3SGKA

Unique carbohydrate/carbohydrate interactions are required for high affinity binding of fcgiii and antibodies lacking core fucose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
209
structure length
209
Chain Sequence
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fc fragment
publication title Unique carbohydrate-carbohydrate interactions are required for high affinity binding between FcgammaRIII and antibodies lacking core fucose.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgkA01
4M6AA 2PXYB 4NQUA 3EW3B 3WFCH 4P4RB 2FWOA 3W0WE 2V5MA 2H32A 3QUKB 4MNGB 3VE0B 1RMFH 3CU7A 2FBOJ 1KIRB 12E8L 3OZ9L 3QUXD 4JM2C 3I02A 3CVHB 3L95B 1EX0A 1AKJA 1CFVH 3QCUL 2VR5A 3O11B 3TCXA 2OR8A 4MMXC 4NRYA 5IF0B 1GYAA 1EEZB 5FOJA 4CMHB 2R4RL 4NHCL 2XPGB 4PJEB 2BOCB 5DF0A 3ULVL 3T0EB 3QZWG 1BLNA 3UJTL 3D2UD 4UT9H 3VFSB 3D85D 1E27A 2DYPB 4ZUUA 5D1ZD 1WBYB 1W72H 5GGTA 4YAQB 1WT5A 1QSFB 1FNGA 1ZGLM 3EAKA 3K8MA 3KR3L 5F89A 3HUJB 1G9ML 1UH4A 1FPTL 1U3HD 1SMAA 2B0SH 3ARFC 5FUZH 4OCSL 2EC9T 1DJSA 2VDNH 3AREB 3BD5A 3GSOB 5C0RH 4EN3A 1AGCB 3TBVB 2HJLB 5DHYA 3UPRA 1BFVH 1E28A 1G7LB 1ZSDB 1QKZH 3L3JB 2NY7L 4PB9H 2YXMA 4ZSOE 4UV7H 5CEXB 3P77B 4RGMB 3OKMB 3OKEB 1NDMB 4OGAD 4YO0A 4K8RH 2HKFH 4POZD 4CVZB 5H35B 1J8KA 5DMKB 4ZOEA 2BY0A 4N68A 4BZYA 4WFFD 3GK8H 4Z7NF 1G7HA 1K4CB 2P43B 3BGAA 3CLFL 3NFSH 3H3PH 4XX1G 4XBGA 2NZ9C 5FF6B 3ULUF 1S7UB 3DRTB 4GQ9H 1F3DJ 1F5WA 1DEEA 2NY4D 4JB9H 3FONB 1WIOA 4JG1L 3SGDH 3BWAA 1B0RA 4XBPB 4DVRL 2YKLH 2RCSH 3GI9H 2NMSA 2EYTA 2CIIB 4KDTA 4ZFOL 1NDGB 3MLVL 3STBA 4YHYC 5D7JB 4MJ5B 4LDOB 4ZDHB 1IGFH 5T33H 4Z9KB 2F5AL 3RNQB 3B43A 3TT3H 4NYLA 1NGYA 3VFMA 1RI8A 4NCC2 3E3QE 1DDHA 1XH3B 1KPUA 3SDDB 3C8KB 2ADJB 3IFNL 4YEFA 3LRGA 3GBNH 5GHWL 1U2CA 2NY1B 2YK1H 2B8OT 2VZOA 4NQEE 1FNHA 3IU3A 4PG2C 4X6DA 5LCVH 1GZPA 1RFDL 1FNSH 1MRCH 1NFIB 1IC5L 5HI3D 1S8DB 1VEPA 4EZMA 3TM6A 4ETYA 3MRLA 3MRGA 1MFCL 4KK9D 1JPST 3O4LD 1VFAA 1XGPA 3MA7B 3IDNB 1ETZA 3TGXA 2YBRB 2R23A 4O4YL 1L7IH 1YNKH 5D2LA 2HG5A 5GIRA 5CWSB 4GSDH 1MCDA 4KK5C 3OAZH 5D96B 1JGEB 2CJUL 3AAZB 4L4TA 1JMZA 1GHFL 5DQDH 3MJ7A 1RJLB 3IU4L 4PLJC 4KK6C 4OGXL 4XB7A 1DLHB 1LDPL 1W0VA 4R3SA 3UYRL 3FRUB 5I1JL 4G8EA 4XCYB 3ES6A 1FJ1B 3DMMB 4QRUB 4HWEH 1SJEB 3VMOA 4OCYH 5L9DL 1G7QB 3QJHA 2OJEB 4HIIB 1JZ3A 4WTXA 2DKUA 4S1DD 1ZHBA 1XIWB 5EO0A 3X14B 5EU7E 1TVBB 4IRJC 3MRQB 1VGKA 1YNLL 5IFAH 2FB4L 3G6JA 4GUPB 5DJ6B 3VGGA 1T80A 5GSVB 3M45A 3GMRB 2FH6A 3NAAL 3MJ9H 3WFZA 4Q7DA 3K46A 3Q1SL 1RUPL 5E95B 1F13A 4XPBH 3VFWB 4MNGE 4JFOB 2F74B 4YDKL 4MGXA 2PYFB 5T1LA 1AFVL 3WNKA 1JNNH 5T1KB 5E2TL 5J7CC 5LAXA 1MWAH 2R2EB 1HHHB 4WJ5B 4ODTH 1BEYL 5C0NC 2P7TB 3OX8B 4YEEA 2VLJB 4HK0B 1JP5A 4M7JL 4MYWB 5L8JB 2G9HA 5I75C 2YSSA 5I1GH 3B2VL 5H2BB 1ITBB 3RWFB 2BY3A 2Y36H 2R4SL 2CKNA 3Q5YA 4PJEE 3TO2B 1DBJL 1CR9H 5DYOA 1HXYA 2P5EA 3VFVA 3T0EE 2OTUB 2YPKA 3FN3A 1G7MA 3B2UC 4AZ8A 3FQUB 5D1QA 1YEDB 3QEGH 4XXDA 2Q3AA 3WNPA 4YWGL 1ZS8B 4Y2DD 5JNYA 1QSFE 1U8HA 2ZG3A 2H3NB 3HG1D 5HHOA 1IC7H 1JF6A 3C6SA 4GBXA 4GRLB 2P5WB 3P40A 4QHUB 3HUJE 2XA8H 1JFQH 1MVUB 4X6BA 4L8DB 1KCSL 4LSVL 3CFKA 1YEIH 4LCUA 4NN6B 1WWWX 1IAOB 5C09B 1WUNT 3SPVA 4XBEL 2AAVA 3CVHL 3CVIL 1U8LB 1ZHLA 4H5SA 1AGBB 1NCBH 2C1PB 3QCTH 4OKVB 5K93A 1JNHA 3J7HA 4P2OC 5JXAL 1X6NA 1BFSA 1F90L 4FFZH 1QYGL 1ZTXH 2YEZA 2AK4A 3QG7L 3ZE1E 4FTVA 1YEFL 3GIVB 5C2BL 2XWTB 1LE5B 2IADB 3N85H 3QUMB 1YEGH 5L0QC 1V7ML 1XGQA 3U9UA 4NM4L 2BHYA 5FHAL 4JO1H 1ZT7B 1SY6L 2ESVD 1A3QA 1RUQL 4BYHA 3NFNB 5EIVA 4X9HA 1YUHB 1D5BA 4MNHA 3FB5B 5CSZB 3QNYA 3T2NL 1G0DA 4HG4J 4D9LL 2BVTA 3KHQA 4I9WD 4Y1AD 1KJVA 4WWKB 1XGYH 1I85A 5K9JH 4X7CC 1MNUH 3F58L 1RZ8B 5IEHB 1ND0B 2VITB 4DCQB 3SGJC 2AQ1A 1V05A 1SEBA 2J12B 3OG4B 5CZVL 2GJ6B 4ESKA 1VADA 5SWZA 3KPPA 3RI5K 3LZFH 3RAJH 5I8CA 5FYLL 1T3FA 1OAZH 5EO9A 4ETQA 4NWUL 2DM3A 1CE6B 1GGBL 1UXWB 1BHGA 1FN4B 3VG9C 4MX7B 5JW3H 3RHWK 4HWZB 4LBEB 3O4OC 1YYMH 4JKLA 3WS3A 4KRLB 1U3HA 3ARBB 4YX2L 3F8UB 1MVFA 5I1IH 2XFXA 5DJXB 5IR1B 1ADQL 5C0GA 2WANA 3MNWA 1G1CA 3ZTJG 2PR4H 4BJLA 4QRSA 1CFTB 3RL1B 4NZTH 5HYSA 5E8DH 3LOWA 1ZWIB 3WYRA 2FWOB 5JOFB 1OAKL 3DETD 3QFJB 5MI0B 3LMJL 5IBTH 1AHWC 1ERNA 2B1AH 3ALXA 4P4KB 1EO8L 1A02N 1MFEL 3IYLW 1KIUA 4FFWC 4CVXB 1J86A 4HGMA 3WN5A 5DJCA 4XP1L 4LVOB 4I2XA 4TUOB 25C8L 4BZ1H 3VXNB 2WP3T 1DQLL 4FQQA 2DIAA 2XXMB 4KQ4H 1P5UA 5AYUH 1FG2B 2EYRB 4G6JL 3QXAB 4U0RB 4JHWL 5C6TH 4K3EH 1LD9A 1FH5H 1EXUA 2EKSA 2WBWB 3MBEB 4KKCD 1H3XA 5ICZB 3BP6B 3MGOA 4Z7NE 2DWEB 4QOKD 1W0WA 4YZFF 3IDIA 1FVDA 3SGEI 4PP2B 1H3TA 4OD2B 3ULUE 1OAQL 3L5IA 5FDWB 2GFBB 3JWOH 1T2XA 4XC3H 1F3JB 5EOCL 5HGGS 4ZFFB 4FP8H 3TYFA 1F02I 3KYOB 3PUCA 5EWIL 5EUKB 4XNZB 3OJVC 2N7BA 1XR9B 4OJFH 5BO1L 3MXWL 2VLJE 1JGVH 5GRUL 3BKCL 4CADB 3MFGB 5ID1B 1BBDH 3E1F1 3ZE2F 3QA3A 4CNIB 4LVNC 2P8PA 4EQ3A 2B1HL 3TYGH 3MRMB 1LO3H 1S9VA 3SDCC 1CLOL 4Y4HA 4XPAL 2ATPA 2V7NB 4WV1A 1N6UA 1YC8A 5KVFL 1PEZA 3U82B 5EZLB 5E8OA 1QZ1A 1A1MB 2R8SH 3BRGC 3MROA 1VGEH 5BRZD 4O2EB 2ZCKL 1FL5B 2VWEE 3IXTA 4XCCL 1AH1A 5J13C 3AY4C 4RBPK 1T0NA 3ZKNC 4NKOA 2P5WE 1DEEB 4QRQA 4YXKH 1VESA 1M7DB 2WBJB 3IFOA 1OY3B 1S9WA 5C09E 4KHTH 4LLWA 5MERA 2EKJA 4GAYA 4RAUB 3MRFB 1I9EA 3T65A 2UVFA 3GSUA 4DN3L 1QQDB 3VA2C 1HZHL 3B8SA 4KVNH 2FLRT 2NY0B 3NABH 1ZKAA 4NKDB 1NGYB 1TFHA 4NYLB 4NZUH 4P9ML 3VG0L 4CW1A 2DQCL 1KCKA 4FXKA 4JRYA 4OCWL 2MCPL 3MLTB 2BDNL 1BBJB 4M6OL 3DVNA 4BQBA 4L9LA 5DS8A 2CSPA 1XZ0A 1G84A 2OQJA 4LLYA 1X7QA 2DB8A 3I85A 3C5ZB 3CJJA 5JW5B 2PW2A 4PGBA 5HTSA 2NXZB 1CDCA 4IS6A 3MODH 4U1JB 3C9NA 1N4XL 5E6IB 1A6UH 1N64H 1C7SA 2ZCLL 1XGPB 1Z9LA 3QI9B 4OLYL 4TUJA 3FFDB 3CNKA 3CAFA 5A2FA 1NAML 1WQVT 4M61A 1A4JB 1JPFA 4JFXA 2HG5B 2FSEB 1BZ9A 4YHLH 4PJXF 1N5AB 4UB0L 3RDTD 5IW1B 2XA3A 1VFBA 2X5PA 3O6MH 5LKNA 2GJ6E 2NY2D 3WE6B 1ULVA 4NP4L 5HYQA 1BX2B 3GSVA 4MDIB 2AJVL 1OLZA 3P2TA 4Y2DA 4G8EB 3TWCL 5IW3A 4FG6C 3O2WL 4U1NB 5DGRA 2O61A 1L9MA 4AK1A 5E9DB 4XPFH 3QJHB 3T4YA 4FXLA 3QHFH 2EDOA 4PJDA 2R1YB 1FO0L 3WJJA 4UQ3B 4H26A 1VGKB 4AEHH 2VH5L 3G6JB 1HNFA 2C5DC 5GGRA 2IPTL 1MY7A 4UDTA 5ECJE 4EVNB 2YA1A 3HCVA 2XIDA 5I1DA 1CG9A 5IJKC 3Q5TA 4WEBL 1BGXH 8FABA 1FIGH 4MJID 4TPRH 3QFJE 2XKNB 1MCSA 3I2CH 2B7DT 1AQDB 2X42A 2NY5C 3UBXG 3SKUD 4OF6A 5C7XL 5F9JA 3GRWH 1LNUA 3N1GC 4OCRL 5ITBL 1WLHA 4ZS7L 1PQZA 4UUJB 4Y4KB 4JREB 3SO3C 1WZLA 2B4CH 1BWWA 2YS4A 5IFJA 3DV4B 2D7NA 2R0LL 3N1MC 3JUZA 5D70H 5DEFB 5CINL 1BAFL 3V6FB 1FG9C 3QIBC 5EU6D 1SBBA 5I2IB 4A6YA 4NGHL 3TLRA 4RDQG 1TMCB 1HILB 3HPLB 2FJFA 2IWGA 1B90A 2FX8L 5DZNA 1HINH 5D1QB 4DGIH 4W4OC 4TNWF 3U4EB 4NC1E 2DQGH 2N1KA 2R0ZL 5LBSL 3CFDA 4KKNA 3QYCA 5JNYB 3NZ8B 5HHMD 1K9TA 5HHOB 1NBVL 3D69B 4LCWB 4HQQL 4YXLH 5EU4A 1JZ6A 4H1LB 3FN0L 3CFKB 1V3LA 3U46A 3RGVB 4LCUB 1VPOH 1YMHA 4ODUB 5CGTA 4HAGA 4L8SB 4YFLI 2MWCA 4PRPA 4UTBH 1JGUH 3TA3B 2NX5D 2I24N 3G5VB 4Y4FB 5C07A 1UEYA 5D7LD 3S97C 3PQYD 1GVIA 4MVBC 2A6JA 1H3GA 3KYKH 3IXAB 2FX7H 4LHQB 3V5DB 2Y23A 4GKNA 4BSWB 1X4XA 1T4KB 1AXSA 1XGQB 5TE7H 4ZTOL 1P84J 1EJOL 5GGTL 3QUXB 3KPMA 4Y5VC 5FB8A 1IQDB 1D5BB 1FZOA 2AXGB 1REIA 4GG6A 3VFPA 3ZSTA 1Q94A 5TQ0L 3O3BA 1S7TB 1G9EA 3LQZB 1OSPH 1J1XH 3S36L 2HVKA 1M71B 2ICEA 4TNWK 1OTSD 1SEBB 4UNTA 4QRPD 4GW1A 3LN9A 4OGYL 3GSRB 3D2UB 2Q87A 3D85B 4MCYA 5JHDD 4U33A 1XF3B 2HJFB 5CBEB 1RURH 4PRNB 3CGTA 5D1ZB 5C1MB 5I8CB 4B5EA 1U92A 3EYSL 4G6FD 3FB6B 3DUSA 1OGAD 1TJIL 4NZRH 4HXBL 2QR0A 2XI9A 1F8TH 4PG9B 1U3HB 3RTQA 2A38A 1BMGA 1CN4A 3H8NA 3V52H 5EORH 4AT6A 2VDOL 4OSUL 5F96H 1ZHKA 3HRZA 3LB6C 1X3DA 4DVBA 2YPVL 5IK3A 1IGTB 5IJVA 4PR5B 3VFRB 4M7LL 3MNWB 4BH7A 3LEVL 2HH0L 4OFDA 4ZTPL 5IB5A 4PJ8D 1QLRA 3MLRH 3V0AC 3ZMRA 5IB1A 1A1OB 3JBG7 4NM8H 4M7KH 4KVCL 4QY8B 1DLFH 1KIQB 4TNVF 1PX4A 2ZKHL 3P9WB 3RU8L 5L2JA 3SEPA 1CFSB 4JN1L 4N0UB 5D1XD 5GJTL 1TQBC 2VUOA 1A7BA 3ZYZA 2X89A 3EOTH 3WN5B 1FORL 1MQKL 1YY8A 5ID0B 2I25N 3TNMA 1HKFA 1UYWH 4Y2OA 4EN3C 5I8OH 1V3JA 2RR3A 2NY4B 5E9DE 3ZE2E 4H88L 1CXFA 3CX5K 4AEIL 5D7KE 1LD9B 4Y5XA 5HPMA 4Q9CA 5MEOA 2CKBA 1EXUB 3OR7B 3C60B 3P4MB 3EDJA 1I8LC 5C71A 1WZ1L 5I30H 3HB3D 3O8XB 4D0BB 4ZODA 3MRHA 5IV2A 3IDIB 3G6JE 5DEGB 1KN2H 3V4UH 2QSCL 3OAYK 2BY1A 5DHVA 1N6VA 3BGMA 4ZPVA 3FO2B 1KB9J 5D6DA 2IAMD 3HZYB 4HIXL 1UVQA 1LO0H 3IJSB 4Q9QH 2P24A 4IM8A 5L88L 1U95A 5C0JA 4LSSH 1Q0YH 3S37H 1WSST 5H37G 1AD0B 3O4LB 3JSSA 3QISA 2W38A 5IIEA 5HVFB 1OM3L 35C8H 4U1HB 4CUCA 1QFUH 2B20A 1IZJA 4TNVK 5I76B 5M95B 4YGVA 3AXLA 2P8PB 2R0KL 4BQ6A 2NNAB 2K3TA 3OGCA 4XCEA 5H37H 1ZLVK 1HH9B 3QIUD 3RDTA 1X5KA 3B6SB 4K2UL 4JZJA 2GJJA 3HPJA 2ORBH 3QXDB 4HWNA 4HG4K 3CH1A 4ZPTB 5HHOE 4JFDD 3CU1A 4LCWE 1PJ9A 4RFNC 2HWZL 3KJ4C 5IVNA 5JMOC 5ICYB 2OYPA 3MNVA 1TVHA 3D6GA 3O0RH 3TVMC 4P46D 4FQ2H 4J1UB 5E70A 2PTTA 4G42B 1MJJA 2W65B 1E4JA 5EZJB 3E6HB 3SKJL 2PF6A 3U4BH 5TE4L 4CW1B 5IP4A 1IGIL 1MCKA 1S9XA 4PJ7F 5JR1L 5DJ2A 1FBIH 4L9LB 2W59A 3DSNA 4A2LA 2N56A 5CEZH 1KXQE 3SCMD 4PJ9B 5E2VL 4KMTL 4XWGL 4PJGF 4WW2C 4XMKH 1DE4B 3WKNA 4PGEB 5EOQL 3P0GB 4NN5B 2I5YL 4WDIA 3A6CH 5GS0C 4TUJB 1Y6MR 4HJJH 5BOZG 1FNEB 3MOBL 3IVKB 1MH5B 4HJ0D 3ECBA 4WI7A 4YPGA 3KYMB 3F7VA 1BZ9B 3DIFB 3GJEB 4XCNA 3VDBA 1YY9D 3IB4A 4HUXA 3ILPB 1WBZB 5GRXG 2F5BL 3PNWB 2KL6A 4QKXB 1DL7H 1T0PB 5F7DA 2C7UA 1PG7H 3FQRA 2R29H 4Y0GA 3DVGB 3AROA 4NZJA 3HG1B 3G04B 1A0QH 3K2UL 2J8OA 3RIAF 4YHOH 4F2MB 1CTNA 3JWDL 4FXGA 4D8PB 1TLKA 5KVDH 1D9KA 2YOCA 2UY7A 1F4WL 3WFEH 1A3RL 3GSNB 3RZCD 3EYQC 1JBJA 2ZUWA 1NKOA 1KC5L 3PWNA 4NQVA 4D0DA 5J1AB 2CUMA 5JTWA 1X5AA 1G7IB 3L7EA 4P5MB 1EHLH 2WIIA 2JJWA 3FRPG 4KGLA 2VXUL 3RNKB 3GMMA 3V0WL 1QBML 3GMPA 4HK3N 1CICD 8FABB 2W91A 4XH2A 1R3IH 1WBXB 4BFEA 4MHHI 4MZ3A 3QQ4B 2WLZA 4GW5A 1OP5H 2XKUA 4N0UE 2QQLL 4PP1C 4WFFE 4YHIB 3OV6A 4OLVL 3SGKA 2EDHA 1QP1A 5F9JB 2ESVB 2V2TA 4BUGA 1F11A 3V7AE 4ODSL 2BRRH 3BI9X 5HI4D 1KTDB 1RZKC 4HWUA 2VZVA 4Y1AB 4ONGL 5EBLB 3EYOB 2BVUA 1IKFL 1EGJA 4NUGH 1FHGA 2JF1A 3HE7D 3WNOA 2GY5A 4R90H 1NCUA 4JPVH 4DK3A 1MF2H 3JV5A 2HT4D 3PHOB 4KQ3H 2VL4A 2EH8H 1T7YA 1HDMB 3JZ7A 4ORZC 4P2RA 2PYEA 4PJGB 1PBYA 4TUKL 1A7QL 3RVUD 3U0WL 5ISZA 3EYFA 1UWEH 3RIAK 3B5HA 3E0GA 3O2DL 1TNMA 1N2RB 2LU3A 2OXGA 2VQTA 5ENWA 3GEWB 2DKSA 4LU5L 1MEXH 3PGFH 4DGVH 1CGWA 1I85C 2X4SA 2AKRB 4H8WC 5AYQA 3OHXA 3O4LE 4MAUL 4FN0A 3G6DH 1JYNA 3O6LH 4DZBA 3HAEB 1JPSH 3DX6B 2D7MA 4PJ8A 4LLUB 2DQUL 3U48A 2FZ3A 1RK0B 1NBYA 5FYJU 2UUDH 4BSVB 4Y16C 4M7LT 4DFHA 5C3TA 2A6JB 3MREA 3OSKA 4FQXC 1FDLL 2GI7A 4KROD 3SDXF 4M8QA 1FLTX 5HJ3A 4ACPA 4ZXBA 5D1XA 1LP9F 3WFHA 2J6EA 3P30H 3KPMB 5ESAB 1KLFA 4X9BA 4H20L 3ARQA 5CJOL 5EU5B 3KPNB 2W9EL 3MRJA 5HI5D 4NJAL 3BXNB 4LLDB 4Z7OE 4Q6IB 3NPSB 2YUZA 1NMAL 4RISH 4GAJH 4BELD 2DLGA 4F33A 4X0KB 2HRLA 2XNAB 4I48A 1KXVC 3P11H 4NRXA 3VH8B 1S7XB 4ELMF 1DVFC 1RZIA 2CMRL 3MV8D 4F8QA 3CSBA 3VWJC 2J3SA 5IGXL 2HJKB 3O3AB 3MZTA 4QOKB 1HHIA 4RMRA 4I13B 1U92B 1N5YH 3GIZL 3WFBH 4G6AC 3DUSB 4FMKA 3EO9L 4H8WH 1HIMH 2BFVL 3HZMB 4EI6B 2IAMA 1OARL 1U2HA 1DBMH 3AM8C 4JLRB 5BW7C 1A6VH 4HIJB 1BP3B 3HI1A 5DGQA 5IJVB 1RK1B 3S8WA 4Z76A 4AH2A 4GXVH 3GMNA 3Q6FA 4RNRA 1ED3B 2X9YA 4X7DC 43CAB 4XCFH 2IH3A 4BK4A 4JPKH 2Z4QA 1L0QA 3PJSA 3BHBB 1NUDA 4LVHC 1OP3H 2DTMH 4LP5A 5FO7B 1AE6H 5EC1B 4PYHA 1KFAH 5F8RC 4NQCA 5EZOL 5CJQH 4Z7WF 1KJ2H 4ALAH 3UTTA 4OFKA 3FT4A 1QBAA 4GRWF 4Q74A 1UB6A 3LV3A 3MLUH 5SV4A 3ARGB 5BRZB 4MCZB 2Q86B 3HG1E 1A7OH 1PW3A 1IM3A 5DUPL 5HHVH 1ZV5A 3PL6A 3TH3T 2VDMH 4E41A 1MRDH 5IB4A 1S3KL 4JM4L 3DX7B 3D3VD 3TT1H 4Y5XB 2Z35B 3M07A 1FZMA 2GAZB 3U2SB 3WHE1 3SDXB 3CXDH 4CAGA 1K3ZA 1EZVX 5E5RB 2NZIA 2AABH 3H6JA 3MRRA 4IIQA 2Y4SA 2DQJL 4WW1A 1AP2A 1RZFL 5LJYH 5T3ZH 5E99L 1I7RA 3BZDA 4IHOA 5F93C 2OL3B 5AZ2H 4Y19D 5DHVB 2ILLA 4ZPVB 2XY1A 5T3XH 5JQHC 3BN3B 3K4AA 3VGHA 4FOMA 1HHKA 4B7LA 5J06A 1UVQB 1QBLL 3RIFF 1HXMA 3BPLC 2P8LB 4R4NC 3P0VL 5CILL 4ELMB 2WUBH 2ESVE 2F54D 3BQUA 4PRHD 4M43H 4PBWD 1PD6A 5DWUL 4UT7H 4NN7B 3HC3L 4MA1B 3EDKA 5BV7B 5LGJA 2P8MA 4NO2B 2M2DA 4I9WE 4IOFC 2HLAB 4Y1AE 1CDIA 4GQPH 4JY5H 3C2SA 3GSNL 4N8VB 5KANG 4XCEB 3RDTB 1OAXL 1UJ3C 1K2DA 3RY5A 1P84K 5DZLA 4KY1L 5F3BA 4Q2ZB 3HPJB 2NY2B 3RVTC 2R4RH 5DUML 1CF8H 4PJGE 1KCVL 4JCMA 4FFYH 4Z0XA 4BZ2H 4Y5YB 4CVUA 1H8NA 3UJTH 3ZKMD 2IMNA 2VXVL 3MRBA 2AK1H 3IJHA 4ODVL 4WVRA 3BEVA 4PJAF 5DRWA 2EYSA 1TJGH 3KWWA 4K94C 4Z7WB 2VR9A 1T21A 4GRWB 4Z6AT 5F9AC 4I5BA 5SX4H 2LABA 1TPXC 3TO4A 1JWSA 5FA3A 4A6YL 4F9LA 3RIFK 3HR6A 3U1SH 4MJIB 3E6FB 3I6LD 3M1BB 1J0JA 3FQTB 3EYUH 3LD8C 5I74B 4ELKA 2D7QA 2AEWA 4I0PC 4RAHA 4UDUB 4JGUA 2VERN 2NY6C 2QADC 4U6XB 1BFOB 2AQ2A 3SE8L 1MCOL 5MENA 4HUVA 5JA8B 1GIGL 2FH8A 5F7MC 1OD7A 5EU6B 2P48B 1UM5L 1Z0MA 4B7IA 1MLBA 2W9LA 4HC1A 3KLAA 3S37X 3LSOA 2PO6A 3A6OA 5D7SL 5C9JA 1T5XA 1D3CA 1I3GL 2DJSA 4JHAH 2XN9D 3E3QC 4QOKE 4TVPD 3VXPB 1NMBH 4OKDA 3FO0H 2Q8BL 4DGYL 3WXWH 2JKXA 1MHHA 3VFNA 3SDAD 5DJ8A 3Q3GB 4S0TD 2F5AH 2Z91B 3UX9B 1YDPA 3QULA 3MRDA 5KSVB 3AS0A 4N1CA 1F58L 4OI9A 2K9UA 3FOMA 1CGSH 4TSAL 5KSUB 2YD2A 4M93B 4ONHA 4D0DB 3IFNH 4QRRD 3EGSA 5EU3A 5INCA 4KKBD 2E7CA 2ITDA 3H9ZA 4PTTB 5DTFB 5FCUH 1CD1B 3L5WB 2NX5B 4HT1H 1PGRB 2QQNH 4NNPL 2EDLA 1YN7A 4LPVA 5D7LB 1UENA 5GGUA 3PQYB 1KB9K 3RWCB 5K9QI 1EEYA 1KNOA 2XTJD 3QDJD 1FIEA 2K7PA 3UTOA 1OSZA 1IT9L 5K9OA 1OB1A 4PJAB 4GW4B 4CKVX 1UA6L 5BRZE 4QXWA 2J4WL 1JK8A 4U1GC 2FHBA 4P3CL 1B0GB 3H9SD 3DNKA 1QFWI 2DM4A 4K3JH 3S9DB 1FVEB 2DQTH 5DRNB 1GHFH 4LPXA 3H42L 3UPCA 3OKKB 1A6WL 4X7TA 5KVEH 5BVJB 1WK0A 3VFOA 1KENL 1CLYH 5ESVA 4HBQA 3SDXE 4QRPB 4R26H 4OAWB 4G6KL 2W0LA 3V4PH 2VAAA 4FNLL 2Y6SD 1SVZA 4QF1B 5L9DH 5DC0A 5F3HA 5JHDB 4ENED 4EI5A 3RQ3A 3EYFB 5E1AB 4APQA 3TBSB 4G6FB 3VMPA 3DROA 4OQTH 5JPNA 1OGAB 5LG1A 5C0FA 3HZVB 1MLCA 1Q9OB 4PJBA 1NAKL 1ZT4A 4LSPL 4C4KT 3PGDB 4M1CD 1C08B 3P0YL 4G7YL 1PG7X 4ELME 1F00I 5EUOA 4JANA 2P46B 1CQYA 1RUPH 4UILH 3NVQA 4U1LB 3MLPA 1CIDA 3RVWD 1BIIB 4X4YB 4RZCB 1I9JH 3LQMA 4HPYL 4MD0A 4KGJA 4OF0A 2XQBL 2Y06L 2YC1A 4PJ8B 1LDSA 3EHBC 2H26A 2BJML 5DXWA 1Q38A 3KJ6L 2CKBL 3P4NB 2NW2B 2Z93B 5F1KC 1ES0B 1RU9L 4X6CF 4XWOC 5DJDB 4TQEL 1DZBA 4XPGH 3V6OA 5F9WB 1Y18B 5D1XB 5BVPL 4NO5A 1DBJH 3SDYL 4AENB 1QA9A 4M5ZL 2O5ZL 3S3JA 4HBCL 1FL6A 1MFBL 4LLQA 4EBQH 2APVA 3L5XL 3ZKXB 2G5BB 2EZ0C 2YUXA 5JLZB 1OW0A 2HTKD 3DUUB 4K71B 3C08H 4NNXB 4X8JA 4UU9B 4NRXB 5FAAA 4JE4B 1S9YA 3MRCA 2BMKB 1S78C 2VN7A 4URTB 4OD1H 4Z7WE 5BV7L 4GRWE 4QHLA 3MO1A 1NLBH 1NSNH 1HHIB 1DR9A 4PB0L 2F19L 5DVMA 3EZJB 3LKNB 4P9HL 4YK4C 1U6AL 3CVHH 3IGAB 4R9HA 3CVIH 4F3FB 2A77H 4MA3A 3MC0A 4MJIE 1NL0L 4R97B 1LE9B 1I1FB 1KULA 1JV5A 1UM4L 2IAMB 4HF5L 5IB2A 2C26A 1FE8H 5EA0L 5JXAH 2Q76A 2X70B 5E56A 3FQNA 4OB5H 5DD3H 2VDRL 3VA6A 3Q0HA 3AS2A 1QYGH 2F54A 3HS0B 1NC2D 3HE6D 1XCQA 4Q6YA 3RWEB 3EFFA 5J57B 4MJ2A 4WU7B 4AH2B 4OM1H 4KZEL 3E2HB 2IBZX 2OBGA 3GMQA 4RNRB 4XHJC 4XXCC 3NCYP 4G8IA 2HA1A 4UNUA 4NM4H 3W5MA 4JQXA 1BPVA 1SY6H 4GRMA 4EOWL 4U6YB 1RUQH 1B6DA 5EU6E 3QCVH 3F5WA 1KACB 3GHBL 5L6YH 1P2CB 3GM8A 3QIUB 5FECA 4XNQA 4JQIL 4EKXA 3MRKB 3LV3B 1VKXA 1KN4L 4KJYA 4UIKL 1PG7W 1CS6A 2V9TA 4MQXD 1FNAA 4O51B 4JFDB 1F4AA 3DWTA 1RY7B 2FO4A 4LVEA 5ACZA 4LSTL 1I9IH 5GQBA 1KLGB 3ZE0F 4ZOBA 1U8PB 1X4ZA 3W11C 1GSMA 4X6CB 4GAGH 3CMOL 4P46B 3L3KB 2OJZH 5C0EB 3R1GH 3QDMA 2NX5E 1VACB 4YIQB 3ZO0A 2ZOKA 4YX2H 6FABH 4RRPA 1I7RB 4PV9B 4X4ME 5D7LE 3PQYE 1J1OL 3ZL4H 2JTDA 1IL1A 4PGDB 4KZDL 4CU6A 3X3GH 1JGDA 1DUZB 3QHZH 4KJWD 4QT5B 1NUFA 2ITCB 5EULV 2W60A 3MZGB 5GRYA 3RJQB 4AIXA 4DZ8A 3QFDA 1F6FB 4YC2B 4ZNCD 3UXFA 2Y9RT 5F71A 3SCMB 2G75A 1IAIM 4PJAE 4NZDA 5DFVC 4O02H 5TFSH 4R8WL 1BECA 4WRLA 2MNUA 3KPRD 1UZ8B 5LGJB 3LMJH 5CGYC 5EN2B 4ZMAT 4OTXL 4AJ0A 5J0BA 1MFEH 2NR6C 1WZKA 1E0OB 3I6GB 1XF1A 1ZEAL 1XIWC 5H94B 5KG9B 4KI5F 5BQ7B 5CSBA 5FO8A 1TJHL 3QWOA 4IDLA 5I1AA 5B4MC 4G9FD 2AJ3A 4QRPE 3ZYIA 2XN9A 5I18L 4G6JH 5JHDE 3ULUC 2ICES 5T5NG 4XNYL 3TCLA 4XMPL 5CD3A 5EBWB 1QSED 1OGAE 1Q9WB 1T20B 2JB5L 3SDAA 1PYWA 1H5BC 4DJMA 5JO5A 2D7PA 5GZND 5DR5L 3INUL 3PIQA 5E08L 4OIIL 1KB5A 3QNZA 3RWHB 4UMGA 5F1IB 3VRLF 3RZCB 2JCCF 5HXMA 3OJDA 4LP4A 4OD3L 5F88B 2KQNA 5KAQG 2GUOB 4QRRA 3CK0H 4OZHF 2GSGA 5EOCH 3QUZA 5AZEL 5BZWB 2NXYD 4KTDL 2W0PA 1EGJL 3CIQA 5CIPA 1CICB 2GT9B 4P57B 5MEPA 1D6VH 3QDJA 5EZIL 5IB3A 1D5MA 2YXFA 4G9DB 2ED7A 1HE7A 3H0TA 1OPGL 2BRQA 4DQOH 3HZKB 2HVJB 4DTGL 3HMXH 1D9KC 3ARDA 3O6FB 4W68A 3HA0A 3DBXA 4YHML 4HUVB 1IC1A 1MCLA 4M5YH 3X11A 1BIHA 1LVEA 1NJ9B 3WNMA 3TEUA 3ULUH 3B9VA 1MLBB 2FHFA 3KLAB 3ZKSD 3HE7B 3FAXA 3LSOB 1AGEA 4PJ7A 3G5XB 5F7NC 2XTLA 2ZUYA 5DVNA 1S5HB 2E5EA 2FIKB 4KUZL 3BH9A 3PABB 1I8KB 1NC4D 3IETB 2BVYA 1BOGA 2DICA 2GJZB 4POYA 2APWA 4JM2D 3QQ9C 1XT5A 4MNQB 2R1WA 3MR9A 1T1WB 1YDPB 4C83B 3VXSD 4YDIH 2DQEL 2DQCH 3IF1B 3FT3A 2J6EL 5DQ9A 1OP9A 3Q6GL 4LPCA 2QQKL 2X1QA 1XGTB 2MCPH 2P42B 4IJ3B 4C54A 4ONHB 5D8JH 4M6OH 4WNQA 5D7IA 1W8OA 3PWJB 5EU3B 3DXAD 2MPAL 3W9EA 4WWKC 3QPXH 4HZAA 3W5NA 4RA0C 5BCAA 2DM2A 3L3GB 5D6CA 3V0VA 1CU4L 4G8GD 1NCAH 4OZIA 2Y7QA 1IGMH 5IOPA 3DSFL 2GYSA 2ZCLH 5ADOL 1E6OL 4JZOA 4XPHL 2H1PL 4KROB 4JO3L 5A40E 2AVGA 2WP3O 1QR1A 3ARFD 5HDQL 1IEBB 1JPGA 4G5ZL 4BH8A 3VGFA 5ALBH 5GRWA 1AY1H 1RULL 4OZHB 3FTGB 4JFDE 1IKNA 3EO1B 4IRSB 2BC4B 2YD3A 4DKFH 2GKIA 1TIUA 3GB7B 4JKPL 5EBMA 1NCTA 3DPBA 1RUMH 4K3GA 4RDQF 4X7TB 5FFLA 4X6CE 5I16B 5FGBA 2VQUA 3MV8B 5IUSA 1PDKA 3QUMH 5I1LA 5FKPB 4OZFA 4OV6F 1OL0A 3SKOA 1N0XL 4KDVA 1U8KA 4ZXBC 5KS9A 5MI0C 4QHNB 3MYJA 1KTLA 2A9NL 5TQ2H 2FYYA 3VJ6B 2NZ9D 3I9GH 5D2NA 3ULVD 4S1SH 5FM5O 2IPTH 5KSAC 2O5YH 1QSZA 3SKMB 5TPWH 3NGBB 4JANB 2DI9A 4OFYD 4LOUD 4XTRC 4HCRA 2V2XA 3HE6A 5IT2L 2FX9H 4OCNC 2D9CA 2D31A 5I8KH 3EDDA 4AQ1B 4HKJB 1CD9B 3RVVC 4O9HL 4GKZA 3BFOA 4N5EC 3LPWA 3B9KA 1UH3A 3B3IA 4QLRA 2EXYC 1AR1C 3UC0L 1EMTL 4JVWA 1N59A 1TETL 4UAOB 4NKIH 5E7FA 3MBXL 5M94B 4QTIH 1BAFH 3R4DA 4OF3A 4KJPC 4E9LA 1YEHH 3CXHJ 2CDGB 1QFWL 3BZFA 2OZ4A 1OAYH 5B3NA 2EXWC 4Z77A 2C3VB 2FX8H 4M1GL 4S1QH 1UC6A 3RA7L 1WCQA 2XQYK 2UY6A 2HN7B 5EOTA 4IOIA 4HFUH 2JK5B 3S34H 3D3VB 1CBVH 1FV1A 4X5WB 2ADFL 1BVKB 3GHEH 2CGRL 3KPSD 4XZUA 3UBXB 4LGPB 3HFML 5DA0B 2K1MA 2X4OB 2CRIA 5DK0B 1KBGH 4NT6B 4YPJA 3IFPA 4LSUH 4X80H 2MSPA 4Y19B 1YNTB 3MLWL 1YPZA 3LKSA 4PLJD 5L2KD 1S7QB 4KK6D 1AJ7L 3SOBL 1I3RA 3ZE0E 4HJGB 4YHPA 3PL6C 2IQAB 5GSRA 4WI9A 5CFHA 1MELA 4C56A 2F54B 4PRHB 2BVOB 1FL3A 1GGIL 1YN6B 3BIBX 3GSWB 5I9QB 4LHUD 2X1WL 4FZ8H 5IVXA 3QH3A 5J3HD 3VFTB 3K80A 2H8PB 2YWYA 4ZS6C 4IRJD 5EPMA 5GGRY 3T77A 2VIRA 4R0LA 4XP4H 3HI6H 1ZA3A 1NGZB 2YUVA 1J7VR 2IFFH 2NY0C 2QHRL 4HV8A 5FECB 5IMLB 4XNQB 3FQWA 5ITFA 3MTRA 3V7MA 2CO7B 1JZ7A 2A0LC 5B8CA 5E00A 3RRQA 1I1AA 4FQHA 5JW4Q 2DWDB 5FUCC 3BQUC 1QSEA 3MRIB 4MNQE 3TN0A 5C0ND 1S7RB 2DL2A 3C5ZC 1GGYA 1B4JL 2DIBA 3OKNA 3BZEB 2NXZC 3PWUA 4BFBD 5E6IC 5EIIA 4WO4D 1XGRA 2ZUXA 2YD5A 2DLTA 4JJ5B 3QI9C 5IHBA 4YJZL 4HLJA 4P5TD 3GGWB 3UJJL 3L3OB 3T1FB 2P45B 4UOJA 1QFOA 5DURD 4PV8B 5JIIA 1P7QD 3B83A 3LN5B 4QXTB 1A3LL 4WI4A 1BM3H 1BOYA 4JN2B 4HC1L 2RGSA 3OG6B 4MQ7A 3FMGL 3BSZL 4DZ8B 2HH0H 3LEVH 2VZ3A 2H2PC 3D0VA 3MLSL 1T1ZB 2VDKL 3VRLE 2AEPL 2WINB 5C0IA 2BCKB 1W72A 5I17A 1J8HD 1C12A 1RHFA 3H7BB 3QZWA 4OZHE 1U93A 4K7FB 5IBLD 5JPMB 5GS2H 5J11B 1SJXA 2OSLB 4G43A 3K7UA 4P2OD 5DMIH 3I50L 3BT2L 3JV4A 3TO4C 2XKSA 3G5YB 4Z8FL 1QVOB 3MV8E 4RBPH 5GS1B 4F9LC 2XN9B 4MQTB 5DK2A 4OCXH 4H88H 1KT2B 3HRPA 1VA9A 3RY6C 3QSKB 1NC4A 4JY4A 3T1WA 3ULSA 1BD2D 4JM2A 5JXEA 1TTFA 5CJXA 3SDAB 2VLRA 1XR8A 3JUYA 4XNMA 5FK9A 3VCLA 3RWJA 2DQFA 1KB5B 1G9NC 2KDGA 4LLVB 4Y4KC 4NQDD 3L3DB 3PXHA 2X4NB 2VL5B 3F7YB 4QRRB 4HMEA 3MLXL 2GSGB 1U0QA 2PO6C 2ATKA 3D9AH 1K4DB 3WO4C 1IC4L 1MJ7L 1QRNA 3ARWA 1FSKB 1PKOA 3WEXB 3MV9D 4G8GA 5FYJL 1WTLA 1P53A 3QDJB 3UDWC 2G60L 2EO1A 4JFQB 2BVQB 1OM3H 2GK2A 3H0TB 3T0AA 1DN2A 3AU1B 1EJ6A 3DUHA 4OBSA 1MCJA 3KHOA 4HUNB 1I8MB 3ARFA 3HC0A 4J3WA 3WDHA 2R0KH 4FFVC 1A7NL 3TIEB 3H9SB 3RGVC 3R06B 5A3IC 3SQOH 4ZQKA 2JJUA 3IT8D 3E8UH 2GSIA 4R4BB 4R96B 3GZKA 3ZDYF 4FQLH 1S7WA 3D3VE 4ZO7A 2W1NA 3DURA 5DUBB 5T1MB 2V17L 1AGEB 3TA3C 3U30B 3U0PA 4YHKH 5GRVK 1HI6B 1T7VA 2HWZH 1HOCB 3FJTA 4NPYB 1NQBA 3KPLA 5FCSH 1G9NH 1IBGL 4Y19E 3QWQB 2YD8A 3OMZA 3BUYB 2ZG2A 1ZMYA 1INQB 3O6KH 1YJDC 5DQJB 1ZK9A 1HEZA 2CRMA 4MQSB 1U8JA 1MAMH 4FQPA 2F8XC 2F54E 4MS8C 4PJFF 4PRHE 5ICXB 3MV7A 1FFOB 5HHPB 2E8ZA 3F7RA 1HQ4B 1WCBA 1U91A 4RAVA 5FYLD 4H1LG 2IALA 4YXHH 3M17B 5D6CB 3V0VB 2FLBT 5HPOA 4MJ6A 1EFQA 4GLRH 4XWGH 3RUGF 4EI5C 4ZUSA 4M1DL 3P9LA 5IOPB 3VXQB 4LKCB 2JIXA 2F53A 5IESH 1EFXB 4H1LH 5AUMB 3MXVH 5CKGA 3MOBH 4K7PL 1QR1B 1S7VA 1IAKA 4PG2A 3MJ9A 4CN1A 4XVTH 4HXAL 3CZJA 4HZLA 5C0AD 4JY6A 1G7PA 3LRHA 3VRIB 4DKAA 5CCKL 2KQMA 3HNVL 4YQXL 3RWDA 3QNXB 4GXUN 3OXRA 2XZCL 1MWAA 1T6VN 4WUKL 2AV1A 1R5VB 2VO5A 4N9GB 2OR7A 4UNVA 3LKRA 1S7SB 2W0FA 4JKKA 1FFQA 2HRPH 2BXYA 3JWDH 5CSGA 1FCGA 1F4WH 1UACH 4L4VA 2HAZA 2VQ1A 4OLZL 1MREH 4XVUC 4X83A 1KTLB 3BD4A 4WHTA 3CC5B 5L2KA 4JPWH 3ZKND 2X4QA 3I6LE 2VXUH 4U6HA 1AXTL 1A22B 1DN0A 3WL9A 5CBAB 3VU2A 2NTFB 4WEUD 2X10A 2XACC 4RGOL 2B5IB 1OW0C 3FO1B 3EKCA 1NC2B 3HE6B 3TIDA 1FLRL 4RFEB 5F6IC 1R3HA 4LHUA 1DANU 3W39B 5K33A 1R0AH 4Z7VA 5J89A 2WM0A 3C60C 4LSQH 1ZVSB 3BZ4B 1NGQL 3HTLX 2LVCA 4U2YA 4YHZH 1MPAH 3LN4A 3O8XC 3UAJC 5GGVL 3MLYH 5ESQB 1YYLH 5B38A 5CD5C 1HSBB 2JJTC 1RIUL 4U1MA 2XN9E 4TVPE 2NLJA 2GK0A 4PJFB 3OKYA 3ZDXF 3SGDI 3BZFB 3STZA 2E9BA 3GSXB 2B39A 1MFDL 3O3DA 5DJAA 3O2VL 3RUGB 4NBYB 2DBLL 3WO3B 1NANH 5HYJA 1RSFA 4X5XA 4JQXC 4DAGH 1NMCC 5DO2C 4QRRE 4K9EC 1U8QA 3GJFB 3O2DH 4J7RA 5DDHA 2AJYL 3VW3L 3PGCA 4G8FA 4JZNA 1SYVB 1A6ZA 4KRNA 5D9SB 3AGVA 4LU5H 2G2RA 2E9WA 1II4E 2AI0H 1E6JL 3QPQC 3VFUA 3QDJE 4LGRB 4MAUH 2BSSB 4CVWA 2X40A 1RZJL 4TVPL 4FG6D 5C86A 2X4TA 5GSRB 1A6TA 2WLYA 4I3RL 4KXZH 1UADC 3P9MA 5BMFL 4F7PB 5TDNB 4YBLC 1HSAA 1TCRB 2LU4A 3KPRB 2R56L 3H9SE 1KLUA 2ARJA 4PD4J 4ZD3H 2X2YA 1FDLH 3QH3B 5I19L 4FQCH 5HHQA 3C2AH 5EPMB 1KB5L 43C9A 2A83A 3L3HA 3T77B 3U0TB 4OLWH 1JZ8A 1QPPA 1MI5D 3WLBA 3QDGD 5DRZA 4L3ED 4H20H 3GMLB 32C2B 1QUNA 3ROOA 3X12A 2VXSL 4HX1A 5EDXA 4G9FB 4Q0XL 1SJHA 2SEBB 4O58L 4X98A 2HFEB 3FQWB 1IQWH 3DARA 1CWVA 4FQHB 3KPQA 3BKYL 1INDL 5T1DL 3D18B 3IAPA 4JDVB 5JIKA 2CMRH 2VZ1A 2F8VA 3CDCA 4FABH 3UTQB 4EDXB 1MFNA 1UZ6F 4NO0A 4PJ9C 3EO0A 4JG0H 3TBTA 4QRTA 5EIIB 5IKCB 4L3AA 4C58B 2AXFB 1I1CA 4HPOL 3MNZB 3OAYH 1H3PL 3QIBD 2ARJQ 1DBKL 3B8YA 1FYHB 4KAQH 3UTZA 2IG2L 3SJVD 5IG7A 4ZAKA 2NW3A 3SGJA 1HKLH 5E6ZA 3HLAA 2ADIA 1JUFB 3EJJX 5IM7B 4ZOAA 1RUAH 4WI6A 2LTQB 1XF2A 4Y88A 4L4JA 2D03L 1GC1H 4AIOA 2VSCA 5I1EL 3MV9A 4B53A 5DSCA 1IGYA 5E8PA 5L7XL 3D0VB 1Z9OA 3FQXA 2DD8H 4WCYH 1UKQA 4V1DD 1LEIB 1ZA6A 2A9MH 5C0IB 4N5UA 4I4WB 1LO2L 5DD6B 1UWGL 4JRXA 5I17B 4L3CA 3PWLB 3CFJB 3LQAC 4N1HB 3VXUD 1OF2B 2HMID 3WBDA 3OR6A 3LKOA 4L1HA 1T04B 4GMTH 5EZOH 5SWSD 1HYRC 2BNQA 4ZYKA 4XI5C 4L29B 2JLLA 3F62A 3NCJL 4PRAA 3ULVF 5T5FL 3QUZC 3V4VH 1P4BH 5I1KL 1AGFB 4MVBD 3KYNA 3GBML 4HIEB 2WSKA 5CEYB 1AC0A 4IRZH 5GRVL 5EFIB 3CXHK 5EO1B 5J1SC 5KTEL 4UINH 1I7ZB 3N9GL 3MJ6A 1LMKA 4P99A 4TRPH 2DRUA 4YLQT 4JM2B 1GCFA 1PZUB 5IW6A 1XR8B 1GPOH 1DQDL 3ARDC 3ZDYE 4JFFD 3VXSB 2Y5TB 3MV01 4AYFA 4ODXA 4JO2H 2CO6B 3DECA 3H9HA 3KXFD 3QXWA 4EUPB 2R0WL 2RQ8A 5JW4M 1R3LB 2B2XL 2PCPB 1BF8A 1G7JB 3VXOA 5EIQA 3DXAB 2GY7B 1F2XK 3ISWA 3IDXH 1OGTB 1K6QL 1U36A 4LIQE 4AL8H 5IVZA 1C5DA 2IPUK 3WIFA 3LEYH 1JYWA 4WTZA 4OLXL 1Q72L 4LLMA 1DQJB 3EOAA 1A9EA 4XMLL 4OFIA 3BKJH 1S5IL 2YUWA 1AKJD 3FB7A 2PW1A 4PJFE 3GSNH 4YNYB 3ARFB 1UM6H 1CVSC 3LB6D 3AC0A 3I75B 4L8CA 1HH6B 4F7EB 2OK0L 1B2WH 3L6FB 3IAQA 3KLSA 3HNTH 1AIFB 4KY1H 3U7WH 1JPTH 2GSIB 2BVPA 3VXRD 3MFFA 1DSFL 1M4KA 3RUGE 3WSQH 4HLZG 3LKQB 4L1DA 1GOFA 5I15L 2IGFL 2XICA 4N9OB 1ACYH 1CXHA 5JMRA 4Z0BL 4HCRL 1HK6A 4YDJA 5ERWB 3CSGA 1UXSA 3SDCA 3B9EA 1EHNA 3G5ZA 3OKDA 4X7FC 1OWRM 1PSKL 3NA4A 1NBQA 4LFHD 5I8EA 1TVDA 2JJVA 1I4FA 3AY4A 2QHLA 4CDHA 2APXA 2C3HA 2NYYC 2VABB 1AGDB 3LHPH 4EN3D 3I3DA 1U8JB 3CPLA 5DJ0A 5FO9A 5DRXA 4HIHB 4ZUTB 2MHAB 3LEXA 1J1PH 4WU5B 2OZ4L 1W2KT 3KDMA 3NFPA 4JPIA 3KPRE 2EEDA 1PKQA 1QO3B 1U8MB 1R24B 4RAVB 3RPIA 1N7ML 4PYGA 2A2QT 4XVJL 3DX9B 4WI8A 5D71L 2IQ9L 4MA8H 1IM9A 1YEKL 3L5JA 4KKCC 3LDBC 4TSBL 3RL2B 1FFPA 1YEEL 1CT8B 5DK3A 1BWMA 4G9FE 4WI3A 1DQQB 1IFHL 3A6BH 2BVEA 5ADPL 3D0LA 1CFBA 4LGSB 5D2NC 1VFMA 4OZGF 1KPRB 4DFIA 2HFGL 1BVLB 2MQ3A 4U7KA 4PGCB 4TVSa 3HAEH 3IDYC 1CZ8L 5B39A 1TTGA 4AM0A 3D39A 4DGYH 3A0OA 3DTXB 3MUGB 4CDGC 1A9BB 3UYPA 4HS6B 3GRWA 4JAMA 1L7TL 1Q9LB 3KPSB 1A2YB 3D1MC 2AJXL 5DD1L 1J0YA 2UWEF 5D5MF 3B9KC 3TZVC 1WTGT 2DOCA 4WTWA 1XGUA 2FD6H 3BAEH 1F58H 3QEUA 2VC2L 4MB5A 3ZDXE 1MIEL 2YA2A 5FYKE 5HGHA 3OPZL 3C5SA 2RFXA 3U7YL 4TOYL 2V7HB 3MMEB 2Q6WB 4TULL 3GKWH 5L2KB 3HC4H 4PBXA 1QFPA 2EH7L 1YECL 3T8XB 2VDLH 1WAAA 1CIUA 1X5XA 3ARGC 2WV3A 4R7NA 5ACLA 5J6GA 4ZFOB 4HGWB 3IDMA 4WHCA 2VLKA 3OJ2C 4PJCA 1K3IA 3FHAA 4NSKA 3EZ8A 3L3IB 3AUVA 2XY2A 3WFCL 4L8BA 3TVMD 1P1ZA 1KPVA 1Z0NA 4LHUB 1A14H 4QXUL 4E42A 2E27H 2D3VA 2Q20A 3V5KA 1AO7A 3GO1L 2OXHA 4IRJB 3FT2B 1F6AA 3S4SA 3BPNC 3IKCB 4YE4H 1B9ZA 3WLWC 2BSTB 4LDLB 1MI5A 1A7PH 3QDGA 2ICWJ 1CFVL 3D25A 4L4TD 5B38B 4MXQC 4PJIF 4LAQH 4F57H 1TQCB 2V2WA 5EC2B 1CFQB 1DBAH 4HS8L 4RWYH 4S1RH 1KENH 2HT3C 2LAGB 4G6KH 5DJAB 2DMKA 3R0NA 4FNLH 4UT9L 2VN4A 3VXSE 5GS0D 1ZAGA 2E3VA 15C8L 5IMKA 1W72L 4WO4B 1IAMA 5E24E 4NN7C 3L1OL 1ZGLB 2BP3A 3P4LA 2J2ZA 3QIBA 1U8NA 3BPCB 4M9OA 4HS3B 3DXAE 1F4HA 4ORGA 4LCYB 4P5TB 2VLLA 3NCEB 2YHGA 2B0SL 3U7AA 4MXVF 1MUJA 3DVFA 5FUZL 1MOEA 4OZGB 5DURB 2VDNL 2G2RB 4DW2H 1P7QB 3HI5H 2OTWA 2UYLB 5C0RL 5B8CC 2DQDH 1I1AC 4BKLA 4AMKH 5C0BA 1UZ6E 3WCYA 1B88A 4OLEA 3QJFA 1BFVL 2Y06H 3MRPB 1QKZL 3TN0C 1HQRB 1A6TB 4WUUA 4UV7L 3UYOD 4MWFA 5FXCH 1J8HB 4CJ0A 5DJZB 3VXUA 1CDUA 4K8RL 4NUJA 3EYQD 2UWEB 5D5MB 2I07A 3CZFA 1JWUB 5HHQB 2XWBA 1PY4A 2P5ED 3GK8L 43C9B 5I66A 3WLBB 2OL3H 4PBVC 1A8JH 4P2OB 4X4XB 4ZO6A 5DHVH 3NFSL 2YPLA 2EC8A 3SDYH 4LK4A 3H3PL 3X12B 2EIBA 2O5ZH 3IJYA 4GQ9L 1MFBH 3V79C 1YZZA 1CXEA 4JB9L 1Q0XH 4GBXD 2H45A 3QO1A 5BZDA 2YKLL 3KPQB 4LCIH 4N8VG 4E0RB 3BUTA 2RCSL 3GI9L 5FYKU 5DFWH 4F7CB 4I3GA 2XZQL 4G3YH 1VERA 4JFHD 1BD2B 4Y5VA 2GTWA 4MZ2A 5BV7H 3IRPX 1IGFL 3JTSA 1T1XA 5T33L 5KVGL 2WUCH 1R5WB 2QBWA 3TT3L 3ULVE 2QJDA 4XPTH 1J5OL 3EJYC 5JUEH 4UQ2B 4NQDB 2UZIH 5MP6H 4GOSA 1T03L 3G6AB 3GBNL 2ZJSH 4PJIB 2NW3B 2YK1L 3QHTC 5GRJH 1CFNA 2AK4D 4PTUA 4QHKJ 1YMMA 5LCVL 2Y5EA 2QSTA 3BOVA 4QYOB 4FTVD 1FNSL 1MRCL 1UWXH 3VXMD 2DI7A 2XOTA 1T22A 1XF2B 1SHMA 3WNNA 3IFLH 2NY3C 1KTRL 2HTLC 1KYOJ 5AD0B 4G80A 4JFED 3S5LA 1MCRA 3X13B 2QV2A 4K8RC 3OL2A 5JXEC 5CJXC 5INDA 4U2ZA 3O4OB 1L7IL 1YNKL 1Y6NR 1A4KB 1JF1A 4GG8A 1HHJA 3BP7A 3OR6B 1JWMA 4GRWH 4NHUA 3W82A 4JQIH 4LF3A 2X7LB 2FR4A 1FFNA 1NEZB 4AIZB 3VXRA 2AV7A 4UIKH 1T0MB 3QQNA 4Q9RH 3O9WA 5SWZD 3EFDH 3KPSE 4JO4L 4HWEL 3DV6B 5SV3A 4UBDD 1VEOA 5F44A 1F4XH 4OCYL 5T5NF 1KTKE 1AHWB 1D5ZA 2CDFB 3G08B 3TNNB 2ZSVB 3H9YA 1DTUA 3F6IA 4AQOA 5IFHH 5J1TC 1V7NL 3EBAA 1RUKH 3HHRB 5IW6B 2HT2C 5L2KE 1MHCB 3JTTA 4NO3A 5JORA 4M8VA 3IDJB 5IFAL 4XC1H 3TBWA 5IQ9B 2J1KA 1I1YB 1NBZA 1NFDA 2EO9A 1FGNH 2IBBA 1MRFL 3IDUA 3MJ9L 4UTAH 2EDEA 2ICWA 5KAQF 1GGUA 4HUKB 3TBYB 4M4PA 1T7ZA 4KZDH 4PLNC 2CLRB 1R3JA 3CD4A 1DVFD 1M1SA 1I8LA 3WKML 3WMSA 1MCQA 3MGTB 1JNNL 4LKXB 4K7PY 2BY2A 4YR6A 2XV6B 1MWAL 1D6EB 1HNGA 4HHAA 2KPNA 4R8WH 4ODTL 2C1OA 3GI8H 4HGKC 4G6AD 1EDQA 2ZSWA 1ROWA 1FVCB 3WFDH 2R2BB 2MCG1 3NN8A 5I1GL 2VE6B 5IQ7H 3DGGB 4FQIH 4PD4K 3QEQA 1CR9L 4HUWA 2DJUA 5JHLL 2VXQH 1KOAA 1HHGA 2BNUA 3QEHB 5KJRL 3N1PC 3MRNB 5C0AB 3QEGL 1TZHB 4BFGA 3MFFB 4IEFB 2OLDA 3BO8A 4LCCB 3V6ZA 3VXTB 5HSFA 4N0FB 4LVNB 1MHPL 2X4PA 2IFGA 3DO7A 4XAWH 3VWKA 5C6PB 5BXFB 1JFQL 3KNBA 4LEOA 2BNRA 1JF5A 1LGVA 4ZO8A 2GCYA 2H6PB 4OZGE 1ORQB 1YEIL 3G5ZB 1RHHA 1LO5B 3KPTA 1NCBL 1PZ5A 4OD3H 1O7SA 3QCTL 2IPKB 5F9WC 5I0ZA 4U6VL 3PWPA 1BQHB 2YR3A 1UH2A 2H9GB 2I9TA 5DJ0B 1ZANH 2A6KB 4FFZL 1EGJH 3LEXB 3NH7H 1A1NB 2EE3A 5L8LB 1J8HE 1CQKA 2JELH 2J8UA 5D5ME 2UWEE 2Z8SA 2GITA 1RJZA 3TVMA 5GGVY 5JOEA 5AG8A 1O7VA 5F9OL 1YEGL 2QKIB 1C7TA 1KUMA 1FP5A 3ROLA 1F42A 4Y4HD 4JO1L 5FOBB 4RX4A 4PY7A 5IMMB 3LRSB 2BSRA 4NWTH 3K4ZA 4Z7QE 5E8EB 1SYSA 3PHQA 1LEKA 1N6QH 2MTPA 1MNUL 4Z5RA 4R4ND 1WC7B 4UIMB 4NKMA 4U0QB 1Q9KB 1BD2E 5DI8B 4KU1A 4WW2A 3ZYJA 1GRWA 3P4OB 4ISVA 1H8OA 2R1XB 6CGTA 2HFFA 3DRQA 4IOFD 5L8KB 3LZFL 3RAJL 5C0DA 1U8OB 4NQDE 2YD7A 3CDGA 2EIDA 3E2HC 3EUUA 4LPYA 1FGVH 4WEMB 5HYFA 3K4DA 5JW3L 4JRYD 2EIEA 4PJIE 1YYML 3L7FA 3UO1H 5DC4B 2XG4A 4PJHA 5IHUH 4PRIA 2DQEH 2J88H 3CUPA 5KZCD 1T1YB 5HGHB 3SN6N 3RVTD 2PTUA 5I1IL 1U58B 5LGHL 1I3UA 4H0HB 3LIZH 2XRAH 3O3EA 5DLMH 2MPAH 3TPUB 4ZUWB 4OUUB 2PR4L 3GUTB 2V9RA 4R7NB 5HYIA 1RD6A 4PJCB 4NSKB 4NZTL 5E8DL 4MXVE 2B1AL 4XPHH 2VZUA 3V5KB 4JO3H 4PY8J 3EOBA 5AAMA 3WUWB 5MEQA 2FGWH 2YRZA 1MI5B 3T3MF 4G5ZH 3S88L 1JIBA 4L3EB 5DT1H 1XEDA 2ICWI 3F6LA 1RULH 4BZ1L 5FKAA 4N8CH 3QP3A 4GKSB 1P4IL 4NQSA 3X3FH 5CP7A 5J9PB 5AYUL 4WGWB 4JKPH 4QHMA 5HGBA 1NCCH 4K23H 5C6TL 3RI5F 4K3EL 2YRPA 1FH5L 4I0PD 3PV6B 5DVLA 1NAMB 5LXGH 2BZDA 4U1KA 2NY6D 2QADD 3RHWF 4JQVC 5E94B 4D0CB 3GNMH 3W2DH 3P73B 3SO3B 4QTHB 1ZGLP 4HUUA 2BOBB 4JDZA 3CSYB 1P7KB 1K8DB 3GMOA 3F12A 2FIRT 2I60H 3QIBB 2A9NH 3JWOL 3WXVL 3SJVB 2VLLB 5IMOB 1SM3H 2MJWA 5FYLE 4C59B 1EO5A 4FP8L 3HMWH 3T09A 2CIKA 2EDKA 3VXMA 5K9QG 1OVZA 4D3CH 2GEEA 4OJFL 1JGVL 2IH1B 4JFEA 1MJ8H 5F7YC 4LRIA 4V1DB 1BBDL 1FO0B 4HDIA 2CLVB 5TDOA 1NGXA 4HFWB 4MWFB 1XF5A 3TYGL 3PDOA 1XCTB 4W6WB 1LO3L 1Y0LA 4U3XA 3QQ3A 4J8RA 4KHXH 5C0AE 3BP5A 3BVNA 5SWSB 4GO6B 1XF4A 3RZCC 4ZAKC 3S96B 5HGAB 5I1CH 4CJ1A 5JZ7D 4MSWB 5MHSD 2R8SL 4F8TA 1VGEL 1M6OA 4CN4A 4Y16A 5BS0A 2FBJH 2PTVA 3TJHD 4XGZA 3IS1X 4YXKL 1IGJA 4FQXA 2CR6A 5CHNA 1JHTB 5TH2A 1DQML 4YDVA 1N3NB 4KHTL 3LS4H 4KK8C 2CGRH 3JV6B 3MJ8B 4Y5VB 3H3BC 3SE9H 1T1XB 4KVNL 4HH9B 4OCMC 1MHEB 3NABL 1UKTA 4U05A 4NZUL 3JWOC 1BF2A 4JFFB 1KJ2A 5D93C 3NPZB 4PRPD 3KXFB 5A16A 1WFNA 3OAUH 2FATH 2Z31A 3O6FC 5HHNB 5E4EC 4OM0L 3MLWH 3O41A 4FZEH 5C07D 3L9RA 4PJ5A 1DVFA 4ZNEA 5GS3A 2Y1VA 4P49A 4QHKI 3VWJA 4P5KA 2H32B 1RVFH 3HE7C 3ZTJH 3DO3A 2WMPA 4I0CC 3MODL 1FYTA 1N64L 1M05A 1K5NA 3K74B 3I02B 3VRJA 1F4YH 3BE1H 1AKJB 1JMXA 3OGOE 4QXGH 4OT1H 4YUEL 3AM8A 4NRYB 4I3SH 5BW7A 4YHLL 4Q97A 4PRDA 2QHRH 2LU7A 4X6DF 5F1NA 4NHUB 2Z8WC 3O6ML 2FJHA 4KI5C 3DYPA 1JNLL 5H8DA 4Z7UA 2FR4B 4J6RH 1KG0A 1UFUA 3RKDD 4Z78A 1BLNB 4IJ3C 2EDFA 3EHBD 5J6HA 4AEEA 4G6MH 1E27B 1WF5A 4DEPC 3JV0A 4ZUUB 1INEH 4FRWA 2JB6A 4IMLA 1OTUC 4RGNC 5D2LF 2XZAL 3QO0A 1FNGB 4XPFL 2EDBA 3RX8A 2FJGA 3QHFL 5F89B 1TQBB 3RTQD 3T0DA 3K8LA 4RA3A 3GBLA 4RQQA 3KVQA 4AEHL 3UJJH 1DCLA 1NBZB 3NZHH 4P59L 4AG4H 4EN3B 2VISA 1AC6A 4PJCE 3S7GA 5DHYB 1UQSA 3UPRB 1E28B 2XXCB 1BGXL 4M48H 2W0KA 4HKXA 1FIGL 4TPRL 1RZGA 2AGJH 3QG6A 4IRSC 1S78D 4MDJA 2PN5A 4KTEH 4NQXA 2VDKH 4YO0B 2A6DA 5CS7A 4JDTH 4JFZH 1MI5E 4HHAB 3GRWL 4L3EE 1ZHNA 2R2HA 2A1WL 3GSQA 1QPXA 3W0WA 3LH2H 3MX0A 4U7MA 3ZDZF 1NFKA 2X89D 1G7HB 3G6JF 2ZSWB 4JFYA 4NOBA 1I7TA 5FV2A 4R4FH 3KPOA 2EICA 4PREA 3VFGH 2L4OA 4XBGB 3NN8B 1FZKA 1I9RH 3V9FA 3VGEA 4XNXH 3QIWA 1CXKA 4HUWB 3TFKC 3O45A 4QNPF 1NKRA 4KV5F 3CDFA 3QXUA 3BWAB 3V8CA 1B0RB 5TDPA 3UROR 1HINL 1EAJA 1Q1JH 2R2CA 1R6VA 2EYTB 2ADGA 1Z5LA 4CN6A 4DUVA 3EIFA 2DQGL 1WWCA 1I7UA 3VDAA 3BO8B 3V6ZB 3K8KA 3K0WA 4MAYA 3VFMB 3NIDF 3SJVE 4EDWH 3KLHD 1DDHB 5KSBA 1KPUB 3ALPA 1A6AA 4NCC1 5HHXH 1UJ3A 1VPOL 1X5HA 2VDQH 3MCLL 1U8IA 2LVEA 1K8IA 3IU3B 4X6DB 4M62H 1GZPB 4UTBL 1JGUL 1LQSR 3ZKQD 4P23A 1Z3GH 1OT2A 3F7QA 3MRLB 3MRGB 4V1DE 4RFNB 5GGSA 3KJ4B 1KIPA 1UB5A 1VFAB 3AS1A 4E5XA 3U6RA 2NY5L 3W11D 4U31A 1ETZB 3KYKL 4U1IA 2R23B 2FX7L 1OP5K 3TVMB 3WIIL 3PG2A 5D2LB 5KN5A 2WNGA 2CXKA 5GIRB 5TE7L 1EK3A 5BJTA 2ED9A 1H3UA 2XWJA 5SWSE 3STLA 2B4CC 4ZSOA 4HKBA 5C92A 2ZWLT 1KYOK 4F15C 4RMVA 3U36A 2X4UA 4L4TB 3MJ7B 1W0VB 4R3SB 1OSPL 1A21A 1C1EH 3ES6B 1WICA 1J1XL 4Z5RB 3BIKA 4I0PA 1L6XA 3ESVF 4L5FH 1CGYA 3ME0A 4JFFE 1ZHBB 1J12A 5EO0B 3T3ME 1RURL 2FEDD 2NR6D 3HR5A 3KXFE 3PP3H 5I9QC 2GTZA 4NZRL 4NRZA 1F8TL 3B5GA 3V52L 5EORL 4X6EA 5D72H 2CLZA 5T1LB 2DQHH 4RMTA 1LO4H 3PHSA 1AD9A 5LAXB 3RVXC 3U9PL 2A73A 2FL5A 4NQEA 3MLRL 1DEDA 3QDAA 4CMMA 1AI1H 4M7KL 4MD5A 4KFZC 2G9HB 2W07A 2YSSB 4OQTA 4UT6H 1O0VA 4LEXL 3T4AA 3UPAA 3CFEA 4PY8I 3LPFA 4KWUA 5DYOB 1HXYB 2DDQH 2P5EB 4ZFZA 3VFVB 3ZZ1A 5FA4A 3EOTL 2XQYG 5AWNL 1LEGA 2YPKB 1G7MB 3W9DA 1E4WL 4FA8A 1B6UA 3LS5H 2CDEA 4XXDB 4R2GC 5ETUA 2X1PA 4Z18A 1UYWL 2YMXH 3BYYA 1IEAA 1U8HB 4N0YH 5CCKH 1IGCH 1BVZA 3C6SB 4GBXB 2XZCH 4X6BB 1KCUH 1N8ZA 4H25A 5I30L 1D9KD 2WWKT 2ZOLA 2E9JA 3SPVB 5GGQH 2DBJA 1ZHLB 4H5SB 4BQ9A 1KN2L 5TJWK 4JDZB 3V4UL 3EJZC 1CK0H 5SX4I 3CCHA 1JNHB 4Y8DC 4JRWA 4M3KB 1X5IA 4I18A 4DKDC 5JDSA 3M8OH 3FCTA 1LO0L 2AK4B 2YEZB 3HNSH 4FTVB 2CIKB 1AXTH 3VXMB 4Q9QL 2IC2A 4RSVA 1MCFA 5GS1C 1Q0YL 1FLRH 3S37L 1TTUA 4P4RA 3U9UB 4M00A 3HN3A 3WIHH 3QAZC 4EIGB 1YA5A 3QUKA 3QQ9D 5E5UB 35C8L 1V3MA 1QFUL 5JQ6H 4MNHB 1KIRA 5TDOB 1NGXB 4RFOH 3QNYB 4PLOB 3CVHA 4PGZA 3L95A 1QNZH 1KJVB 1Q8MA 5HDBF 4MA7L 3QQ3B 5IF0A 2Y07L 4YBQC 4WWKD 2PKDA 4EJ1C 2ORBL 1H3WM 4PJEA 2BOCA 4LSRH 5A43C 3NA9H 3T0EA 4EEEA 4P2RD 2PYED 1VADB 5SWZB 1G6RA 3KPPB 4RCAA 3O2VH 5ISZD 1T3FB 3VFSA 5EO9B 3RJDA 4ETQB 2F58L 2DYPA 3TH2T 2HLFD 1TZGL 4M6MH 3NIFE 1WBYA 1SY6A 3O0RL 3WS3B 4YAQA 4UOW0 4X6DE 4HWBH 4Z95H 2GIYA 4FQ2L 2AS5M 2OCFD 3HUJA 3BP4A 1KGCD 4D9RD 2XFXB 3U4BL 2O5XL 1WIUA 5C0GB 3AREA 4YFLF 1EV2E 3EOYG 3GSOA 4Z7OF 1TNNA 4QRSB 1FBIL 4BK5A 1AGCA 3O9WC 3TBVA 2HJLA 5D2LE 1G7LA 1RZJH 5HYSB 1ZSDA 4P5KB 3L3JA 5CEZL 5CEXA 2Z0BA 3P77A 5BMFH 3OKMA 1SEQL 4OGZA 4XMKL 4DN4H 3OKEA 1NDMA 4ZXBD 3FFCD 4WFGD 2R56H 4L4TE 4CVZA 1VDGA 3A6CL 5H35A 5DMKA 1DANT 1V3KA 3MACH 5DJCB 2V5RA 4I2XB 1KB5H 1P69B 2OP4H 4FQQB 1CD0A 1KCRH 3PWVA 1K4CA 4LDEB 5KSAD 2VZTA 3ALWA 4Q0XH 4OLUH 1S7UA 4XTRD 3DRTA 2E7MA 1N26A 4O58H 2EKSB 1KG0B 1VSCA 3FONA 3MGOB 2DN7A 1PG7L 4XXCA 4XBPA 3D5OF 5FM8A 2R29L 3RVVD 1CL7I 1W0WB 2CIIA 3BWUC 3ZDZE 2DQIH 9CGTA 4LVHB 1FVDB 1NDGA 1A0QL 1KEMH 4N5ED 5D7JA 4MJ5A 5TGBA 1SJVA 4ZDHA 2EXYD 1AR1D 3RNQA 4YHOL 1KSRA 5KVDL 5DMJB 3WFEL 4QNPE 1XH3A 3SDDA 5GISL 3BJ91 4KJPD 4KV5E 5F7UA 5B3JF 2ADJA 3TYFB 2IG2H 2L0DA 3S35L 1RIHH 2EXWD 4ODBD 3T08A 1CLZH 1NFIA 4YBHA 2EEAA 2D03H 3NIDE 1RZGB 2BHZA 3WDJA 1R3IL 2OR9H 2M8XA 1T83C 2YWZA 3QA3B 4I77H 3IDNA 5JA9A 3VWKC 5GS0L 3CFCH 2P5EE 4M6NH 2YBRA 4PJDF 1S9VB 4Y4HB 1LO2H 2ATPB 4P48A 5IEKA 4WV1B 3OB0K 4NQCD 5CWSA 3FZUC 3UTTD 2APFA 5E8OB 2BRRL 1I7TB 2X44D 3MROB 3IXTB 4PREB 2DLFH 3K1DA 1JGEA 1T0NB 2YZ8A 3AAZA 3NCJH 3BPLB 1RJLA 3MLZH 4NKOB 3PL6D 1GAFH 4NUGL 3WD5L 1JHLH 1GZQA 4QRQB 4E41D 4NIKB 1DLHA 3FRUA 3IFOB 4R90L 4JFHE 4XCYA 4JPVL 1MF2L 3GBMH 1S9WB 3DMMA 4O5LH 4QRUA 4K3DH 2EH8L 4LLWB 5MERB 4GAYB 3T65B 2ZNXA 3GSUB 1G7QA 1I7UB 4ZS6D 2OJEA 2OS7A 3BJLA 2ZUQC 4HIIA 1JGLH 3HMXA 1XIWA 3X14A 3AVEA 4FXKB 2O26U 1TVBA 5SX5K 4JRYB 3MRQA 5KSBB 2NY0D 5C2UB 3IKKA 2AK4E 1MAJA 3ILQC 4GUPA 1UJ3B 5DJ6A 3DVNB 4FTVE 5GSVA 3GMRA 1KJMA 3VXME 1MEXL 3PGFL 5DS8B 4DGVL 5KZCB 1XZ0B 1OLLA 2OQJB 4LLYB 2A0LD 4WFHD 1X7QB 2B2XH 3G6DL 2PW2B 4PGBB 4JFOA 2F74A 3C09C 3BQUD 4IS6B 3SE4C 3C9NB 1K6QH 4N0CC 4B50A 1NLDH 5T1KA 2VUYA 1H5BA 1DBBL 4V2BA 4E5XB 2R2EA 3DX8A 4WJ5A 5GXBB 4GMSH 4QCIA 2P7TA 3MJGX 3OX8A 4M61B 3U79A 2VLJA 2MKWA 1JPFB 4JFXB 2Z9TA 2Y25A 2EE6A 2E6PA 2KZWA 2E8YA 2HP4A 4W4NA 1RZKL 4F58H 3P30L 1WVZA 5H2BA 4IDJH 3RWFA 1VFBB 3TO2A 3C6LC 1TPXB 3U36B 3O3UN 4JVUA 1VEMA 5SWZE 3A67L 5HYQB 3GSVB 1SBSH 3PE9A 3GKZA 2C4FT 3FQUA 4RISL 1YEDA 4GAJL 2ED8A 4Y2DB 2H2PD 1UCBL 2IGFH 4X7SH 1ZS8A 3P11L 3LD8B 4Z0BH 4HCRH 2O61B 4LARH 4I0PB 2H3NA 3T4YB 4GRLA 2NY6B 2P5WA 2QADB 4QHUA 1F97A 4PJDB 2AJUH 4L8DA 4LIQH 4KPHL 4CL7A 4MXWL 4ONFH 5D7KD 4H26B 5C09A 1H15A 4GG6F 1U8LA 1AGBA 2W92A 1I8IA 5GGRB 5F7KC 4H8WL 1HIML 3TO4D 4UDTB 4OKVA 4ZNEE 3HCVB 5I1DB 1CG9B 4X6EB 1DBML 1CGXA 2BERA 4HK3J 4DWHA 3ZTNH 1A6VL 4XP5L 1YC7A 3UEZA 3EDEA 3GIVA 2VOTA 2XWTA 1LE5A 2IADA 5AEAA 2ZPKH 3QUMA 1RIVH 1A7RH 1LNUB 4XCFL 5KW9L 4JPKL 4I2XE 1PQZB 2EDWA 4XP9H 1ZT7A 3NMEA 2Q7YA 5IFJB 1OHQA 2DTML 3NFNA 4UV4H 4ZFGH 2Q8AH 5MEND 4M7ZC 1YUHA 1AE6L 5CLWA 5CSZA 3GJFH 1T66D 1KFAL 2ZUTA 3T4AB 5CJQL 1IFHH 1KJ2L 4ALAL 5ILTL 4ZUVA 4A6YB 4WWKA 2PO6D 1LEGB 1EEQA 2FJFB 1RZ8A 4UZGA 5IEHA 1ND0A 2VITA 2NTSP 4DCQA 1EEUA 4NQTA 2VXTH 2VDML 3THML 3CFDB 2GJ6A 1IEAB 1MRDL 3V95A 4C57C 2LTQC 4YGAB 3TT1L 2IEPA 5EU4B 4LRIC 3B9DA 5HDBE 1CE6A 3U46B 4H25B 5J12B 4XVSH 1UXWA 3TH4T 3CXDL 3VD9A 5FHBL 2COQA 2AABL 1YMHB 4MX7A 5JIPA 4LBEA 1CTOA 5A3ID 5I1HH 5T3ZL 2VC2H 2RB8A 4PRPB 4M03A 4NJ9H 3OPZH 3CCHB 2DL9A 1MAKA 3U7YH 5DJXA 4TOYH 3RWIA 4LRNH 5IR1A 5T3XL 1GXEA 3OJMB 5C07B 2OI9C 1UT9A 2JJSC 1I1RA 5D4QA 5JDSB 2YD1A 1T2QH 1RZ7H 1CFTA 4GT7A 4B0MM 2WUBL 4GKNB 3RL1A 4M43L 1AXSB 3NBNA 1ZWIA 4MLSA 3REVA 5JOFA 4UT7L 3FFCA 3QFJA 1ZLWH 4QXUH 1T7WA 3RY4A 3N50A 4P4KA 3GO1H 1CD8A 5FB8B 1FZOB 4CVXA 1ZLUK 4GG6B 1NCWH 4JY5L 3VFPB 1Q94B 3O3BB 4J3VA 1D5IH 4WI2A 5KSAA 4J3OC 4TUOA 3VXNA 4MS8D 2Z31C 3SE3A 1HWGB 5FM5M 3TJEH 4P3DA 1BREA 1J87A 5IWLC 2HVKB 1FG2A 2EYRA 3PP4H 3QXAA 3FL7A 2ICEB 5FYJD 1CF8L 5FYKH 4GW1B 5HD8C 5DFTA 4FFYL 4HS8H 4BZ2L 3MBEA 4MCYB 3H3KA 1JHKL 4EI5D 3BP6A 5ICZA 5C0CD 1G6RB 4JRYE 5DVOA 5KSBE 2DWEA 4NNYA 4APQD 4K7PX 15C8H 2AK1L 5FUOH 4N1EA 4DK6A 4PP2A 2QR0B 2YN5A 3L1OH 4OD2A 3RTQB 4AT6B 5FDWA 1TJGL 2GFBA 1ZHKB 3HRZB 2D7TH 3BP4B 1C5CH 1F3JA 4DVBB 4ZFFA 2AXHA 3BKML 5IK3B 1X5GA 3KYOA 5EUKA 4BH7B 1BQLH 4J4PC 4RIRA 5IB5B 1QLRB 4X7EC 2Z8VC 3U1SL 3C8HA 1XR9A 5E2WH 4CADA 5IB1B 2X05A 1BQUA 4WY7L 5ID1A 3EYUL 4FQ1H 4IOSD 5L2JB 4EUPG 5B3JE 4CNIA 5IHZA 3MRMA 1YQVH 4YK4B 2VTFA 4XVUD 2V7NA 3X17A 3BDYH 1J0ZA 2IAND 4FQJH 1YY8B 5EZLA 3TNMB 4JCLA 1A1MA 5TF0A 4EUPH 5JOPD 3PWVB 4O2EA 1FL5A 2R9HC 5CUSH 1MFAL 1LWRA 1BJMA 2ERJC 3ULVC 2V9QA 4G7VH 4JHAL 5MEOB 4PJDE 3QUYC 5HPMB 2CKBB 1M7DA 2WBJA 5DA4A 1NMBL 3FO0L 3ZLQC 2R69H 4LOUC 2AEQH 3C60D 3MRFA 3MRHB 4RAUA 5IV2B 2XZQH 2CD0A 3WXWL 3BGFC 5F21B 3O8XD 3UAJD 1QQDA 5TGBB 3VD4A 3DHMA 5KVGH 4K94L 5CD5D 4YFDB 3BGMB 4NKDA 1G9MC 5A2LH 5TE6H 1J5OH 1CGSL 5CP3H 2EDNA 1G1YA 2IPUG 3MLTA 1T03H 2I26N 1BBJA 2YZ1A 3QIWC 1M7XA 1JL8A 2P24B 5FCUL 1U95B 5C0JB 5E2UL 1F45A 4HT1L 5HDOA 2QQNL 3C5ZA 1JJUA 5JW5A 4OI8A 5IIEB 2I9LA 4TTDD 4U1JA 5E6IA 1FNFA 3QWRA 4AEFA 5I71B 2FEEI 1X44A 12E8H 3MUZ1 3OZ9H 3QI9A 4MAYC 5DO2D 4YGVB 1EZVY 3AXLB 3FFDA 3OGCB 1A4JA 3QCUH 5MHSE 5IEKB 4WENB 2FSEA 4JZJB 1N5AA 3QPQD 1DP0A 4NHCH 5IW1A 4K3JL 3ULVH 2DQTL 4YDLB 3CH1B 3SKNA 3JVGC 3WE6A 1IAII 4P23C 1BX2A 4MDIA 1QLEL 1GZQB 5KVEL 1CLYL 3MNVB 4R26L 1TVHB 4PFEA 4JO4H 4U1NA 3V4PL 3NACL 5DMGC 5E9DA 1J18A 2DF3A 1CL7L 4PRPE 2PTTB 3KR3H 1V7NH 1MJJB 5DMYA 1G9MH 1FPTH 3QDMD 4N0RA 5LQBL 2R1YA 5J3HC 4OQTL 4OCSH 2MKLC 4UQ3A 5C07E 1S9XB 5CZXC 4OIBA 5DJ2B 1MRFH 1KJMB 2CPCA 4ODHL 2FRGP 4EVNA 1W8NA 2Q1EA 3GFUA 4Q58C 4UILL 3RY6A 2NY7H 3BPOC 2XKNA 2IF7A 2VKWA 5FDYA 1I9JL 1TQCC 3WKMH 1AQDA 3WDIA 1H5BB 4GG6E 4PJ9D 4WDIB 3DX8B 4PGJA 1KJ3L 4QCIB 5ANMA 4UUJA 4Y4KA 4K07A 3ECBB 4YPGB 2R15A 3AMLA 3DV4A 3F7VB 3CLFH 4XPGL 5DEFA 4XCNB 1EHXA 4WO4C 1WFUA 4HUXB 3V6FA 3NCCB 1B0WA 4O00A 5JHLH 5I2IA 3CX5J 4P5TC 5DJYA 1HILA 3HPLA 5F7DB 4JG1H 4LHUG 4LMQI 2C7UB 2FECI 5HVWA 3FQRB 4JGMA 4EBQL 4DVRH 5CJ5A 5KJRH 2E6QA 3UDWA 3U4EA 5HHMB 3MLVH 3C08L 3G9VA 1FAKT 3BRDA 4J3UA 3NZ8A 1LK3L 4WI5A 3D69A 4FXGB 1MHPH 5B38G 1D9KB 4LCWA 1DUYA 4OD1L 4H1LA 1NLBL 1NSNL 1UEMA 3PWNB 4NQVB 4R6UA 3RGVA 1ACZA 5BOPA 4XI5D 5GHWH 1H15B 3L7EB 3LPGA 4ODUA 4PJXA 3DI2B 5IBLC 2WIIB 2A77L 3QUZD 1I8IB 1RFDH 3GMMB 4P2QD 4L8SA 1IC5H 4U6VH 1IE5A 3GMPB 3TA3A 1CDGA 1FE8L 3G5VA 4Y4FA 5F6HJ 4OB5L 5DD3L 1MFCH 4XH2B 4GW5B 2P49B 1URLA 2EDJA 2AEIT 4OF8A 3IXAA 1G6RL 4O4YH 3PV7A 3V5DA 4OM1L 1BZQK 3QRGL 5F9OH 4BSWA 1T4KA 2V2TB 1F11B 1PY9A 3ARDD 1E4KC 5E4IA 4HKZA 2Q7YB 3QUXA 4LL9A 4QO1A 4D9QD 2DTSA 1IQDA 4BA8A 3QCVL 2AXGA 5L6YL 2CJUH 4PS4L 1WWAX 3IU4H 5EU7C 2DKMA 1S7TA 4OGXH 4I18C 4ZUVB 2EDTA 1LDPH 3LQZA 2CH8A 3UYRH 5I1JH 1VFOA 3ARTA 2ZCHL 1FAIL 1M71A 4P2RB 2PYEB 5C0CA 5KVMC 2PXYC 5ISZB 3GSRA 3D2UA 3D85A 4Q9BA 1I9IL 3EDFA 1XF3A 2HJFA 5CBEA 4GAFB 4PRNA 5D1ZA 2X6MA 1YNLH 2FB4H 4GAGL 3FB6A 5ENWB 1Z6JT 2OJZL 3NAAH 3R1GL 4PG9A 2QEJA 1RAMA 2X4SB 2CUIA 3Q1SH 6FABL 4UI2A 3OHXB 3ZL4L 4DZBB 3RWIB 4YDKH 2VDPL 4CMHC 5LGHH 1IGTA 3X3GL 4PR5A 1AFVH 3QHZL 3V8OA 3VFRA 4K3HA 5E2TH 2DMBA 2FZ3B 1NBYB 3T0EC 1R3KA 1NUGA 2J5LB 1BEYH 3MREB 1NH6A 4O02L 1PVHA 1A1OA 4M7JH 1FZJA 5TFSL 3OF6D 3K81A 3B5TA 4M8QB 4QY8A 3REVB 4OFVA 1KIQA 4ZXBB 5HJ3B 3FFCB 3WFHB 3B2VH 2R4SH 3O2DA 3OXSA 1CFSA 2IANA 4N0UA 3VI3F 3MRJB 2NYYD 3S88H 4HULB 5KSAB 5ID0A 3AREC 1HYSD 1XAUA 5E5MA 3KYAA 1P4IH 4P3DB 4F33B 2D0HA 4YWGH 4I48B 3VGBA 1RZIB 1WZMA 3C60A 3OR7A 3P4MA 1KCSH 4LSVH 4RGMC 3O8XA 3JWNC 4D0BA 4LAJH 4NNYB 4XBEH 5DEGA 5HVHB 2JJTA 1NEZG 2KBGA 2E7LC 5KBNC 3VD7A 1DFBL 1JN6A 4JR9L 3FO2A 3WXVH 5C8JA 3CK0L 1F90H 5DD0L 3HZYA 3QG7H 1WISA 3HI1B 3IJSA 4Z76B 1YEFH 5C2BH 5GRZA 3GMNB 3Q6FB 4RIRB 1V7MH 2IH3B 4GLRI 2AJSL 2Z4QB 2NPLX 3PJSB 1D6VL 3KS0J 1AD0A 3O4LA 4BSJA 5FHAH 3C87A 1ITCA 2DM7A 3S98A 4U1HA 4P3WA 5D7JC 2DLHA 4LCCC 3B9KD 3TZVD 4DQOL 5I76A 2N4IA 3T2NH 3HMXL 4NQCB 4D9LH 2NNAA 5IHZB 2D0GA 3UTTB 3FT4B 3SDDC 1UB6B 1HH9A 3B6SA 3F58H 4M5YL 3I3EA 2NY1C 5HHME 1IM3B 3ARGD 3QXDA 4WTZG