3SGDI

Crystal structure of the mouse mab 17.2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
218
structure length
218
Chain Sequence
DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGSHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex mAb 17.2 and the C-terminal region of Trypanosoma cruzi P2 Beta protein: implications in cross-reactivity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Light Chain
total genus 57
structure length 218
sequence length 218
chains with identical sequence L
ec nomenclature
pdb deposition date 2011-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgdI02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgdI01
1BBDL 3LPFA 5E00A 4HC1L 1TIUA 1EAPA 3I02A 3WNKA 4YBLC 1N59B 3O6FC 5HDBF 2YC1A 4HIXL 5JIPA 5KSBE 1DBJL 4CU8A 4OUUA 1A0QL 2Y06L 3MOBL 5C09E 4ODXA 3GJFA 2VMFA 1YEJH 4NUJA 1AIFA 3DI3B 4X98B 4CGTA 5HHQB 1YQ2A 3BKJH 3UZEA 5JHLL 2Y6SC 5C0FA 4GXVH 2DYPA 4G9DA 2R4SH 2EICA 3VD9A 1P5VA 2DBLH 4KUCD 3BDXA 1TJGL 4WWID 1XF1A 3ROLB 4N9OB 4W6XB 1FNAA 2VAJA 1GAFL 3WUWG 1W0VB 4DZ8A 5ALBL 5IV2B 2APTA 3FQRB 5I9QB 1R3KA 2OI9C 4NQVB 4NQEE 1HHGA 1BQHG 1SY6L 3LPGA 3IETA 4UTBL 3ARGC 1L9MA 2EXWD 3KPRA 5ANMA 3C87A 3B9KA 1TPXC 3ME0A 1BAFL 4CKVX 3S3JA 3F7YB 3WN5A 5I19L 1W0VA 3I50H 4FNLL 2XWJA 3ZL4H 3WS6A 4PTUB 2ARJA 1FL3A 1MFBL 5GRJL 3TH4T 5KG9B 3T0EA 2JTDA 4NQVA 5HDQH 3IETB 3WO3B 4MLSA 1WBXA 3L9RA 2R0LH 1FZKB 3CFEB 3PWPD 4P2QE 5JORB 2KL6A 5HJ3B 4ZUUB 1I8MB 4I9WD 4P9ML 3D5OF 4PJHF 1CXFA 3UPAA 5F7EL 1ZMYA 4WNQB 2Q8BH 1U8KA 1A6ZB 5ADOL 2OQJB 1WBXB 3BH8B 2RCSL 1FZKA 3AROA 5E6IC 3BH9B 5GGRB 2CH8A 3BPLB 3W39A 3I9GL 2DI7A 4MJ2A 4MAUH 2BP3A 4OM1H 5CFHA 1BJMA 3U6RA 4CRPA 1DE4A 4LCYB 3ZDXE 1RZKL 3MLUL 3BUTA 1T80A 3BP7A 1G84A 4LEXH 3N9GL 4BQ9A 1Q38A 4BK4A 3SDYL 1L7IH 5FGBC 3THML 1IGCH 1CWVA 1MCPH 1G0XA 4R90H 5MP6H 2BDNH 5FYJU 4MQTB 1TQBB 4B7LA 4PLOB 5D9SB 4LFHG 5A2IH 5BW7C 3TBWB 2UVEA 4WFHE 2VL5B 3V4UL 3KYOA 4KI1A 5CMAA 4DEPC 5T1LD 4M61A 4MJ5B 3MGTB 1FLRH 4HZLA 5EBMA 2Z4QB 4AG4H 1TJIL 2QQNL 2A0LC 2A74A 3I2CH 2Q8BL 3C09C 1VERA 5E8NA 3M8OH 1OSPL 3LEXB 3TJHD 4MVBD 4LQFH 3V0WL 4QTHB 5DS8A 1W72L 3Q0HA 2A73B 2LU3A 4LRNH 1CICA 1GZPA 5DLMH 4U1GB 5IJKA 3JSSA 1K3IA 3TC9A 4RISH 1ED3A 5F7MC 3QNZA 2P5WD 5DLML 4LCWE 5DC4B 3V4PH 5LBSL 1OT1A 1BX2A 1DQJB 1HIMH 1GJIA 5HDLA 1CXKA 1OGAA 2XV6B 3S4SG 4N0CC 4QRPB 1BD2B 4JFQB 1KJVB 4Q9RL 1QUNA 3E0GA 2G9HA 3GEWB 1JGUH 4U1JA 5DC9B 3KNBB 2KZWA 5KANI 5B4MC 4R2GB 5C07D 2ADGB 5JLZB 1G7MA 2FO4A 3HZYA 1CE1H 1IM3B 3IKKA 5D96C 2VXQH 3WSQH 1BFOB 4V1DE 4PD4K 2A77L 3OJ2C 2HWZL 5IB2B 5GJSL 1MF2H 3WIFA 4JFQA 3EBAA 1PYWB 5F9JA 2FH6A 3JWOL 3LRGA 4AENA 3GJEA 5CUSL 5I15H 4D2NA 1SBSH 1JNNL 1K4DB 4IRJD 5MERA 4Y16C 4MXQC 4ODHL 4PLKC 3HRZA 2DLIA 3QPXH 2X4PB 2BSSB 1A3RL 5MEQA 1DBJH 4PGBA 1V7ML 1K4DA 4QXTB 4JREC 2HFEB 3R06A 4MAYB 3ULVE 4LDOB 1Z3GH 3U7AA 1RUKL 3FFCE 4HDIA 4QHLB 2ZG1A 1J10A 3TZVC 1WFTA 1U6AH 4XH2A 1ZVSA 2NY2B 1LMKA 2NXYD 2IFFH 4A6YB 2VZTA 1WBZA 5GS1B 4S1QH 1NUDA 4EUPH 1TZGL 4YHNA 4MNHA 2VDLL 5AEAA 1OB1B 4MNGB 1F4WH 3K74B 2BJMH 3U4AA 4BUGA 5I1IH 2GSGA 4JG1H 2DQDL 1DEEA 4G9DB 4KZDL 1DLFL 4X6EB 1YEEL 1G6RH 1OB1A 3MOBH 3SQBA 4OM0H 1MIEL 2ICEB 3NIGE 3QDME 2HJKB 3EDFA 1R3KB 4OZFG 4G8IA 3IDMB 1YEDA 5EN2B 1BZ9A 4YHIB 3UJTH 4F37F 5C8JA 4BFIA 4B50A 4O02H 1IZJA 3X3GH 1T5XB 3QXUA 5I1HL 4NFBA 3WDHA 1H8OA 1QRND 4X99B 5J11B 3PWUB 3N85L 2DLFL 1SBSL 4GXUN 1VACB 3GSUB 2E3VA 5FKAB 1IGYA 2DF3A 3HR5B 3HPJB 5HYSB 4JDVB 5F89B 4QF1B 2XN9B 1W2KT 1LO2H 4EBQH 1CICD 1UQSB 3GHEH 3CU7A 5CP7A 4ZS6D 5L2JA 3CZFB 3PWPB 4UV7H 3IRPX 4QRPA 4YDJB 3SDDA 3BEWB 2HRPL 4J23A 1EVUA 5EOCH 1OHQA 4QRSA 1JYNA 4H26B 3GMPA 5D7LD 4GKZA 2FHBA 1BD2E 4QRPE 1MCIA 2GI7A 3RUGF 1LO4L 1QQDA 4POZC 1QNZH 3K0WA 1S7TA 2H32A 4IMKC 4E42B 3B83A 3VRLF 3QDMD 5T1LB 2CK2A 3REVA 5I1KL 3SDDB 2QQKL 4PJ5D 3RU8L 2VLLB 5HHOB 2IFFL 4LCWB 3HE7B 2H6PB 4LK4A 4GRLA 4RGND 3UMTA 3R8QA 3BPCB 3EZJB 4LRNL 1JPST 4OGYL 2NTFA 1EIBA 5ICZB 1S9WB 3QZWG 5JDSB 2EE6A 4NP4H 3VFUA 5I1GH 3P9LA 4M3JA 2DICA 4UT9L 4Q6YA 3M8OL 2Q76B 5F7UA 2VAAA 1I3VA 3A67H 4M48L 2X4TA 3V0AC 5BS0D 4X4XB 5CJOL 4JFPA 5D6DA 2Z8VC 4HKZA 4ZFOB 1ZK9A 1S7RB 3ARDD 2A74B 5F9WB 4QNPF 5IVXE 1HH6A 2X1QA 3WO4C 4AIZA 1IEHA 3H9HA 2YBRB 3SOBH 2EYRA 4XH2B 1INQA 3I6GB 3DJ9A 1WBZB 3AREC 4M4RA 3C08H 1KGCD 3QIBD 1YEKL 1LEKB 3P3YA 2YC1B 3FO0L 5EFIA 1S7RA 3HCVB 1QSFE 1A1OB 4RGOL 4I13B 3HG1D 4KXZH 3HE6B 4ZPVA 3BD4A 2YPVH 2DJ4A 3RTQC 2GT9B 1RZKC 4Y19E 2AJYH 3GBMH 4U3HA 1T7WA 4G6KL 3H9ZA 5D6CA 1J1PH 2AK4E 4YHMH 5EULV 4ZFFB 2BSED 3UZVB 4Z5RA 5FUCC 4K8RH 4XNMA 3G6JB 5JOFB 1CLZL 3ZSTA 3KPQB 5BMFH 1M4KA 1U8HA 1S7UA 1A1NA 4K7PY 1ZLSH 3FQRA 4GRLD 2YD9A 3GSXA 4LPYA 4OB5H 2NY4B 5MEND 4FFZH 2BFVL 3P4OA 4IJ3B 5IVNA 2FEDC 3GSNA 4HH9A 4G7VL 3PHOB 2FX8L 3F7YA 5C0DB 3QHTC 2Z35A 3GRWH 5FYKE 4OF3A 1JZ7A 1YEKH 3VFWB 3ULSA 1AD0A 2MQ3A 3GRWL 3WXVH 1RJYA 4UT9H 1S5HB 2H3NA 3G6AA 3PGCA 1K2DB 4MAYC 1LDPH 5K9QI 2E7CA 3LY6A 1UACH 4EXKA 4E5XB 2VDLH 3HLAA 4G8GD 4MQXC 1LE5A 1QQDB 4HJGB 4PY7B 3QUXA 2FX9H 2VQ1B 5D1ZB 4IIQC 1GGIL 1VADA 3RGHA 4UT7H 3NA9H 4YIQB 5EO0A 5GGVH 4O4YH 4FQPA 4KHTH 1ZVSB 1JV5B 2DM7A 3QULB 2LQRA 3V4UH 3HLAB 2HFFB 1U92A 3S96A 4KI5F 4LLUB 1NAKL 3J7HA 3C6SB 1NGQH 5DMYA 1IT9L 2DOCA 1YUHB 1NBZA 1DN0A 4R90L 1Z2KA 2YPVL 3DX6A 4K3GA 3C8KA 3DGGB 1DBKH 2FX8H 2FSEA 5D2NC 3UYRL 2ZCHH 1FZJB 4D0BA 3GI9L 3H9YA 2QL1A 2C4FT 5DD0L 5C07A 1FIGL 2UZIL 4XC3L 4JFFB 5TGBA 5HVGB 3MLZL 4FFWC 5DK0A 2IH1B 3NACH 5BMFL 2YPKB 4Y5XA 1OPGH 4P2CG 1OAUL 3MGTA 4JQVA 1U3JA 5EO9B 4NFCA 4ELME 3OMZA 3UTSD 5BRZA 1PVHA 1YN6B 3L95B 4P2OD 3L3IB 3TO4D 1LO5B 1J7VR 2BFVH 3KXFB 3Q6FB 5KVDL 5ACZA 1N64L 4N8CL 4UIMB 1GYAA 3V6OC 4PJBA 3DV4B 3TO2A 4PP1D 2IBGA 1TFHA 3G5XB 3FL7A 2CSPA 3W0WA 2HLAA 5DS8B 4QHNA 5DI8A 2Q6WB 3AU1B 4GLRI 2NXZD 1JPTH 3RHWF 2GJZA 3U83A 3FQWB 2FECI 2H26B 2XFXB 5ETUB 1FL6B 4Z7OF 5DFVC 2APWA 2UZYB 1FVEA 3BPNB 2GHWB 3CFBA 5TPWL 1U8OB 3BVNA 3STZA 1T6WA 2ZSWB 3MRCB 4YPJA 2OMBA 3AU1A 1JNLL 4DKDC 1JPGB 1EAJA 2NW2A 3ARTA 3S36X 5J12C 4JM2A 2EDXA 3MJ7A 2LV4A 3NTCL 3ULUF 4DAGL 5MEPB 1JN6B 3RWFB 4HKJA 1AHWB 2E5EA 3STZB 1DLFH 2Y36L 1TETL 3VGBA 5IEHA 3TPUA 4UU9A 1I7UB 3OBAA 3ULVL 1MELA 2CO6B 2E9IA 3RWEA 4FZEL 4I48A 3RZWA 3JWDL 4HIIB 3MRKA 2ZUWA 1FG2A 1SM3H 2DDQL 4L3EA 4H8WC 4HWBH 5FYKL 3P9LB 4X4ME 5IBUB 3QIWD 2Q76A 1BMGA 3MO1A 5FUZL 3S98A 4U1SA 4YDLB 3GMQB 2EDHA 5B38B 3FFCB 2B5IB 1OF2B 2VXTL 5HD8C 1CLZH 1D7FA 3HI6H 4TTDD 4X80L 3AY4A 4M93C 4H20H 5IMLB 4XP9L 1LE9A 4Q0XL 4FQLH 3S36L 3IDJA 4ODBD 3SO3C 4MA8L 4PV9A 2K1MA 4ELKB 2Q3ZA 1FO0L 5CINL 4NKIL 5F3HA 3VFTA 3PGDB 4KVCL 5CHNB 3DVGB 1I9IH 3BYYA 5EPMB 5L7XH 4KY1L 3H7BB 4WO4D 3DX6B 1I7TA 1NLBL 3OKNA 4U3CA 5C1MB 2G75B 1SJEB 4AM0B 4PJFF 1IGFL 1MCBA 1U95B 1FZMB 3GFUA 2IAMA 4JZJC 1V3MA 3UO1L 4D0BB 3BDYH 1RJZB 2IGFH 2VL4A 4WEMB 1NMBL 2YPLD 1JF5A 4P2QD 3DMMB 2D7MA 2ZJSH 3FB6B 4OM0L 4JQVC 5IBTL 1YEIH 3VCLB 4CJ1A 4GMSL 2MSPA 3O45B 1EEZA 1BIIA 3UDWC 2FEEL 4K3EL 4MNQB 4PJAB 5BXFB 3UEZA 3KLHD 4C57C 4HUVA 5EBLB 5BRZB 4E41A 2BRQA 4PJCB 1U91A 5A3IC 1KTKE 3BRGC 1VHPA 2QQNH 4LOUD 1I1AD 5FECA 1FVCB 2Q8AH 3VMPA 4YEFA 1QYGL 1QFWM 1CF8L 3KYMB 4ZDHA 2VDQL 3OPZH 2AW2A 3EYUH 3LSOA 3HNTL 4J8RB 1OAQL 3OR6B 5HGDA 4PJDF 3TGXA 4GW5A 1NBQA 4HIEA 5FKAA 1VPOH 5DRZB 5IJKC 2VH5L 5C0GB 1RD6A 1NGYA 2IMMA 3DUSB 1CFVL 2WBJD 4OIBA 3ZT5A 3QDGE 5H8DA 4AYFA 5HI4C 1VDGA 3CU1A 1GIGL 5KZCB 3I85A 3UPCA 1AQDB 4OBSA 4J1UA 1A6WL 4OIIH 4PY8I 5FGRA 5A2KH 1MHHA 1VGKB 4YXHH 1LEIB 3VMOA 1KIRB 4UDUB 3WFBL 4S1QL 3MNWA 1YJDH 1HZHH 2G60L 3KGRA 2JCCF 3GSNH 3S96B 3PDGA 2R0KH 5GS0L 4JHAL 4OV6F 4Z7WE 4KK5C 1NFKA 2R0KL 1DR9A 4U1MA 1LEIA 3T0ED 1MLCA 1DANU 3PP3H 1QLFA 2YPLA 1IQDB 4ZQKA 1T7YA 4NWTL 1E6JH 1WTGT 2CDFA 2XXCB 4DZBA 5I15L 4U2YA 4Q9QL 3BP6A 1AKJB 2HFTA 4KRPD 1FZJA 1IQWH 3SCMD 3DPBA 3HAEB 3HC3H 3NZ8A 5J12B 1DVFD 1EBPA 4NM8L 5DMKB 2X70A 1RHHB 2YPLB 3QWOA 4IHOB 4D9RE 3FHQA 3LEVH 2VE6B 3NGBC 3TJEL 3BZFA 5HYJD 1X6NA 5F3HB 3L95A 1AO7E 2IBZX 1RIVL 3JV4A 3QDGD 2W0FB 1UJTA 3MRMA 1Q72H 2F19H 3MGOB 1KB5L 3U30B 5EC2B 1FAKT 4MJIE 1QHOA 3CCHA 1F3DH 1Q9KB 2R9HD 5KSUB 4KMTH 4FZEH 3OB0K 1KB9J 1QYGH 3IU3A 1OCWH 2BOBA 4WUUD 3ARPA 1FP5A 2XRAL 4L8SB 4M48H 2XY1A 5B3NA 4WFEE 2EYSA 1EMTH 2A6JA 3QEHB 3O81A 5JXED 1LK2B 3CCHB 5JMOC 1ZLUH 2NY0B 2FJHB 3TYFB 4ZPVB 3IDYB 4PJCE 2HT3C 3W5MA 4JFYA 2IADB 3KPMA 4F37K 5EBLA 2OP4H 3HNSL 1FGVH 4UTAL 3NCYP 2GITB 2UY7A 2WLZA 4OGAC 2R9HC 2P4AB 2NPLX 4HG4J 2YA0A 4OCLC 1KG0B 1QG3A 4ODWB 1DBML 3FFCD 2YD5A 5FCUL 3RTQB 3S3PA 2DLHA 3BJ91 3MACH 4PJ9A 3EOBA 1A3LL 4ENEC 4LKXB 5HYFA 4YHML 4MCZA 3Q3GB 4KROC 1D5IH 1G9NC 5JNYA 2NX5E 5JUEH 5KN5B 2NY5L 4X7EC 4AIXA 3GSRA 1LVEA 2ZP0T 4MA8H 5KSBB 5F70A 3PQYA 1Q9WB 4NN6C 3AUVA 3QJFA 5JHDD 4FNLH 4UAOB 3ZL4L 4LLWA 2MHAB 5CBEA 4HMCA 1ZHLB 4AEHL 2OR9H 3AGVA 5IBLC 2BY0A 4FRWA 1A14L 2OX5A 1CI5A 2IANE 2ZPKH 3I75A 3SDDC 3QI9D 5FYJE 3LDBC 1MJUL 4KTDL 3CVHH 2GK0B 3WHXB 4P4KA 4FN0A 2R29H 5BZWB 4NO0B 1YECL 1J0KA 1NC2B 4W4OC 4YJZL 3HAEG 3D1MC 2EEBA 1KTLA 1MCEA 5F6IC 1QRNE 1M6OA 4TULL 4M8QB 5E56A 1NGXB 2CDFB 5D7SH 5SV3A 1G6RB 4LHJB 1NDGA 4X0KA 3KWWB 5GHWL 5AZ2H 5A2FA 2FBJL 1JFQH 5JW4N 3IDIA 1GGIH 1KTLB 1X5GA 1PKOA 4KI5D 2FEEI 2YMXH 1G6RA 2AK4A 1ORQB 4O2EB 1U2HA 3B9AA 2WWKO 3JTSB 1A6TB 4NZUL 4WWKD 1WWBX 1I1AC 4OB5L 4EEEA 1KPUA 1BECA 3IDIB 3KHOA 3NZHL 3IFLL 1JZ8A 4KHXH 5IROA 1PY9A 4G6FB 3ARGD 4LASL 1Q9KA 3T2NH 2HT3D 4CNIA 2C3VB 4I0KA 5IK3A 2BMKB 2DQIH 1U0QA 2GK2A 3MMEB 1YEFH 3O2DA 4HUUA 4M7KL 4GW1B 5CZXC 1E28A 1BOGB 2V2WB 3VGFA 3C8HA 4OLVH 3RWGB 4X6CE 1WZ1L 2VDKH 3OJDA 4M7KH 3KXFE 4P2RD 4Z95H 1FNGB 2FR4B 5LGKA 2GJ6B 1GL4B 1MIEH 4N68A 3QYCA 2NYYC 1M05B 3LN9A 4QY8A 1PEZA 1G9EA 2L4OA 5SX4H 1OAKH 2JIXA 5DD6B 5BS0E 1EZVY 3VXSB 5E2UH 5T3XH 2YXFA 1NLBH 3ABZA 3MNZA 3VI3F 1P6AB 5JW3L 2X4SA 4FQXA 3MCLL 3IKCA 1JE6A 2X4UB 4HJ0D 4V2BA 2VLJB 3CC5B 4QY8B 4R4FL 4BZYA 4KKNA 1C12B 1MFCL 5E08L 5I8KL 3EJZC 1QSEA 3MA9L 2IBZY 5GS3A 5J6HB 5JZ7C 5L6YL 1IKFH 4Y88A 5D7SL 4DZBB 4M7LT 4HIIA 2YD2A 1UCBL 1YEFL 2Y1VA 3P4MB 4HPYH 5C0AA 4NRZA 2AK4D 1KLUB 3U0WH 3F58H 1MCWM 3RI5K 3QR2A 4NCC1 4XB7A 5ICYB 1MHPH 1G9MH 4PRPE 3TVMB 4M03A 4OF0A 2BOCB 2DQHH 5IHUL 3LKNB 3TBTA 2C5DC 1CS6A 5IESL 1YYLH 2AI0H 3LV3B 3FRUB 1T7ZA 2NZ9D 4N8VA 3QUXC 3GIZH 4B53A 4GW4A 4HHAB 2H1PH 4IRJC 4PTTB 4R2GC 3FO1B 1U8MA 3QI9A 4L8SC 2Y23A 4DGIL 4I3GA 2DI8A 5L7XL 4M9OA 5D5ME 2XOTA 1JZ4A 3GJFK 3BGMB 4JR9L 5L9DL 5CD5D 4H25B 1NJ9A 1I85C 1UM5H 2IGFL 1MHCA 2PTUA 3IFPB 5I1JH 3MRRB 1I75A 4LBEB 4QXUL 3GM0A 3MCKA 1OVZA 4PP2A 4FXKA 2HLFD 5D7KE 1NKRA 3MACL 3MR9B 4FP8L 3F7VB 3L7EA 1QBML 3OR7B 3O3AA 4L4VA 5IB4B 4Z6AT 4EOWH 1D5ZB 1UB6A 2W1NA 1MPAH 4XXCA 5BOZG 1A14H 2XTJD 3EO9L 4FFYL 4FABL 4HUKB 4ODWA 4PP2B 3O6KH 5BXFA 4U2ZA 4LLMA 3OR7A 4WWKA 1CGUA 3VXUE 3FCTB 3N50A 3NIFF 3MUY1 4MCYB 4OD1L 4WJ5B 3N85H 1XZ0A 2PUQT 1H15B 1S9YA 2JE8A 4JG0H 1MCHA 1V5JA 3RKPA 2G5BA 5FUZH 3RWIA 1I3GL 3BKYH 5JW4R 1NLDL 3VI4F 2HN7B 5KSBA 4X5WA 2VR4A 4KC3B 4ZTOH 2A6DB 4X7CC 4MMXC 3P73B 4Z7UA 1J9CT 4EI5A 4P4RB 5BVJB 5F6HI 4HMEA 4JZOB 1B3JA 4M1GL 3FQXB 3QO0A 5I1EL 2NY3C 5HYQA 8FABB 3B5TA 4RMTA 3QIBB 4YFEA 4UB0L 3MV7E 1SYVA 4Y4KD 4PJXF 2A83A 2AQ2A 4NHCL 5I73C 4IS6B 1BVKA 3L3HA 4JPVL 5DR5H 1NFDB 4P5TC 1FE8H 1N2RA 2XTJE 3HS0A 5K9KB 1PW3A 2BERA 3QCUL 4PYGA 4U1LB 2E27L 4X6BB 4K55A 1OD9A 2JJWA 5DVMA 5KVFL 1CD1B 3GZKA 1NUFA 3LD8B 1S9XA 1MEXL 3E1F1 5DQDH 3VXUD 3CFIC 2AV7A 2VIRB 1QBLL 2DQJH 3TT1L 2ITDA 4I0PC 5DEFA 4DVRL 4PJBF 2DJUA 1PGRB 3V7AG 1YY9D 4K71C 1KB5H 2J5LC 4NFDA 3WJLA 4BK5A 5I75B 4MSWB 1P6FA 5EH1A 1D5BB 1B90A 1UWXH 2VYRE 4FQJL 5IJVB 2J8HA 3JTSA 3U7WH 5ITBL 4TSAL 2FLBT 3F7QA 3H3PL 4OCSH 3SE9H 3T4AB 2W59A 2YD4A 5EU3B 5T5NF 5TFSL 3DV6A 1UXWB 2X4RA 4NO5A 2X89A 1XGPB 4CVXA 5IGXH 5DTFB 4JM2F 4PRDA 4Z77A 3MV7D 1OWWA 4L3ED 3BOVA 4U6VL 3SJVA 4UTAH 2PTTA 3FN0L 3VXTA 3K2UH 2WINA 5IMKA 4A2LA 5IHZA 3ZYZA 1RJLB 1FE8L 3PHSA 4YDIL 4U0RC 5DA4A 1RURH 3MCKB 2DBJA 5T1MB 1DBKL 4K3EH 4U6XA 2BOBB 4M7JH 4TOYL 5H94B 2JCCB 2GJ6A 3SJVB 4GG6B 2X1OA 3GIVB 5C0IA 3F6IA 3IRZA 5ELIA 4RDQG 1RJLA 3D85D 1XR8B 1RZFL 3Q1SL 4OTXL 3K2MC 2BVQB 5EIVA 5EU6D 5GRVL 1JF6A 5KW9H 4UILL 1OTSC 5J0BA 2ZG3A 3FCTA 3HB3D 3ARYA 4XPGH 3OKLA 5JIIA 2VDMH 1D9KA 2H41A 1F90L 4HUXB 5DDHA 2ILLA 1P4LB 5F9WC 5B21A 3L3DB 2PO6B 5I18H 4P3DB 1KCUH 2PO6D 1CLCA 1IAIL 3T08A 2O5YL 4JZOA 5FGBA 3RIAF 1P4LA 3RU8H 2X10A 5JQHC 4FP8H 1L7IL 4DGYL 2LAGB 3WFEH 3OKDB 2CXKA 1YJDL 4H5SA 1AGDA 1NC2D 4U1HB 3VXPA 4HC1H 3TBVB 2Y07H 2V7NB 5FFLA 1U3YA 5EU6B 5ECJE 4HPOH 5HVHC 3B6SA 1A0QH 3PP4L 1OTUC 2X9WA 3O9WD 3B4NA 2DS4A 4LAQL 2LVEA 3ULUE 2FJGB 4JEGB 5DYOA 3C5ZC 1SY6A 3QQ4B 1OP3K 4HWBL 3GSNL 4C59B 3IFOA 4K7PH 3RL1A 3EFFB 2XWBB 4HWZA 5IROC 4XHQA 3WNPA 1BF2A 5CCKL 1HQ4A 1HKFA 1B4JL 1PJ9A 1DUZB 4P23A 1DL7L 4KK8C 4LSDA 3I6LD 3C9NA 1AIFB 3FTGB 2OTUB 4NKDA 2AGJH 1T22B 3QWRD 4OLYL 3B9VA 2H8PB 4PGDB 4XHJD 5TE6L 4YHYC 1XT5A 1RFDL 5AZEH 5D70H 1H5BA 1JCKA 4DGYH 5IM7A 5HSFA 1EJ6A 4NNXA 2GAZA 3RAJH 4PJ7E 2HJLA 1K4CB 1RVFL 2R2CA 4HULB 1YPZB 4G6JH 4JVWA 1ZSDB 3DSFH 2O5XH 5D1QB 3ZT6A 1GVIA 1W72A 1H5BB 4P9HH 4PRHE 3UO1H 1GGYA 4L8BA 1UWGL 1NMBH 3PWNA 3RFZC 5C0IB 3T0VA 4HUUB 1G7HB 2FECL 1P84J 3VFMB 4Z7UB 4E0RB 1AGCA 3UAJD 4TUKL 4UUJB 1UADC 2LFGA 5FA4A 3MRLB 1IGML 3QEUB 4MGXA 1NSNL 4L4TE 4F9LA 1XCQA 1DQDH 4OKVB 4TN9A 3WUWA 4S1RL 2V9TA 4WFFE 5T5FH 4U05A 4Y4KB 5DHVB 5EBWA 2NY1B 4ODSL 5DHVH 3MV9A 1HSAB 3OKKB 3TT3L 2CGRH 3SDYH 1MVFA 3WV0A 2IBBA 2Q7NA 3SHSA 3NCMA 3HR6A 1IKNC 4MA7H 5C0CD 2VIRA 5K9OB 4LCYA 4RGNC 4PJEB 1V7MH 3V7AE 4GAYB 4TVPE 4ZSOB 4MXWH 4H8WL 2VXSH 4RFOH 2JB5L 1F3JA 4I3SH 4HBCL 1XGTB 5EUKA 3BPNC 1IGMH 4GUPA 2B2XL 3U46A 3T4AA 1YEEH 4QYOA 1JMZA 1ETZB 4P2OC 4GAYA 3B8YA 5C71A 1ERNA 5FO8A 3T1FB 2XZAH 4EJ1C 1QKZH 1F11B 3MXWL 4QYOB 5CP3A 5D7LE 5HY9A 3NCJH 4N5EC 2ATKA 2DWEA 3BUYA 2EO9A 3HC4L 4U6HB 1JBJA 1UKQA 3GIVA 2L0DA 3CD4A 2BNQA 2X4OB 1CQKA 1ZT4B 5EU7E 3KPSD 3U4BH 1QLRB 1ZLVK 3EZ8A 4UI2A 4RGNE 1T66D 2IALB 4XCCL 1KN2H 3P0YH 3VD4A 3OKYA 1E4WL 4JY4B 1UGNA 1AGFA 2R8SL 5JPMB 3ZMRA 4UINL 4P5TD 5D7JA 2BY2A 3VFGH 3UXFA 4FG6C 4BQ8A 1SMAA 1ZE3C 2EKJA 2DQGL 3BW9B 4PUBH 3VFOB 2ITCB 1FNHA 1NBVL 2ZWLT 1H9VA 1UVQA 1AGFB 2WQRA 4MQXD 1IEAB 4R9HA 4YXKH 1CDYA 4Z9KB 5ESQA 1U93B 5DJXB 3T0XA 2BVYA 1NANH 2BNRB 4LSUL 1S7WA 2Z31B 4N5UA 3BE1L 1KLGB 3QAZC 5IB2A 3NOIA 4GT7A 2XA8H 2OYPA 1QEWA 4AL8H 1CFNB 4IEFB 3BN3B 5ENWB 1MI5E 2UWEE 3QCUH 4CU7A 2WWMD 5IW1B 4GOSA 3ESVF 1KLGA 3ORJA 3HG1E 3UX9B 5IFJA 3OPZL 5HHPA 5L8JB 4U1NA 5ALBH 1JGDA 1ZLWH 2DQJL 3NGBB 1Y18B 4Y5XC 3VRIA 1FNSL 2BHZA 3PABB 1H3XA 3O8XD 5HJ3A 2DQTH 3HI1B 5INCB 5K9OA 3T2QA 4P2RA 3EW3B 2GJ6D 1QSVA 4WNQA 3ECBA 2YA1A 4Y1AE 3TBYB 4HJJL 3HC4H 2VZOA 1MFNA 3KXFD 1CDJA 4P2RE 5CZVH 3KS0J 2IQ9L 3GKWL 3T8XB 3VJ6B 1AE6L 2MJWA 4NM8H 3TLRA 4NM4L 2PW1A 1V7NL 3I6KA 2LAAA 3EYUL 4PGCA 5GIRA 1R0AL 1JHTA 4LLDB 3S35X 1R5WB 2BHUA 4JFFD 2H9GB 2C1OA 5IJVA 1GAFH 2DWDA 2EZ0D 5DEGB 1DQQA 2JB6A 1NCUA 3FQNB 3CDFA 2X4NA 3L6FA 4YE4H 2OL3H 3KYKL 1FGNH 4JKLA 1TENA 5F3BA 1EVTC 4FQQB 3NVQA 3U9UB 4QXUH 1BM3L 1KYOJ 5KVEL 4L5FL 5SWZB 4PRDB 4JY5L 5J1SC 2NW3B 3EHBC 4S1RH 2P5EA 5DVOA 5D2LA 1NFDF 3MODL 3RY6A 2Z4QA 3L6FB 3VXTB 5IHZB 5MP6L 3MRFA 4GJTB 3EO9H 4FFYH 3GMNA 2Y6SD 4OGXH 4MD0A 1DBAH 1T1YB 1WBYB 4MD4B 4PB9L 3DIFA 2BNQD 1F4YH 3FB7A 4W81A 3HC0B 3JTTB 5KAQG 1WAAE 5F7EH 4G8GB 4C4KO 1BHGA 2ZCKL 2ZUTA 1SM3L 3CLFH 1SEQL 3SE4C 4OT1H 3MV9B 3QCVH 4OQTL 5FGCB 3JTTA 4NOBA 4YUEH 1NCBL 5HGBB 4CVZA 5E8DL 5GRUL 2R1XB 1OGAB 3FJTA 3VMNA 32C2B 1Z3GL 1BD2A 2Z31D 1I4FB 4F3FB 1J0JA 1TMCB 3MBEA 5I0ZA 2UVFA 4QGTA 1G7MB 2FO4B 3HZYB 4GRLB 1KIPA 1UWXK 1CDCA 4PY8J 4BQCA 3LHPH 1F4XH 4F7PB 2VN4A 4U6TA 5CJOH 5IFJB 4UQ3A 1XGTA 3D9AH 1QRKA 2X42A 5GS2D 3MNVA 5T3ZD 2DLEA 1FG9C 4DCQA 3BP7B 1ETZA 4XBGA 1PD6A 4YHPA 1OARL 3G6DL 2F58L 3PABA 1UENA 4P3CH 43C9A 2W9EL 3P40A 3TIDA 3B8SA 1G6RL 4OUOA 3QXVA 1CDHA 1U58A 4OFIA 4GKNB 1F00I 4O58H 3VGGA 5J6GA 1J8HE 4GFTB 4PGBB 4DJMA 4RAVB 5CJBA 1OPGL 1KIQB 3E2HB 5AG8A 4O58L 1B4RA 3KPNB 4YDVB 5ESVB 1CGYA 1KPRB 4FQJH 2W38A 5GS0D 3U0TB 1FFNA 5KSAB 3QEQD 2YUZA 3RL1B 5CKGA 3CX5K 1DBAL 5D7LA 4JM4L 4PB0H 1MCQA 4XNYL 4TUJA 4N1EA 3V4PL 5TH2B 3PJSB 4XPFL 1JPTL 5CJXC 3C5SB 1QSFA 4JN1L 3CFCL 1J11A 1HDMB 3A6BH 4NSKB 4XCFH 1N59A 1AXIB 3NZHH 3BX7C 3NCFB 3U7YL 2CJUH 5EUOE 1ZHKA 4N9GA 4GAFB 4F9LC 3AS0A 4IJ3C 1DDHA 3LEYL 1UM6L 3UCRA 1HDMA 4PJXA 4JHWL 4LMQE 4F2MA 3S35L 4KGJA 2BNRA 2VZUA 3RBSA 4DAGH 4JHZA 2EC9U 3C5JB 5FA3B 3FQUB 4U7KA 1NCCH 1YQVL 1BVZA 3T0EB 5KG9A 5FO7A 4HWBA 3Q48A 1XIWA 3V52H 4IMKA 4EN3B 4DWHA 2VLKA 1CE6A 4PRID 2ZCLH 5F7LB 2FX7L 3S4SB 4JM2C 2O93L 1RMFH 2IAMC 4JZJA 5C7XL 3LKOA 3QEUA 2VC2H 5HHPB 4QHKI 1JGDB 4J3OC 5AZ2L 2AK1H 1CL7I 1KIUA 5ANMB 1AQKL 3Q1SH 4P0DA 2VLKB 2OLDA 2CDGA 3ARFC 2MPAH 4PG9B 5KZCD 4CDGC 2CRZA 4M6AA 1KPVA 2PCPB 1C1EH 2PO6C 5GGQH 5IIEB 3K1DA 5T33L 5I71B 1WFNA 4N90E 5KSAD 3L3GB 2J6EH 3K4DA 4F3FA 3I9GH 5FDWA 1HOCB 3MFFA 4LSPH 3BP5A 1T89C 4WEUD 4XNXH 4PJIA 2V5SA 1I7RA 3ZDYE 1MFDH 3PE9A 1R5IA 1UXSA 1KSRA 4XC3H 2FO1A 1E27B 2B1AH 4NZDA 2C3XA 3OX8B 1BQLH 3F12B 3P77B 5ISZE 2E7HA 1QPXA 4OZ4B 1VKXA 3RVWC 4JGUA 5GS1A 4LSUH 4MVBC 2YS4A 2B4CC 4EQ3A 4PRIE 3V6OA 1C16B 1DE4B 4X6FB 2D0GA 4NKQB 1X6LA 3MRQB 4OLXH 4Y4HC 1GOFA 5B8CC 5ESVA 2W9LA 3DMMD 2OZ4L 3T1FA 2D03L 4O9HL 2BCKB 4UINH 4XRCA 3SDCC 1HI6A 1MREL 1I9RL 5T33H 3RY5A 3VFRB 3BSZL 4S2SA 7FABL 1KCSH 4IRZL 2XPGB 2J6EL 1FFQA 1RUPL 1IILE 1BBJB 4MWFB 1Q9LB 5F1IB 2BCKA 1BLNB 2Z91B 3ARRA 2DMCA 4CVUA 3L5WB 1RZ8B 3GB7A 1RK1B 1YMHA 3AM8C 3AAZB 2EC9T 2DM2A 4UBDD 1CFQB 3DVNA 3JV6B 1MRDL 2XWTB 4ZXBB 3ZO0A 4N9GB 3UTTA 3KJ4C 1C08B 4RQQB 3CFBB 3LEXA 4U1JB 1BLNA 1FLTX 2HKHH 2Z91A 4TNVK 4M6OH 3LN5A 1OAXL 5JLZA 4D0DB 4R97C 2CKBL 5HI4D 2AP2A 1UACL 2JJTC 3GSWA 3OKMA 4XXDB 3SQOH 3HNTH 4DZ8B 2J2ZA 4RCAA 4CL7A 5DFTA 4GSDL 4EIZC 12E8H 2DL2A 4OCYH 1NLDH 2MCPH 1VB9A 2YRZA 4EN3A 2A9MH 2BXZA 4OLZL 2Z31A 3WN5B 1X4YA 4WHYG 3CLEL 5D71H 3MRKB 1NFIA 4MJID 3BWAB 4CN6A 2BSRB 4HF5H 4X8XA 5I2IA 3P4OB 4CN4A 4GAJH 4XP9H 3BKML 3VXMD 4QOKB 1R3IL 3WFBH 1LO0L 2CDGB 1CTNA 5C0DA 2NY3D 2YEZA 4PR5B 3H8NA 3P0GB 3R06B 1MWAB 3BWAA 3EO1B 2JELL 5L8LB 4WUUA 3R1GL 4PJ8D 1KXVC 5LAXB 1OF2A 1UJ3B 1Q0XL 2H3NB 2W0KA 1A6ZA 1WCBA 4WRLA 5EZLA 5CGYC 1F58H 1PLGL 2A6IA 2VDOH 3D0LB 4JFXA 1KPRA 2HJFB 2VSCA 1MLBA 5TF0A 2N56A 2AJXL 5IESH 4YHOH 5FYLH 1MJJA 4PJHE 3RZCC 1I8IA 3VH8G 3PGDA 5CHNA 5EZLB 5DGQA 1P7QD 2FD6H 4OZHE 2RCSH 4OGZA 2F8VA 4WO4C 4JG0L 3TO4B 3GJFB 1DANT 3Q2CA 4P2OB 1BWMA 2Y25A 4DTGL 4YPGB 3BZ4A 4LDEB 4PGCB 4NZTH 5C0FB 1AD9B 5FB8B 3K8KA 4WV1B 5D4QA 1BD2D 1EO8L 4LIQE 4P2OA 4LNRB 2JF1A 1NDMA 2E7LC 4MQSB 3PUCA 3MUJA 3VFRA 5E9DB 4MHHI 2CDEB 4X6EA 5SWZA 1YEHH 3UJIH 1TETH 5IW6A 1U3ZA 4HXAH 4H0GA 3IVKB 1WT5C 2GSIA 3WS3B 4NO3B 1FYTA 3IU4L 3W0WD 2D7QA 2XWTA 3ARVA 4CVWA 4LQ1A 3IGAA 3T3MF 1UA6L 5I75C 4YHKH 4YWGH 5TDOA 4GKZB 5BVPH 1FYTB 1RIUL 3H9SB 1OQXA 4XXDA 1FL6A 5SX4I 3S37L 3OG4B 1FVEB 1IAOA 3IDNB 1IGYB 3NCBB 3UJTL 3V5KB 3JWOC 3FO2B 3MNWB 3MBXL 4I77H 4PJIB 4OCRH 4JO1L 2EH8H 1JGVL 4ZO9A 5LWYH 1I4FA 1HHJA 2O26U 3V5KA 2Y5EA 3BO8A 5SWQA 4I18C 3LKQA 1A6UL 1AP2B 1DP0A 5IEHB 4F7CA 1YY8B 1QVOB 1NANI 1U92B 4I48B 5I18L 5DD3L 5CJ5A 1NBYB 1A7BA 2FGWH 5F96H 3NTCH 3MRDA 3QNXB 5B8CB 4PBVC 4PRAA 5GGTA 5D9SA 3VH8B 3OXRB 1AP2A 4M6OL 5AAWA 1RUPH 3KYAA 2ICCA 2YZ1A 3QWOB 1QFOA 4YGVA 2AQ1A 2J8UE 4BM7A 1G7LA 5CEXA 4CADB 1MLBB 1VFMA 2XNAB 1S9WA 4C83A 4IIQA 3FZUC 2R2BB 1G9NL 4NQXB 1T1WB 4Q9RH 4WO4A 4OGXL 5IW3A 2BVPA 3IJYB 4RDQF 2JIXD 4IRSD 3MRPB 5I1AA 5EZOL 5C0BE 1OTUD 5E24E 2YPKA 3LCYA 3D25A 4HQQH 4JJ5B 5LJYH 1I8LC 1FBIL 5FYKD 2M2DA 1OQOA 3O6LH 1JGEB 3SGKA 3U9PH 4C83B 1FFNB 1NEZG 3EIFA 4DN3L 1S9KC 3DVGA 1YMMD 1U3HB 4YR6B 5DWUH 1JYVA 4N0UA 1CU4H 4H1LG 4ZXBA 4XNMB 5TH2A 5JXAL 4HCRA 1J05A 1MOEA 4LASH 5GRZA 5E1AA 2OSLA 2QLVB 5DJ6B 1HCVA 1ZT7A 5AG9A 4YBLB 3P9MB 2HJKA 3I3BA 3MC0A 3UZQA 1I7ZA 4F7TB 1BIIB 5JTWA 2GT9A 4PJXB 4ZFGL 3RTQA 3ROLA 3GSNB 2P1YA 4KRPC 2ZUQB 4F15B 1T5WA 2QKIB 1MJ8H 3B43A 4QKXB 3C5JA 5FA3A 3X12A 4XNZC 4JLRB 3PGFH 4ZUVB 4XP6H 3DRTB 3DTXA 4HEPG 4KKLD 1OTSD 4HKJB 4IMLA 5H37H 3WS6C 4XBEL 3QIUB 5JPNA 3TPUB 2DRUA 5D93C 2R8SH 1ZS8A 1JRHH 3O3UN 4PJFB 3LKSA 1FYTD 3D18A 1AC0A 1YECH 1CE1L 4YNYA 3DXAB 3HA0A 3V5DB 1CT8B 4CMMB 5ICXB 5F8RC 1YMME 1SHMA 2WBJA 3GMLB 3ELAT 4YIQA 1AFVL 1SBBA 1L7TL 4PJ8A 4RZCA 2QEJA 5DJDB 3ULSB 5D8JL 2PCPA 5CEZD 1CBVH 5B38A 3RGVA 4O4YL 5DJAA 4XVUD 4MQ7B 3VXUA 3MV8B 3BRFA 4KUZH 4LSVL 1JMXA 2P48B 2EE2A 2W65B 1N3NA 4PJ8B 3LKQB 4K3HA 4XVSL 4UDUA 2YRLA 4GBXA 2F5BL 2YN3A 1NGXA 4QLRA 4YHNB 3QUXB 2RAMA 3U6RB 3TZVA 3RVXD 2FDBP 3KPTA 1MQKL 3F5WB 4XP6L 2BNQE 4LOUC 4OGAD 3MV8A 1ZVHA 4R7NA 4J4PA 4WW1B 4HFWA 3TNNA 3QQ9D 4Y7MA 1DEEB 1F2XK 3LEYH 3CFKA 3TVMC 1IFHH 3GNMH 1PG7W 3TPKA 1RAMA 4LCCB 4JFPB 3WIHH 1CVRA 3CXHJ 1RK0A 3AY4C 4X9FA 3SGJA 3TEUA 5HYJE 3X3FL 4I18A 4JJHA 1XF2B 4PJBB 3L3OA 2EYRB 4HGWA 4HKBB 1XF4A 5CSBA 2C3VA 5IK3B 3RWHA 4OZGB 4KKLC 2X4QB 3TJHC 4XX1E 5I1KH 1F42A 3ESUF 1IGJB 3RIAK 4KKBC 4OZHA 2K3TA 4P23D 3MXWH 12E8L 3B2UD 5JMRA 3SO5A 2GTZB 5E1AB 2PXYC 4QTHA 3LIZH 4WHCA 2DI9A 2VXVL 1P2CA 2YRPA 3U79A 3LZFL 4WI9A 1RK1A 2ADFL 4JB9L 3FB5B 4QRQA 1J86A 4JM2B 4NNPH 3HG1A 3QB7C 3QUML 1H3PH 4JPWH 1M7XA 4LGRB 4MAYD 4S11A 2OCFD 4IOSD 3DROB 1U9KA 1CL7L 1ZHBB 5E2WH 1T0NA 1L0QA 4K9EH 4GMTH 1BBDH 4DOHE 4UTBH 4UOW1 1NCTA 5C08D 5IR1A 2MNUA 5JDJA 3GSWB 1LP9A 2FEDD 2FGWL 5F96L 1N6QH 1NUGA 2X1XR 3DRTA 4ZXBC 2ICWJ 3F58L 5DD5L 5CEZL 3T77A 4L1DA 1LDSA 1MHPL 2VLLA 4E41D 1L9NA 1NL0L 3PQYD 3TCLA 3QIUA 4FQCH 1KIRA 3B2VL 1HSBA 3T4YA 3EOBB 1LP9B 1YDPB 4R4BB 2W0LA 4XP4L 5JOPE 1BFTA 1A21A 3MJ6A 5E6ID 3UTQB 5ICXA 4ZAKA 5C0AB 1RUAH 4NQCA 4QT5B 3LD8C 4YUEL 5DQJA 1KEGL 1OD7A 1N6UA 4P4KD 1ACYH 2Q87A 4BQ6A 4CN1A 4J12A 1T0MB 4HJGA 4PY7A 3GMMA 2BSSA 3BD3A 1T1WA 4G6AD 1FCCA 4LVOB 1BQLL 4G6MH 3NAAL 3MA7B 4JFHD 1WLHA 4GKOA 1IC1A 4WCYH 4YAQB 3STBA 4HDIB 1NC4D 3PWJB 4JFDB 1RJZA 5D2LE 5MI0C 2W0FA 5EFIB 3Q6GH 2CLVA 2CLRB 4UV7L 3TNNB 3NFNB 4IOIA 1YUHA 5DD5H 5CIPA 4JFEE 4PJEF 3IU3B 4FQHB 4LSSH 5C9JB 4D3CL 5F6IB 2C4XA 5AYUH 3ZSSA 1EO5A 1VFOA 1Y0LB 2ESVB 3IDXL 3VFTB 4XP4H 4BFGA 3QP3A 4C56E 4YE4L 2IQ9H 5JOPD 5JW5B 5IBLD 4Z5RB 1SMOA 4TQEL 3O41B 3EYSH 4J7RA 4Z0XB 4I2XE 4KRPB 4F7TA 5J3HC 4N8PA 1SJEA 4AM0A 2YOCA 4C56A 4HGWB 3QBTB 1Y0LA 2ESVA 5BQ7A 2VLME 1P7KB 2ZUYA 5ACLA 4M7ZB 5CP3H 2IJ0C 5E8OA 1JPSL 3CFJB 3T0EE 5HGDB 3T3PF 1OSZA 1UCTA 4POZD 3PHOA 2HLAB 2G5BB 3IVKA 1PKQE 3A67L 3BN9D 3NIDE 1ZGLP 4XTRD 4P23C 1SVZA 3DO3A 3O4LB 2C3WA 2Q86A 2VXUL 1IC4H 1MFEL 3V5DA 3FMGL 1HWGB 5LQBL 4P4RA 5D7IE 1IRAY 4NC1C 5HVWA 2VJXA 2WBJB 2R69H 3RVUD 4ZG1A 5IMOB 1OTTC 1XH3B 4CW1A 1GC1H 2BVTA 5ILTH 2CKBA 2D0HA 4XPAH 1JRHL 3TN0D 1K3ZA 4DK3A 5LGJA 4OD3H 3JWDC 3FT2A 3BEVB 2CR3A 1JWMA 5FAAA 1ITCA 1A5FH 3T0DA 4LQFL 3V0WH 4CW1B 1AJ7L 4X4YB 1JNNH 1IQDA 4U7MA 1J1PL 3OB0H 3SE4A 2H32B 3B9KD 4E42A 4R0LB 5TE4L 4EI6B 4MA3A 5T1LA 4H1LH 1NC2A 4HFWB 4KVNH 3BO8B 5SWQB 5TE4H 1AGBA 5LVEA 2VXVH 4P5MA 3V6FB 2BY3A 4YZFE 3H0TA 3SGKC 2F54D 3B9DA 2OZ4A 2NTSP 4JRYE 4P9MH 4JFZH 4XI5D 2AJSH 3C2AH 1KLUA 1AXSA 2AS5M 1MLCB 1LP9E 2ESVD 2APVA 2VWEE 2D4FA 2HP4A 3MLRH 5FCUH 1OGAD 2CQVA 3BP6B 1GC1L 3HFMH 4J3SA 4X6DB 4X4XA 1IM9D 1HQRB 4FTVD 3UROR 2D3VA 3CH8A 4G6JL 4M62H 4Z77B 4HQQL 4WO4B 4JPIB 4NYLA 3WIHL 2VDNL 1RHHA 3MRPA 4HHAA 4ESKA 3H9HB 1G0DA 3ARFA 1INQB 4MA1C 3I2CL 1CFBA 2D7OA 4UOJA 1JGEA 2B7DT 1BJ8A 3BZFB 2BZDA 4JFYB 4NQTA 2C7UB 1HILB 2DD8L 4B0MM 2FX9L 5K33A 3OJDB 1HEZB 1WICA 1HILA 1P7KA 4WI6A 4HLZH 3BSZH 4G9FD 3BRDA 4YHLH 4OSUH 4AEEA 5E8OB 3MJ9L 1FQ9C 3TT3H 3V79C 1CU4L 4HUXA 4ODTH 2AEQL 4HK0B 5DZLA 1MIML 4NBZB 4FFZL 4BZ1H 3VFNB 4N0FA 5L2KA 2VR5A 5GS2H 3DGCR 5HGHB 4KRLB 2VRAA 3VG0L 1RIHL 4FTVE 4XZUB 5IHBA 3GSXB 4X4ZA 3AS2A 4FQIH 3T0AA 1FFPB 1MH5A 5A3ID 5DHYA 1TQCC 1AXTL 3LN4B 4KKCC 1JK8B 3PDOA 3MO1B 4NPYA 4JO2H 1YN7B 4PB0L 2X1PA 3OKDA 3I75B 4YQXL 5JXEC 4U1HA 4NQCD 1IGTB 5I1DA 5JNYB 1EPFA 5KN5A 4XPHL 1N8ZA 3GMLA 4X9BA 4G6KH 5HI3D 3KPSA 5DUBB 5HYIA 1KELL 5C0CA 5ID0A 3LKRB 4JQXC 1XGYL 5DYOB 1EHNA 2WUBH 4IOFD 4OF7A 5DEZA 4L8DB 3WFDH 3QEGL 4GW4B 4JG1L 4CJ0A 1JHLL 4UIKL 5D70L 3UTSB 1RFDH 1JV5A 4PD4J 5D72L 1RZGB 3WFCL 4P5KB 5I66A 1L7TH 2I07A 4PV8B 4Z7NF 5C9JA 1ZLSL 5HYEA 4U1GC 2IAMB 4PIRF 4TNWK 3HN3A 1G9NH 3CMOH 4R7NB 2UWEA 3GMOA 1FJ1B 3RVUC 1KN2L 1E4KC 4RGMB 2X70B 3MTRA 1YEGL 5JO5A 5HD8D 1FZOB 1QLEL 2VDRL 3W2DH 1AI1H 5DJ8B 2CD0A 3HZMA 2R0ZH 1BP3B 3VD7A 1EEQA 1AQKH 1QTYT 1N26A 1F4YL 2UWEB 1DVFA 1RK0B 5I71C 2GUOB 4QHUA 4RIRA 3MA9H 3QUMH 4JPWL 2COQA 1QFPA 3CSBA 4HUMB 5D5MA 4Y5VB 3TBSA 2Y9RT 1SEQH 4Q9BA 4OZGA 3ZKMC 4PJ5A 3RX7A 3OAZK 2HMIC 3CSPA 4YFLI 4OLVL 1D5XA 2P24B 5ITBH 2L7JA 1HXMA 5IUSA 4GRMA 4X80H 3PG2A 1YC7A 5ADPH 4F57H 2FJHA 2BVOA 5IMOA 1XCQB 4OFKA 5IEKB 1OAKL 3B2VH 3MZTA 5SV4A 2M26A 3N9GH 4WW2B 3GUTB 3SE3C 3SKOB 1DZBA 3D2UD 3MLXH 1RZJL 3ARZA 4XPTL 2ZSVA 2A6KA 2E27H 3BEVA 3SDAC 2SEBB 1KACB 3TN0A 4CMHC 1RZJH 4G8FB 2VABB 2ZOLB 3QFDA 3OKKA 4PJ9B 3G5VB 2A83B 2D7TL 2ID5A 4MDJB 5C0BD 4GKSB 3W9DB 4HJ0C 3EYVB 4XNQB 1YYMH 1WZMA 1U8QA 5IQ7L 1WQVT 5KJRH 4UU9B 1UA6H 4NC2B 3ZLQC 2MCG1 1WIUA 3W9EA 3OAYK 3TVMA 3L1OH 4GG6F 3V0VB 5JW4M 5DK2A 3LKNA 2J88H 5DSCB 1SYSB 2HTLD 3DYPA 5HDQL 3NZ8B 1UM4L 1AGEA 5LXGL 3S34L 5DQJB 5H35B 4MSWA 3KPSB 2DQDH 4PTTA 2DM4A 5D1XA 1LHZA 2D4DA 5LXGH 1MVUB 4DQOH 4GRWE 1YNKH 4O5LH 4S1SH 2NY0D 1SYSA 5CILH 3SY0A 4NRXB 3U2SB 5EB9A 1MCDA 3MRMB 3MLXL 3RVTC 5EU6A 4WGVB 1A3RH 3IFPA 3DSFL 3ZE1F 4X8JB 3LVEA 4G5ZL 2PYEA 2ZPKL 5I73B 2I26N 2HKFH 4C58B 2D03H 4O9HH 2DQUL 3F7VA 1VFUA 3PWJA 4IRSB 4R4FH 3X11B 1S8DB 3O3AB 4L4VB 3BPLC 1H3GA 1FYTE 4RMSA 3H42L 5CJ8A 4PUBL 5FM5M 3OKNB 4TSBL 3GMRA 2AJ3B 4X9HA 2YKLH 4O2EA 4G3YH 3T04D 4BSWB 3GNML 4LCUB 1DVFB 1XIWD 3O41A 1QFUH 2PETA 4ODHH 4NNYA 5CEZE 4LBEA 2F53E 1MRDH 2YD8A 4LLYA 3SCMB 4KZEL 1FHGA 1S9YB 2OK0L 3NFPB 1CLYL 4NDMA 2AJ3A 5IM7B 4OD2A 3PNWA 1BPVA 1IEAA 4TVSa 5E9DE 4YQXH 1HIML 3QNYB 1CGVA 2AEPL 4QCIB 5E5MB 1MY5A 5DWUL 4KKAC 4XB8A 4U1KA 5L2KD 2M8XA 4GQPH 3K46A 4KHXL 4C54A 3NN8A 4OD2B 1A7QH 5E7FA 8FABA 4AIOA 3L7FB 3QEQE 3LHPL 3WNNA 2R69L 3CMOL 3VXRB 5C0AE 5I1LB 5GSVA 4EDXB 5T3ZL 1RU9H 3F7RA 4WJ5A 3CXDH 1X5LA 3ZTJH 3NPZB 1EXUB 2EZ0C 4MS8D 4V1DA 5DVNA 2OXHA 2ZSVB 1AI1L 3KLDA 4UIKH 3RWIB 4BFEA 1FRGH 3W11D 2ICES 3HS0B 4PGEA 2PYFB 3VGDA 1CL7H 5I1LA 3O2DH 1LO3H 4P99A 3CFDA 3VW3L 3D2UA 3X13B 4O2CA 5BVJA 4XNQA 4Z76A 3ZTNH 3MXVH 5GGSA 2VWEC 3A0OA 4PJ5E 3K3QA 3RVWD 1F90H 3B6SB 4DOHB 5JHLH 5T3XE 1I3GH 4QRUA 1CLYH 2VDOL 1SJHB 4J3TA 4MXVF 3BMVA 1ES0B 3GI9H 4QHMA 5KANG 5GJSH 3TJEH 4EI6A 1QSED 4RFEA 4X0KB 4OZHF 3RPKA 3TIEB 4MZ3A 5F9OH 4R26L 4MD5A 1JGVH 3DURB 2D31B 5BRZD 5LWYL 1SQ2N 1A4KA 4I0PD 4RX4D 2X7LB 5BV7B 5C08A 2P45B 1LWRA 2A2QT 3BGFC 4YFLF 1P1ZA 5HBBA 1FYHB 2UYLA 5C0AD 5C6TH 2RFXA 3TIEA 2R0WH 2UV3A 5C08E 5E2VL 4WFGD 3QUMB 1Z0MA 2WWMC 4K8RL 5C08B 2NX5A 1T7XA 1CDUA 4PJBE 5E2VH 1EZVX 1FSKC 3ARBD 4U7SA 3C08L 1AR2A 3OAZH 2BMKA 2D7PA 2FBOJ 4Y4KC 2NY2D 5BZDB 1MRFH 1D5XB 2P24A 3MLPA 1A6WH 4X7DC 1OAQH 3O6FB 1NCDL 1XIWC 5DJ0A 3BZEB 4LPXA 1QSFD 4JM2D 3MV9D 5FUOL 1EGJA 3IDUA 4P57A 5MHSD 1A47A 4NO5B 4MD0B 3RVVD 2BVQA 1EO7A 2FR4A 1CDIA 4NWUL 4XAKD 4JHBA 1IJ9A 4LHUG 2BNQB 2WINB 1J0ZA 2YSSB 3ARBC 3PL6B 5C0EB 3IF1A 3VG9B 1URLA 3O0RH 4PJ9C 4U1IA 5LBSH 4LF3B 1FC2D 4D0CB 1D6VH 3WIIH 2UUDK 1CR9H 5E7BA 1PSKL 3CK0H 2DB8A 2A38A 5SWZD 5MENE 2NY0C 1RZIA 1UEMA 4L4TA 3BAEH 1ZT1A 4MJIA 1DBBH 1JTPA 2EECA 1IGFH 1B2WH 3N1MC 3VFNA 1GSMA 3WO4B 2Q3AA 1ONQA 3VXRE 3MLSL 2R1YB 2FHFA 4I77L 3RKDC 3MRBA 3UPRA 5DD1L 3TNMB 1ZAGA 4N0YL 4NN5B 4RFNB 3VWJD 4PJ7F 4AG4L 2EIBA 3ZDZF 4RSVA 4C56D 4PJEA 1NUNB 3S36H 4XBEH 4OI9A 4M8VA 4ZTOL 2P5WB 3FOLA 2LE9A 3H2WA 3W11C 5HHXL 1OP5K 2D7NA 4LLQA 4OD3L 4KY1H 4KH2A 2DIBA 1PZ5B 4GQ9L 3TH2T 4XPFH 3VWKD 3VD3A 4X8JA 5I16A 4BQBA 5JR1L 4Q0XH 1NAML 1Q1JL 1ZVYA 3QQ3A 5E5RB 2AV7B 3I02B 3C9NB 3FTGA 4XPTH 3NH7L 1A4KB 4PPTA 1DBBL 4JO3H 5J56B 3E6FB 1ZHNA 3VA6A 4H0IA 4OGYH 2AGJL 1HH9B 4Y8AA 4DGIH 3WE6B 3MBED 2G2RA 2IH3B 1DQLL 5I8KH 4RWHA 6FABH 4G6ML 4POYA 4PFEA 5DJ2B 2XKNB 2YD3A 4HWEH 1WITA 5DJZA 3SGEH 4Q58C 4DEPB 2H9GA 4JRWA 5DO2C 2H2PD 4GRWB 4LNVA 1KJ2B 4OAWA 3AC0A 1UKTA 4PLJD 2ZZUT 3AREA 4NBYB 4Y89A 2CRMA 4U1KB 2VC2L 4LPCA 5BO1L 2J8UB 4KZDH 1BVLA 3MRGA 4HPOL 4KDWA 5T1MA 1YNTB 4HC1A 1WCQA 1TCRA 2BNUA 5H37G 1A6VL 2JCCA 4HKXB 3OGCA 3ULVC 3HC3L 3NABH 1X5JA 3PL6A 5D1QA 1OW0C 2I25N 5DHVA 2RHEA 5EBWB 2QR0A 4JO4L 3GM8A 3QO0B 3D3VD 1DJSA 2AJVL 4R8WL 4M3KB 2PYFA 2JELH 3U7WL 4P3WA 1EA9C 1GGCL 3MRNB 3EYFB 3GUTA 1GC1C 3G08B 2PXYA 4ODSH 2PYED 4LVNC 4U1NB 1HHKA 2B0SL 5JA8B 3CVHB 1CGSL 4OIIL 1RUQL 3ARDB 2IPKB 4XBPB 3NACL 1QOKA 5F1NB 3ZE2F 1UWEL 2YZ8A 1JFQL 4FQ1L 2AEIT 2F8OA 2CXGA 1JNHB 2ED7A 5DEFB 5BS0A 4J6RL 4AT6A 3MLYL 1KTRL 1CTOA 2P5ED 4JKPL 1ACZA 1PY4A 4KHTL 4YFDB 4LVHB 1TJHH 4MYWB 3BHBA 2CUIA 2UYLB 5ISZA 3P4MA 3QIUC 3HMWH 4JVPA 4PRPB 4XAWL 4XC1L 3ZHLA 3S8WA 2DQHL 2AJUL 5T1KA 4DN3H 3G5ZB 2FRGP 1I9RH 3O8XC 3WJJC 5FYKH 4JY5H 4XNUH 3D3VE 3B9EA 3P2TA 3NCYS 2DWEB 4HFUL 2C1OB 3IS0X 2WBKA 4GRWH 1G7QA 1JVKA 2RR3A 2HG5A 4S0TD 3SDDD 2YUWA 5FYJH 1EMTL 3QQ3B 1H3UA 1KFAH 3FO1A 2Z92A 4TUOA 2F74A 2PYEB 1D6EB 2XZQL 3V52L 5KVGL 3U0TA 3VG9C 2FCBA 5E2TL 3O3EA 3UTSE 4AEHH 2IEPA 2NQCA 2OL3B 3V6ZB 3EJYD 1CICB 1GZPB 3MRRA 2P8LA 1JL8A 2IG2H 3UTTB 1KN4L 3V4VL 4MD4A 5HHMD 2P5EE 3BGAA 5J06A 4BJLA 4NSKA 1G7IA 2V2TA 1A6AA 1MNUH 5E4IA 3LMJL 1C5BL 4WDIA 3RDTC 2WMPA 1QLRA 3CXDL 1DLHB 3L5XH 5FM5O 1WZ1H 2VDKL 3FO9B 1CFNA 1KEML 2PO6A 1T66C 1G7IB 2V2TB 4HKXA 1ROWA 4F2MB 2FHCA 4NQED 4N0CD 5E5MA 2VLJD 5FK9A 4LDLB 3IS1X 2GJJA 5IV2A 4BELD 2EXYD 3FO9A 2OR9L 3BD5A 1UVQB 3VXSD 4L1HA 3VXQA 4M1GH 3VXRA 1S7XB 4KJQC 5FHAH 4NZUH 5EORL 1JRHI 4PR5A 5CILL 1UZ6E 2YK1L 4Y16A 3UJJH 4XCYA 5HPMA 4NBXB 3RZCD 1IC4L 2KKQA 2OL3L 1T3FB 2ADJA 5IVZA 1EHLH 3MNVB 4P2RB 1EJOH 1UYWH 3E3QC 2V6HA 1X5XA 4M6NH 4D9QE 1BFSA 5F6HJ 4F33A 3L9RB 4PG9A 1HHHB 4ZTPH 5HHME 1A7OL 3X13A 4XBPA 1I1RA 1BVKB 4HLJA 3TWCL 4QRRE 3MRIA 5D5MF 2XWBA 3WDJA 1J5OL 1T4KA 2QQLH 1HOCA 4OZIA 1E6JL 5DA0B 4RWYH 3A6BL 1CD1A 4OZGF 4X5XB 3TV3H 5C2UB 4TTDC 4EVNA 2IQAA 3ZKXB 4Y5YC 3RNKB 1K8DA 1HHIB 4K3JH 4PJDB 3ECBB 2D31A 5E6ZA 3HMXL 2X7LA 1TTFA 4Q6IB 5C86A 3SGJC 4OZIB 2D2OA 2FGZA 1MI5B 4PLJC 5FHBL 1FDLL 1VFAB 1HN1A 2HRPH 4M62L 3RNKA 1MFCH 4R4NC 4WFHD 1DL7H 2P44B 1F2QA 1C16A 3MJGX 1QBAA 4ZPTB 3IU4H 3C6LD 4M5ZH 5JOEA 2BNRE 4DW2L 2J5LB 1UZ8B 3TA3C 2NX5B 4LKCB 1BZ7A 1OW0A 1MI5A 5EIIA 1T1YA 1TNNA 5J3HD 5EN2A 4L3CB 4D9QD 3HUJA 1P4IH 3EYQD 3BIBX 1B88A 4O00A 2DIAA 5HHVH 1GGCH 4YXHL 3UP1A 5DD0H 3NBNA 1Z9OA 2DQUH 1UZ8A 1SEBA 1MPAL 3U4EB 3MRLA 4HGMA 4YHZH 1JHKH 1G9ML 3UYOD 4NN6B 4JHAH 3QEQA 2Y5TB 1F4HA 1VACA 2XT1B 3PL6D 1FFRA 3UBXB 1K5NB 1MWAH 3C09B 3MREB 3MBXH 3EYFA 5GGQL 3KYKH 3S7GA 2HT4C 1D3CA 1BQHB 4Y4FC 1HHKB 4LSRH 1T89A 3IJHA 3IXTA 1ZANL 3WKML 4H88L 4ZAKD 3N0PB 3MYJA 3UYPA 2EIDA 4AH2B 2IPKA 3OGOE 2ICWA 5CAYB 3HMWL 2AXFB 3NIGF 2XYCA 1QPPA 2CO7B 5I1JL 1BQHA 2XZCH 4MJIB 4H0HB 2BNRD 4KKAD 4HSQA 2VLKE 5AZEL 2R1WA 2XA3A 5ENWA 1A4JA 3C60C 1DQML 1GXEA 3O2DL 1FNLA 4ZNCD 1J0YA 4NQSB 5GRVK 4XCYB 2NTFB 3X17A 2BHYA 1VPOL 5GGUA 2F58H 3JZ7A 3GJEB 3A6CL 5DURB 2DLTA 5KS9B 1GGTA 3OXRA 4LPWA 4Z7WA 4M5YL 2C4FU 5CSZA 4PRHA 3UTPD 2F53D 1UZ6F 4CADA 1MREH 3HI6L 4WUUB 3S6CA 3MUHL 4CBPA 1LP9F 3ALWA 4NKOA 4LPUA 3VFSB 1OAYH 2Z31C 3ULVD 2XACC 1PZ5A 1IE5A 1IARB 4P46C 4Z7WB 1KOAA 2X40A 5I1AB 2DIJA 2R4SL 4D9RD 3HE6C 4XGZA 1MAMH 1U58B 5F9AC 3QQ4A 1J0HA 1K8DB 4JFEB 5C0JA 4ZUSB 2I5YL 1TVHA 5HVHB 5FOBB 4AMKH 4OCSL 2PKDA 2PXYD 4XGZB 1B0WA 3LZFH 5JUEL 4F58H 2APBA 4AMKL 5KSVA 1T1ZA 1LEGA 4MNHB 2DWDB 5D7JB 5DEGA 2WAHA 5FYLD 2FWOA 3MCG1 1TVHB 4ZS7L 1W0WB 5D2NA 2GSGB 1BZ7B 1X7QB 2NY4C 1A2YA 3WL9B 1L6ZA 4PJDE 1YEGH 4LSPL 2VXQL 3KPQA 1YC8A 2A77H 3MROA 1DQJA 2YR3A 3B9KB 4LNRA 5F44A 5HGAB 1ZTXH 1IAIH 1YPZE 1ND0A 5E8EB 3CVHL 2E8YA 1KTDB 1J88A 4QRTA 5GQBA 1KJVA 4JREB 3GSVB 3O0RL 4X5LA 1ZA3B 5ISZD 4KJYA 2ED8A 2Y5TA 3WFEL 1TCRB 5CKAA 3I3DA 4LAJH 4OCWH 1S7XA 2JKXA 4ZTPL 1RI8A 3RBGA 3MREA 4P2QA 3WBDA 5JORA 3FQUA 1T5XA 3CK0L 5B39G 4NWUH 3RWJB 2WBWB 3RJQB 2HA1A 1H5BC 5D1ZC 4AENB 1CQYA 1S5HA 3G6JF 4HS3B 1NCWL 5J11C 25C8H 3KPRE 1YMMA 5FIEA 3PV6A 3JWDH 1YJDC 1OAXH 2V5YA 3DI2B 1I7RB 5IB3A 4PYHA 5C3TA 1I1AB 1NMAH 2WK2A 4K23H 5FOJA 4XNXL 3O2VH 1A1MB 4E9LA 1I9EA 4JE4B 1ZXQA 4GRWF 2IAND 1S7VB 5EUOA 2EIZA 5C0RL 1CLOH 1UB5B 3X3FH 1U36A 4AT6B 4H20L 1EFXD 1C5CH 5TFSH 4PRPD 5MI0B 3IYLW 4KROB 2CMRH 2Q20A 4KQ4L 5JXAH 5B38G 1I3RB 4JGJA 2XKSA 3WDIA 3RIFK 3TA3B 2V7HA 2JB6B 4KQ4H 4NKOB 1KJMA 1UKSA 4GSDH 5HDOA 3I84A 4OV5B 4LKCA 5BOPA 2X5PA 3V7MA 1QKZL 5SWZE 4Z7VA 2BSTA 2ENSA 4J3WA 2XPGA 3SO3B 1X4ZA 4L3CA 1BBJA 1NCWH 4MWFA 5DRWB 3VRJA 1NGZA 3BQUB 4U3XA 3IAQA 5E00B 4ZFGH 1YNKL 4R26H 1MNUL 3B2UC 3ZYJA 3MRFB 1IGJA 5GISH 5IB5A 4LFHD 1EJOL 1K6QH 4G8IB 3PWLA 3BUYB 1OCWL 4OCWL 2DQFA 1XF5B 4NUJB 2X41A 1S78C 1HI6B 1T2JA 2H2SC 2GJZB 5HDBE 4M6MH 3HHRB 1L0YA 4OZFB 3ILQC 4WI5A 2APFA 2NY6D 3NA9L 3QIWB 4OFVA 2HKHL 4ZMAT 3SJVE 2DYPB 4UOW0 1J05B 2F54E 5B3JF 2ZSWA 3D39B 4C55A 5E6IB 3O6LL 2Q7YA 1J8KA 3DO7A 3AAZA 1QNZL 3FB8B 4OZFA 3CZFA 2EDRA 3K2UL 4KKCD 1NFIB 4QRTB 3QQ9C 3BPOC 4UT7L 5JHDA 3QUZC 1FNFA 2QBWA 2DTMH 3BWUC 1N0XL 3DX9A 1JWSA 1TJGH 5T1DL 3FO2A 4OIAA 4WI8A 2JJUA 3RDTD 3CPLA 4KVNL 3RWJA 1J1OL 2NY5H 1WZLA 4ZFZB 4Y0GA 5HHOA 5MEQB 3DX9B 1I3UA 5JPNB 4LVNB 1AJ7H 4L9LB 3CFEA 1E6OL 3EFDL 3QUXD 5I30L 1RUQH 3MUZ1 1CT8A 3FFCA 1MJJB 2BVEA 2I5YH 3ARDC 1GHFH 5INDA 2Y07L 4WHTB 5GRJH 3O4OB 4Q9QH 2MPAL 1I8KA 3Q5TA 5GGSY 1GPOL 4APQB 1S7VA 1LE5B 2X2YA 5KSAA 5LAXA 3IT8D 1UXSB 5F9OL 4APQD 1MHEA 2R2HB 4D8PA 5TE6H 4RGOH 5L6YH 3G5YA 3TBYA 1XF3B 4XVTH 3OX8A 3MV7B 1CFTB 4WEBH 1IC7H 5ADOH 3AB0B 2WIIB 1AD9A 3K8LA 2AXGB 3QUYA 4X5XA 3KDMB 4ONFL 4M43L 1H8NA 1RMFL 5EIQA 4KDVA 4J3UA 1HHIA 1Z0NA 1LEKA 3G9AB 4OM1L 4XT1C 2XZAL 3QIUD 1XF3A 1OP5H 2NY3B 3MLTB 1DN0B 1KYOK 4LLDA 2Y36H 3RX8A 1S7SB 2Y72A 4X6CF 2VZVA 1H3TA 4WW2F 4L3EE 4M61B 4MJ5A 4F58L 4XMKL 5D96B 1RUKH 2VERN 4BFIB 2OI9B 2DQEH 2GSIB 5TQ2H 4PJCA 3GHEL 3MLTA 3WUZA 5D6DC 3GSVA 3H3BC 4RBPH 3GBNL 2DYPD 1XF4B 3EYOB 3QXAB 1DQLH 1CN4A 5JQ6H 3MQIA 3OF6A 1S7UB 3SDXE 3LSOB 4J3VA 2UWEF 4UIMA 2Y7QB 5T5NG 4IMLB 1ZGLA 3VE0A 2LTQB 4X9GA 4L29A 4DK6A 3IDNA 4FQLL 4PJEE 9CGTA 2QSCL 5C0GA 1B9ZA 4ZUUA 3AXLA 1V7NH 1I1YB 5F72S 2ED9A 4UT6L 3QH3A 5C92A 1OTTD 4CMMA 4GBXD 1PEWA 2ADIB 3QA3B 1JHKL 4OCXH 3H9SE 4HX1B 4QF1A 5CBAA 4XTRC 3W39B 1KCUL 3FN9A 3TCXA 1MQKH 1BFOA 3O6MH 3QO1A 3O9WC 1FIEA 4QO1A 5DJAB 2X9YA 1UH4A 1BQSA 5ICZA 4LEOB 3F62A 1UB5A 1YNLL 1BEYH 2H2PC 2FB4L 3D39E 2GQHA 4JQIH 5MENB 3D9AL 4UNVA 4WV1C 2F54B 5DQ9A 3ISWA 1QLFB 1HSBB 4YGVB 4FHBD 3T4YB 1R5VB 2YEZB 1G7LB 3H0TB 2X4TB 4JPKH 3QCTH 3R4DA 2B1HL 1D9KC 4HKZB 4ZFOA 4WW1A 5HHOD 5KS9A 2I9TB 2EDDA 3HE7A 4YHPB 2R0ZL 4PRHB 1YY8A 4JDTL 4HIJA 3D25B 2JLLA 2V9RA 4JJ5A 2XI9A 4MAYA 2VZSA 1FL5B 2EE3A 4JFHE 3WIIL 5KW9L 3JV4B 5IG7B 4YHZL 3QCVL 4S2SB 2WNGA 2XQBL 3RGVD 5DT1L 5DK0B 1NC4A 3IDJB 4PLKD 1ADQA 2Z8SA 2DQFB 5GRXG 5GGRY 5DMGD 4R3SA 1ULVA 1ZA6A 3M45A 4HBCH 3P9MA 4NOFA 4OZHB 1ODAA 4WI4A 1AY1H 4DW2H 4PG2C 4AEIL 3NFNA 1R24A 3PXJA 3OZ9H 3I6GA 1M7DA 3O4LD 3C5SA 3W0WB 4LSTL 2DTML 2I60L 1KNOB 1MRCH 4FQHA 2AKRA 5E6IA 1P2CB 2IADA 1TVBA 4HD9A 1FDLH 1MRCL 1W0WA 2NY1C 3KJ6L 1U3HA 4YR6A 3BGFB 4JLRA 4ZUVA 5IT2H 1Z5LA 3RKDD 3DTXB 3EAKA 1A7RL 1I9JH 5CJQL 3G04A 1AXTH 2WWKT 4WTWA 1JJUA 4PJAA 1KJ3H 1TVBB 5D6CB 5EU6E 4N0FB 1LNUA 4BSVA 1NMCB 2J1KA 3FN0H 5HYSG 3D87B 1XMWA 4MNQD 1C1EL 4ZFZA 1PYWA 3CFJA 2NY7H 3ZTNL 1U41A 4LVEA 1XIWB 2ZNWA 1W8NA 3G6AB 1KXTB 2FNBA 3KPRB 3QDMB 1QR1A 3B9KC 1S78D 3P0VL 4Y4FB 1OWRM 3LMJH 1YDPA 4IM8A 3BZDA 5D7JD 2B8OT 2FZ3B 2JB5H 4ZAKB 2A0LD 4UMGA 5F7YC 1I1FA 3N1PC 3B5GA 15C8L 4RMVA 4JFDD 4L4VD 1OGTB 3QHZH 3OB8A 4GBXB 3DVFA 4APQA 2UUDH 4GG8A 4BA8A 4L4JA 3GKWH 5C0CE 1HNGA 2VOTA 3U0WL 3BH8A 5L0QC 1F8TH 5I1EH 4JHWH 4NHUB 3MFFB 5E9DD 3HUJF 4MXWL 4RZCB 3WLWD 5DJDA 3IDXH 1R5VA 1HINH 3ULUD 2EDWA 5KSBF 4MNGA 3UTZA 2CJUL 2FATL 4DKFH 4YPGA 1J12A 1GGUA 5K59E 5B8CA 5EPMA 1JGLH 4GG6E 1CCZA 4M6NL 5KVDH 2I9TA 1U8IA 5BV7H 3EJYC 3VH8A 1KCSL 3R0MA 4IRZH 3GK8L 1V3LA 1OM3H 5CCKH 1F13A 1EK3A 4KFZC 4P46B 1CYGA 3H3PH 5JW3H 4MLIA 5IT2L 1KJMB 3HNVH 4XNZB 5JA9A 2NXYB 5HVFB 1LO5A 5E70A 5CJXA 2OJEA 5DMIL 3QDJD 1SVCP 4DUWA 1HH6B 2DJSA 1RHFA 5GISL 4L4VE 4MNQA 4U6YB 5AWNH 4P46A 4LCCA 1CF8H 1KC5H 5FV2A 3ROOA 3D85B 2LTQC 3QRGH 2FJFA 1JIBA 4WUUE 1FNEA 1CXHA 3PWUA 1RUAL 4ZAKC 1XF2A 3DRQB 2PW2A 3EOTL 3M1BA 4P3CL 3GSUA 5EZOH 3CVIH 2GKIA 2JJSC 4KK6D 3SOBL 5H2BA 5D7IA 5KS9E 5DJ6A 2X4QA 1HINL 1ZT7B 3NCCB 2A73A 5TDOB 1UQSA 3I3EA 3QEHA 2A6JB 3G9VA 1XR9B 4LEXL 1NGWA 4QOKD 1CFQA 3DVNB 4K23L 5F9DC 1ED3B 4J4PC 4Z7WF 5DRZA 5C0NC 1NGYB 4QWWC 4X6DF 4WFGE 4PRBB 3SPVB 5ANME 3W9DA 3BKCL 3MJ9A 4LEOA 5GRUH 3QIBC 1H3VA 3KJ4B 1HHJB 4L3EB 4M4PA 1ZHBA 3S34H 5FO9B 1FFOA 1QD0A 5IFAH 4AJ0A 1DQTA 3WLBA 4GAGH 2NX5D 4EQ2A 4F7CB 5IR1B 4Y4FA 1YY9C 3LKSB 5AYUL 1I8LA 1FPTL 5MHSE 3FQTA 5JDSA 3RWFA 2XZQH 3RWCB 5TPWH 4PRAB 3WLBB 4TVPL 2VO5A 1I1FB 3LN4A 4XAKE 1CK0L 2FH8A 3WKMH 4ZQKB 1NPUA 2DQIL 4UZGA 1D9KD 3TBTB 2DTSA 3ARFD 4ZUTB 5I1HH 4WU5A 2X4PA 5KOVC 5E1HB 5E8PA 2B4CL 2IPUG 4NRXA 1CGXA 5INDB 4HIXH 3VXUB 4JM4H 3QISA 4XNYH 3OAUL 4IOIB 1RPQA 4HAGA 2HFEA 4JKMA 3GMQA 4TSCL 2NY6B 3SE8L 1KC5L 4OQTA 5CWSB 4PLNC 1EV2E 3BGMA 4G80B 2QQKH 4HV8A 3QDGB 2J8UF 1A64A 1OP9A 1FN4A 5I17A 4IDJH 4N0UB 4GXVL 5FHBH 3DXAD 2JJSA 4OI8A 5KSUA 5JIKA 5CLTA 4PV8A 1YEHL 2V5RA 1AR1D 2EDQA 4K94L 2AXJA 2C7UA 3KPRD 4WY7L 4NKMB 1FN4B 1NEZA 3ULUL 1OAYL 3ZYOA 3BMWA 1NGQL 1CR9L 3K7UA 4H1LA 4U49A 5DJ8A 4Y5XB 4ETQB 4KQ3H 1CBVL 1FVDB 4NRYA 2DMBA 3RWHB 2WW8A 3I50L 4PJ8C 2ICEA 3RL2B 3PWVA 4PBWD 4PJHA 2P49B 4HF5L 2B4CH 4Z0XA 1VEPA 4HT1H 4NQEB 3C60B 4MMZC 5ACZB 1C7TA 2NXZC 4J8RA 1Q8MA 5E5UB 2KH2B 2PW2B 4GS7C 3UC0H 2DKMA 1X4XA 4PJAE 3FAXA 3BPOB 2WV3A 2NNAB 5C8JB 4A2MA 2VB5A 4QHNB 3RHWK 2OR8A 3DSNA 1G6VK 2IPUK 2CKBB 5EUOF 3V8CA 3PL6C 3FQWA 4XZUA 4YNYB 1BQUA 2ZJSL 4LP4A 2YN5A 5DF0A 5GSRB 3OKEA 2BVOB 1F58L 1PLGH 4P4KC 1OGAE 4KK9D 1U8OA 1MCKA 3BVNB 3L3KB 1Q0YL 5F89A 5ERWA 1JPGA 1A9EA 5E8DH 2Q86B 2P47B 1IGIL 3WD5H 5FGCE 2G5RA 3S97C 4OCXL 2XQYK 1VEOA 3WEXA 3RGVB 4OFDA 1NCAH 3GI8H 1T04A 2VUYA 3OV6A 4YDJA 2MHAA 1Y6KR 1IAOB 1MCOL 2HH0L 3C8DA 3CLFL 3TN0B 4XP5L 3VFVA 3BKMH 1J18A 1T1XA 3HB3C 5IBUG 5HGGS 1F5WA 3RWEB 3NIFE 1RUML 3FQTB 3FT2B 2EDEA 5T3ZE 3PHQA 5IVOA 1GOHA 4P48A 3WLWC 4Y1AD 5T1KD 3C8KB 4LCIL 3U36B 3X3GL 2R56H 4RWYL 3VI4E 5CGTA 4LMQI 5JW4Q 3SQOL 3U9PL 4Z0BH 2F5BH 2X09A 5A2LH 3QDJA 3QRGL 4HLZG 5CIPH 4U1MB 4NM4H 4I18B 3RNQA 1XGRA 5CEXB 4U6YA 3D3VA 4ODUB 1ORQA 2EO1A 2XNAA 3LAFA 4V2CB 4HG4K 3SY0B 1BFVL 1AXSB 3WNMA 3PP3K 5DMKA 4Y2DC 3D3VB 1HEZA 1JWUB 4ISVA 5DI8B 2Q6WA 4AEFA 2AERT 4ONFH 4GRLC 3ZE2E 4XXCC 5D7KD 4O51A 3HCVA 2H26A 2XFXA 5ETUA 3MGOA 3T3ME 2P42B 3GO1L 3KPLB 3CSGA 4IRSC 2EXYC 3D0VA 3MOAL 1SJXA 3O45A 1QRNB 4HK0A 1ZEAL 4HUVB 1FVDA 3CVIL 5DRNA 4F9PA 4X83A 5HGHA 4CU6A 2Z8RA 5TE7H 4R7DA 3SKOA 3MJ7B 4Z78A 4NQEA 5I6XC 1X5AA 5FO9A 1E4XL 3T77B 3H3KA 2WLYA 4NCC2 1OAUH 2VKWA 4NCDA 1K8IB 4JRXA 5D1QD 3PDOB 3BN9C 1PQZB 3E8UH 4GLRH 4P3DA 1C12A 2ARWA 4IDJL 4N0UE 1Q0XH 2DQGH 4KZEH 2OK0H 5CBEB 4YDLC 2ERJC 4ONGH 4DVRH 1P9MC 1M1SA 5DUBA 4F15C 5C6PB 3UBXI 2Q8AL 1R3IH 1G7PA 1S5IH 1KENL 3GIZL 4NO2B 4EI5B 4XPBH 4IBLT 3QWQB 3PGCB 3TM6A 3BQUC 3ZKQD 1WIOA 2V9QA 5ICYA 2HKFL 5FM4A 5D1XB 4B41A 1IFHL 4PV9B 3C2SA 3B5HA 1PKQB 4QNPE 4IS6A 5I1DB 3DARA 5EU4A 5KAQF 5EZIH 5FUCE 4OJFL 3SDCA 1QSZA 4DKAA 5MEOB 2JK5A 4D9LH 4NHUA 4FXGA 3UDWA 1TTUA 3OKOB 1BAFH 5K9KA 1U8MB 3QI9B 1QR4A 1FAIH 4HWZB 1J8HA 1IEBA 2VXUH 4HFUH 3DETD 1U95A 4P4KB 1T21B 1ZWIA 3VW3H 3BKJL 3F5WA 4XI5C 3X11A 3C6SA 5MEOA 1NEZB 5FXCH 4ZUWA 2CLZB 2A9NH 4FXGB 3L5HA 1T22A 1Q0YH 5C7XH 5I1IL 1RZGA 4IHOA 1EEZB 4Y5VA 3TBSB 3ARQA 4C56B 2XKNA 4Q97A 4FG6D 4OCRL 5E4EC 4EUPB 3S88L 4BSJA 4Y19A 25C8L 1QFWL 2OBGA 1ADQH 4S1DC 5C3LD 1M71B 4XCFL 1L0XA 1AO7B 3T2OA 2CIKA 4R2GD 3U7YH 3AREB 1IC7L 3E3QE 3QFJA 1E4JA 1E4KA 5GJTH 3QDHA 4XVTL 1A6UH 5EC2A 1IL1A 1JUFB 4XVJL 4WVRA 1W72B 3HZMB 4LSRL 4CAGA 1XGPA 2HVJA 4OZIF 4LP5A 1FO0H 3F65A 3LEVL 2BNUB 3KPOA 4YBQC 1QO3B 3QNYA 4YHKL 5FGSA 4K2UL 3D85A 3L3IA 3LQAH 4PRNB 2PTTB 3PXHA 5ADPL 2WZPD 1Q9OA 1WISA 1WSST 2CIIB 3CX2A 3T0BA 5T5FL 5IMKB 3VGHA 5BW7A 4UUJA 3DV4A 3TO2B 2L7UA 2YMXL 3SBWC 3L7FA 3U82B 1XGQB 1H0DB 4PRNA 3QHFH 3LQAC 2ZNXA 3DWTA 3T3PE 4WCYL 4GKSA 4YH6A 1WVZA 4M7LL 4OLWH 1TQBC 3GBNH 4I1NB 4Y4HB 1FNGA 4HAFA 3ARBB 4J6RH 5IB1B 4NGHL 5EZJB 5HPOA 5IOPB 5IEKA 3A6OA 4PGEB 1T1XB 1WFOA 2EDKA 5EOCL 5KTEH 3WSQL 5EA0H 4W4OA 3SPVA 4JDZB 1CD9B 1D5MA 4GAGL 5D2LF 1NFDA 2NR6C 1JGLL 3VXRD 1CVSC 1RZIB 2NY2C 4L4TB 5DSCA 3SCMC 2X89D 1JNHA 2MQCA 1AKJD 1F02I 1HYSC 1JK8A 2QSCH 2EYTB 4FA8A 4ODVL 1YN7A 2EKSA 3VWJA 1BM3H 5KVEH 4R4BA 1KCRH 4MX7A 3EYVA 3GO1H 3IDGB 5SWSE 4JKKA 1RU9L 2HT2D 4M1CD 1F3JB 43CAA 5J6HA 4HCRH 5EUKB 1ZHLA 3U2SA 1XGUA 1C8PA 3U1SH 3O9WA 2ADFH 3BIKB 4JB9H 5C0CB 4J3XA 3MV01 5SWSA 1P1ZB 1ADQL 2FIRT 1HQRA 1PKQA 5I30H 3RAJL 2MFNA 1BEYL 4LCCC 4ZOCA 4WY7H 4ZO8A 2CK0L 4K3DH 4L8DA 3EOTH 4MNQE 4PJAF 1HNFA 2XA8L 3GMRB 3IFNH 1D6EA 1Y6NR 4KJWC 4OQTH 1QBBA 4NNPL 2AJXH 4EUPG