLZA 4LP4A 1FO0B 4UZGA 4Y5XB 4LEOB 5IV2B 3QUXC 3T3MF 4KFZC 3FRPG 4NOBA 4YHNA 1T20B 3KJ6L 3KYNA 3OX8A 1G9EA 2VZSA 5K9KA 2C4XA 3TNMB 3DSNA 3QO1B 3SE3A 3VMOA 3SDDC 3BKML 3K46A 2OCFD 4NT6A 5DD0H 2UZYB 4D0BB 1CT8B 2X4RB 5GGQH 3EFFB 5FYKH 5FOJA 1IAKB 5DRZA 1KPVB 2FX7H 4P46A 4YXHH 4P9ML 4RGMB 1DVFA 5GJSH 1BZ7A 4LL9A 1OAYL 2MQ3A 4XP6H 1QQDA 5I1EL 1MCBA 1G9NC 3C09C 1MRDL 3MCG1 3RVTD 2ICEB 3IFPA 4I0PC 4UV4L 4PYHA 5D5MA 2FJFB 1JWUB 2YD7A 5LGJB 4L8SC 2AV1B 1BLNB 4DUVA 5BCAA 1K4CB 4HUNB 3PWNB 2R0LL 3FOMA 1GGIH 3QHZL 1TLKA 2F15A 1V7NL 3DBXA 3KPOA 1RZIB 3BO8A 1T6VN 3GSNH 2FCBA 1VFAA 1URLA 2H41A 3BEWB 4PRBB 1MHHB 3PHSA 1IGML 2QQNH 4LAJH 5F44A 3VXOA 5HGBA 1Q8MA 4ODUA 4M9PA 4F7TB 3WKMH 5CP3H 2YK1L 3PGFH 4G8FB 4F9PC 5BZDB 5IWLA 4FZ8L 4OIAA 1MFAH 3T65A 5JHDD 4LEOA 1MJJB 3SDDB 1CXEA 3OR6B 4NO0B 1F02I 5FCUL 1P7QD 1DQML 1Q94A 3LEYL 3TNMA 4NRXB 4GS7C 4HWNA 5LGHH 4PJHF 5GHWH 4BKLA 1AXTL 1MF2L 1E4JA 1KJ3L 4UU9A 2F9BT 1CT8A 4P5TB 2X4RA 2HP4A 1VCAA 3BKCH 4Y5YA 2FEEI 2VDLH 2YUZA 4JZOA 5CUSL 5DJ6A 4ZS6D 3V0VA 4GRLC 5DRZB 5I8KH 1KPVA 1XF5B 2J8HA 1I1YB 1KG0B 4OIIL 3REWB 2OK0L 1A22B 3NTCH 4MHHI 4IRJA 4Y2DC 1SBSL 2EIZB 5IJVB 2I25N 5K9JH 5IR1B 1S7RA 2WINB 1EFXB 4HKZA 2CQVA 3WJJA 4CU6A 4PJDA 1H9VA 5L9DL 2FR4B 1I1CA 4I5BB 5HDQH 3WEXB 4FQCL 3U79A 4WV1C 1JYVA 2HLFD 4PJCA 4BSWA 1LE9B 2GT9B 2WUCH 1K4CA 1OAUH 2EKJA 5LG1A 4LLVA 3TYFB 3FOMB 5DJXA 4NRZB 3ULVD 4ISVA 3C8KA 5J12C 3NIDE 1T7YA 3QDHA 3U4EB 4HUVA 2CMRH 1BF8A 1JTTA 3CDCA 2A0LC 1YJDC 5IROA 4H20L 3DVNB 4KRPD 4OZIA 5CBEA 3NFNA 1JI2A 2Q3ZA 2VABB 1ZT1B 3QUZA 3CNKA 3O6FB 5CZXC 4YFEA 3S37L 4LGSB 3IDUA 4OZ4A 5DHVB 4MD4B 1KCUL 4EEEA 4ODSL 4WWKB 4G8FA 5IBTL 4HZLB 4AEHH 5GRJH 2NY4D 2JCCB 1U93B 3RPKA 4Y88A 1UB5A 4OKVB 3BUTA 5D70H 4JDVB 4MAYD 1DN0B 3B2VH 4HG4K 1BQHB 5J11B 2YMXL 2ZUYA 4DW2L 3OGCB 3VA2C 4KJPD 3VXRA 5FYKU 5FYJU 4F9LC 3AM8A 4HPOH 4U7MA 3B9DA 4MCZB 3E0GA 4GLRH 1CFSB 5FDWA 2J8UF 2X1QA 3L5XH 5CIPB 3AS0A 3WFEL 2E7LA 5FB8B 2F5AL 2DWDB 3QQ4A 5HGHB 1XF5A 4ELMB 4MJ4A 1I1YA 1KG0A 4MZ2A 3ARGB 1TZIA 4G8IA 5HDLA 3C8HA 4KUZL 5CEZH 5I16B 3CVHL 3QFJE 1QO3A 2X4SB 2VXUH 3JV4A 4PJCE 4ALAL 3DO7B 2D0HA 3VJ6A 1ORQB 1S7RB 1W8OA 4HKZB 4WI4A 1BD2D 3TBWA 4AM0B 3HR5A 1EJOH 4EI5A 4I5BA 1XR9A 1QKZH 3A67L 2JJSC 1U3JA 1I3VA 2BVQA 4NIKB 3CSGA 3QEUA 3CZFA 2GT9A 4PJCF 5IGXL 4UNTA 1RD6A 1FYHB 2H32H 4XBGB 2BVPA 4QHMA 3X3FL 4LLVB 2Z31D 3P4MA 4UT6L 4NQDE 2Y36L 1RUPL 3CFKA 4LLUB 4TUOA 1TCRB 1B88A 1MQKH 5ETUA 5TE7L 3WFEH 1GZQB 2YRLA 4WIQA 3MROA 2DLGA 4KKAD 1AXSB 4P5KA 3T0ED 3NFNB 5T3ZD 2BRRH 2GITA 1TVBA 5FKAB 4QWWC 2C5DC 4KU1A 1FN4B 1F58H 1OB1A 1T2JA 5DHVA 5DMGD 4MD4A 4EKXA 2DQFA 1DLHB 1F4WL 3B43A 5ILTL 4BZ1H 3OF6D 4H0HB 1EO8H 4OI8A 2FD6L 3MRLB 1T83A 3IFNH 3WHE0 1BQHA 1O7SA 4NKDA 2MSPA 5T33L 1NDMA 4OFDA 2JKXA 4PLJC 3MV7E 3VGBA 3W82A 1QFOA 4OLUH 3NCEB 4NM8H 4DFIA 5C0IA 2AQ3A 3WKNA 1MHPL 2ZUQC 1JVKA 3HNVH 5FB8A 1J1XH 2DWDA 1NDGB 4OLXH 3EJZC 2FSEA 2G60L 3MRKB 1T7ZA 5ENWA 1TZIB 1A6ZA 4G8IB 4MLSA 3Q0HA 3JBG7 4FHBD 3SGEH 4IJ3B 2DYPB 2JB6A 1NSNH 3V6OA 3LMJL 3HI6H 1EEZB 1R24B 3QUXD 4NO5A 2DTSA 3WIFA 3HR5B 5DJCA 5DJ0B 5JNYA 3AY4A 3UTQB 3JSSA 3EYVA 3FN0H 3D0LA 3D85D 4JB9H 3QO0B 2VLRB 4QHMB 4M1CC 5DHVH 3VDBA 1S9XB 3SDYL 2Y5TB 3MLPA 3N1FC 4LLUA 1HK6A 3PWLA 5JLZA 1I8MA 2RCSL 3H9SB 3BKCL 4R6UA 3D25B 4DKEH 4AT6A 4Q9RH 2G75A 3VGEA 2HN7B 4Y4KD 3JTTB 3OXRB 3O2WH 3WNPA 3D3VE 1J1PL 3ZHLA 2IPTL 5IMMB 4J3TA 4PJHE 3K74B 4XPTH 3KJ4C 1DLHA 1I7TB 3TO4C 3HI6L 1R5VA 5KANI 2QHRL 3KG5A 2P8LA 2FX8H 1EO7A 4I3GA 3WV0A 2X4NB 4M7KL 1F6AA 3MODH 1CCZA 4XPHL 2HKHL 3BKJL 4Q9BA 4WUUA 1LP9E 4X6EB 1NGWA 5JHDE 4NKDB 2QQKH 4RMUA 4HMCA 5T3XL 1KN4L 4AIOA 3C5SB 1QFPA 4YDVB 1MCSA 3KPRD 1HXYA 5AG9A 1R5WB 5FHAH 2WBWB 2IG2H 4CNIA 4L4VA 5J89A 3VI3F 3NA9L 3VXNB 1NJ9A 2BVUA 2BXYA 4HJJL 2IC2A 5FGCE 3WFDL 2DYPA 3QNXB 2BVOB 4JO4L 4X9IA 2OR9H 3TCLA 4PJIA 3IFOB 3IKKA 4DTGL 1NGXB 3QXUA 25C8L 2WM0A 2DQGH 4ONFH 4DGIH 2YKLH 5J1AB 3GMNA 2MHAB 3FQUB 1U8IB 3UTQA 1RZJC 4H25A 5E56A 4GRWE 4WVRA 5HHNA 5ESAB 4N8VA 3NPSB 4P4RA 1WBXA 3KNBB 2YHGA 4HPOL 4FQXA 4F8QA 1MY5A 3L95B 4LDLB 3CX2A 3MUJA 4HX1B 3SBWA 4PG2C 3P9WB 4GAFB 4RAHA 4KRLB 3NABH 1I8IB 3B9VA 3G6JA 4WUUE 3U6RB 2CKBB 4ZNEE 4OJFL 5CGMA 4UTBH 1ZANH 5HHXL 4C55A 5C0DB 3U7WL 2BXZA 4UOW0 5IB5B 1GPOL 5IK3B 4YHPA 2GCYB 1NFKA 3FRPA 3C2AH 1O0VA 5D7SL 2OMBA 2UUDK 4OCMC 3I84A 4XP4L 3VCLA 4YHZH 5B4MC 5K59E 4G9FA 4MAYB 1T83C 4UB0L 2ZKHH 4Z0XA 3MMEA 1INDL 1LHZA 1JF6A 4R7DB 2Y9RT 4X4ZA 4HKBB 4FQ1L 5JPNA 3C60B 4ERSL 2FBJL 3KLHC 4L4VB 2P44B 3GRWA 3MLZH 1J87A 1LK2B 5EUOB 4BA8A 5I2IA 1T22B 4PTTB 1T5WB 4H5SA 3EO1B 4JVPA 1NMCC 5FV1L 3DETD 4PJIB 2A6JA 2YBRB 1U8HB 1X4ZA