3SGKA

Unique carbohydrate/carbohydrate interactions are required for high affinity binding of fcgiii and antibodies lacking core fucose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
209
structure length
209
Chain Sequence
b'GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fc fragment
molecule tags Immune system
source organism Homo sapiens
publication title Unique carbohydrate-carbohydrate interactions are required for high affinity binding between FcgammaRIII and antibodies lacking core fucose.
pubmed doi rcsb
total genus 39
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgkA01
2DIAA 1IZJA 3MBXH 1AD9B 4KKBC 4H88L 1IKFH 2W59A 3FB7A 2VB5A 2NTFB 4M1CD 5CMAA 3BHBA 4M4PA 2BNQB 5BRZA 5AUMB 5JOEA 2HYMA 3MR9B 2VLRD 4JM4L 1M7IB 4R97B 2APXA 2X4OB 1LE5B 1G6RA 4IIQA 3P4MA 4JDTL 4DVRH 2BC4A 4FNLH 4OZGE 1I3GH 1KPRA 2Z4QA 2RFXA 1H15A 3HG1D 5F9WC 2YPVH 1R3KB 5E00A 1XF1A 1E6JH 3ARPA 2NY3C 5GJSH 4I9WE 4Y4FC 4FHBD 4PRPB 4IDLA 4NHUA 4U7MA 5IROC 1UFUA 2CIKB 5C92A 3RUGA 3NFSH 4HC1L 5B3JF 2V5RA 2QLVB 3GBLA 2JIXA 4XPBL 3NZHH 3LKOB 4JFOA 2P43B 1UJ3C 3L5HA 1GIGL 3KPRD 1KACB 4OQ1A 2ZSWA 4JZNA 5TE7L 5C0AE 1MFDL 1NGYA 5H35A 1MWAL 5D2LA 3PHOB 4NKDA 3P0VL 4UBDD 3HAEB 1JGLH 1FO0A 4J4PA 15C8H 2AI0L 3OPZH 3FHAA 1RFDL 1AP2A 2Y23A 2A9MH 2MHAB 3IDJB 4XZUA 4HDIB 3QHTC 5EOTA 4PJXB 3D25A 8CGTA 3KPNB 1GGIH 1MCCA 3HNTL 3QQ3B 4J3TA 2HVJB 4IRSB 4M9OA 4U3HA 1S78C 1KFAL 2O93L 2YPVL 3P3YA 3ECBA 2AK1H 2X4PB 4Q2ZA 2R4SH 5HYIA 3WEXA 1ZGLA 3BD4A 3SDAB 4XB7A 5E95B 4Y1AA 3MOQA 2PO6A 5SX5H 2WWKT 1P4IL 2R2HB 4YHIA 4M8VA 4I48A 4XC3H 1NFDE 4JFQA 3RGVD 4YQXL 3B9KA 2CJUL 1UJ3A 1ZEAL 4XNXH 3BPOB 5MEPB 1Y6MR 3IJHB 2VXUL 3IJHA 1FGNH 1KN2H 3GSQA 4Z0BL 1BFVH 4KK5D 1EZVX 3AS0A 4OZHA 3TGXA 5C86A 5L8JB 2OK0H 1H3VA 1R24A 2Q8AL 1C5BH 4C4KT 1RURL 2YK1H 3NAAH 2D7MA 5GJTL 5E8OA 3VG9C 3MRQA 3O3DB 1BIHA 5L7XL 1RMFH 1FSKC 4GRLA 1BZQK 5HDQH 5F6IB 2ITCA 5MI0C 1T21A 3QXDA 1CN4A 5EUKB 3EAKA 1HH9A 2XKNA 1R5IB 2XPGA 2J8UE 4EN3A 1VERA 1IAII 4ODUB 2VKWA 3VWKB 4FMFA 3VGFA 1PYWA 5MHSD 3O3EB 4JE4B 4EUPA 1ZGLM 3EYQD 2R23A 3BPLC 1M1SA 4JFXA 5TPWL 4XWOC 1AE6L 3CLFL 4F7MB 3UJJL 4LU5L 4GBXB 4NN7C 3W9EB 4PJEB 2Y25A 2E9WA 3L7EB 5GGVH 3QUML 4GQPH 3RZCC 4BFBD 4M5YL 1J0HA 4LBEA 5D7IA 2VLKE 2XIDA 4PRDA 3NFPA 1A4KA 2BY2A 2HJLB 2NYYC 2WBJD 2Y07H 5CP7B 2R2BA 5IHUL 3EDFA 5A43C 2IMNA 3FQUB 1KTKE 4OD3L 1GAFL 2XN9D 2AEQH 3O6MH 1CGSL 4YWGH 5FYKH 1QNZL 3PGFH 3MGAA 1XH3A 5HI5C 2X4OA 3UAJD 4CJ0A 2W0LA 3W2DL 2VDNL 3IDNB 2OI9C 2R9HC 3ZKXC 5DUPH 5EORL 4PJIF 5DK2B 2OBGA 5C08B 4PRAB 5JW5A 1ZSDA 2NY4C 4PJIB 3OV6A 1K8IA 3SDYL 3ROOB 1FE8H 4PJ9D 4EI5B 3G5ZA 2I07A 4G8GB 1CGXA 1YDPB 1MF2L 4OGAC 3LKNA 1FVDB 2AK4A 3ESVF 2EEDA 3OKDB 3U4AA 1XF3A 4ZTOH 4LCCB 1DP0A 4Y5XB 5DO2D 3SDAA 1V3MA 3D69B 4KKNA 4G8GD 2HG5B 4HIXH 1QRND 2WUBL 2YSSA 5HDBE 5JW5B 4I9WD 5GXBB 5ACZA 4MQTB 4PRBA 5T3ZD 3QQ3A 1N4XH 4JGJA 1GHFH 2P5WA 4IRSD 3GMMB 4UV4H 5BCAA 4AEFA 1FIGH 1CLYH 1FNLA 2Z91A 1D7FA 2CMRL 1KN4H 2Q86B 4BYHA 4X5XB 4Y4HA 3GHEL 3ARQA 3EYQC 3S3JA 5ICYB 1Y0LB 4L29A 1MFBH 5C7XH 3K3QA 3MPCA 1GJIA 2OR8A 3EDDA 3QNZB 4QGYA 3JXAA 1VDGA 2ESVE 3E3QE 4UTBH 2P42B 1FH5L 2COQA 3CSPA 3K4DA 3MRFA 2BSTA 5IGXH 5E4EB 3EYSL 3EYFB 5BVJA 1GCFA 1U9KA 2R1XA 3JUZA 1YY9C 4S2SB 5FA3B 3ZDYE 4P5MA 4HWZB 1L0YA 3QJFB 2R9HD 4LVNC 4RAVA 4MD5A 1ZXQA 1YC8A 2EH7H 4HS8L 1T6WA 4KK5C 4XAKE 1DBBL 4N1HB 5TF1H 3ORJA 2MWCA 4ETYA 1YEIL 2VABA 3UYRL 5MEND 5SWZA 3R8QA 4I0PB 4O00A 2BCKA 1A2YB 3FB6A 4UINH 4WVRA 3KPRE 4L5FL 2CLZB 3I75A 4WFEE 5SX4H 1B2WL 2F19H 3PWPB 2WWKO 1A7BA 2YS4A 4IHOB 4L8SC 3O3BB 4PV9B 4K7PH 5IV2A 4MCYB 4PGJA 5DEFB 5JUEL 5J1AA 4F3FB 4RGNB 4KHXH 4U1IA 1CLYL 3KPLA 1EVTC 4LDLB 4XX1G 2VH5H 3BDXA 3LQZA 2ERJC 3EDKA 2GQHA 1A14L 5GSVA 5FGCE 1UVQB 1Z3GH 5D70H 3NTCL 2E7LC 1K8IB 3EOAA 2XI9A 2WUBH 1EV2E 2W65A 3H2WA 1TXKA 2C5DC 1I9IL 4O9HH 3HS0B 3RDTD 3K7UA 3SKOA 1Z0MA 3V4PL 3IDYC 1Z6JT 3H9HB 4EBQL 3D3VD 2VXTH 5SWSB 5MERB 3CNKA 1U8KB 3ROOA 3GMQA 4KWUA 1YEKH 1DBMH 4PJ7E 4WI8A 1I9EA 1RZ8B 4KKLC 2IJ0C 1NFIA 2PTVA 4XCNB 5GS2H 4ZQKB 1DUZB 4R7NB 2CO7B 3NA4A 4TSCH 3MA7B 1LK2B 1MCHA 3B2UD 1ZA3A 4IRZL 4B5EA 3P30H 2W9EL 1AGCA 3MV11 1FN4A 1JFQH 7FABH 4OUUA 1EEYA 5T5FH 8FABA 1FDLL 4HG4J 3PNWB 4LPUA 4PJ7B 3UTTB 1M05A 4XAWL 4MS8D 4YPGA 3QO1A 1XR9A 4K8RL 2WWMD 2R0WL 4MAYA 2CPCA 9CGTA 2Z92A 1QPPA 4G9FD 4P2QD 3SE3A 5AWNH 2FX8H 1XF4A 1INQA 3GNML 4YXKL 3WJJC 1SJEB 1G7PB 3O4LA 4HC1A 2BOBA 3K0WA 4KJYB 4MXWH 4UQ3B 1A8JH 4JFFA 4QRPE 1F4AA 4YE4H 2VH5L 3CFDB 5E9DB 3WHXA 5DD5L 4XWGH 5EIQA 4TUKL 5C0JB 3O81A 5KS9F 3FB8B 3SY0B 5FOJA 1HZHH 3M1BB 3O6FC 3T4YB 2EO9A 1SYSB 4XP9L 3RVTD 1FLRL 3GSNA 1AFVH 4HWBL 4ODSH 2W38A 2Z31A 1U6AL 4GFTB 3MV9A 4NN6B 5FIEA 3TH2T 5B8CB 2X4NA 3PWVB 4ORZC 3PWVA 5JR1H 1IGJB 3K74B 1MIMH 3OZ9L 4GRLB 4WY7L 5H37H 3WO4B 5E5RB 4BFEA 4GOSA 4NCDA 1I1FB 1WLHA 3WFBH 2HLAB 3NCMA 1G9ML 1X5FA 5T1KB 4HWNA 3ARWA 4KU1A 2V2TB 1UH3A 3ARBB 4OCYL 5DK0B 3VFRB 1PW3A 2YD2A 25C8L 2XN9E 3MREA 4JY6B 5LAXA 4LGPB 1Q0YL 2WP3O 3FFCE 3MRLB 1SVCP 4G6FD 1Q8MA 3IT8D 3S36L 1P1ZB 4S11A 4OUOA 4QNPF 2MQ3A 5I30H 1KIUA 4LP5A 4PR5B 5I75C 1PZ5B 3GJFK 3O8XD 5EIIA 1ZANL 4JB9L 5EBMB 2NTSP 3HNSL 4MWFA 3GMPB 5JORB 4P2RE 1NC4D 2W92A 3MJGX 1UADC 2WM0A 1HH9B 3OHXA 2I9LB 5EO1A 2JJWA 4FQXB 4P23B 4XCCL 4MCYA 4LQFL 3N06B 4M43L 2M26A 3O2DL 2HFFB 2CMRH 5C0AB 4WI6A 2CLZA 3MRIA 4ELMA 3LVEA 5FUZH 3VGHA 3TYGH 1GHFL 5EUOF 2A77L 3TZVC 3U0WH 4NM4H 4X7CC 5D2LB 1AC0A 3ROLA 1MFNA 2BOCB 1N26A 3O2VL 3IKCA 1MHEB 2OJEA 4OZGA 3C09B 3W0WA 5FKPB 1FO0B 3VXME 4XVTL 1LVEA 3BUYB 2J6EH 3W81A 3JZ7A 2MQCA 1ZK9A 3OPZL 4LSUL 3MRRB 4ERSL 3QUZC 4GKOA 4J1UA 4ELME 2AJUH 2LU7A 1MQKH 3GSWA 3GM0A 3GSWB 2ZOLB 4CAGA 4PREB 1JBJA 4X99A 3A6BH 4NYLB 1H5BB 2JIXB 3ARFB 4JFZH 1CDUA 2Y7QB 2DL2A 3K4AA 1CICA 4Z78B 3M07A 2F5BL 3ZT5A 4ZPVA 1II4E 2YUVA 1UA6H 1YPZA 4EOWL 4O5LL 5CEZD 2ARJA 1YEFL 1OTTD 2FR4A 4KQ3H 4G3YH 1BQHG 3DV6B 3MRPB 4TQEL 2GCYA 5DVOA 5BXFB 2FZ3B 4LGSB 2X9YA 3G6JF 1IEAB 3PL6D 5HVGB 4AIXA 3I2CL 2YC1B 5BZDA 4QRRA 3JV4B 2Z91B 4W70A 3SDDD 1Z2KA 4XAKD 5EB9A 3IGAA 1YJDH 5HYSG 1OAQH 4JM4H 1JI1A 3JUYA 5ITFB 4S0SD 1PKQA 5DUML 2X6MA 3TT1H 1ZOXA 1BVKA 3DNKA 1K2DB 4FP8L 4HT1L 5E8OB 4Z0XA 5JW4M 1B0WA 4O2EA 2YD3A 3UXFA 1HHJA 5BMFH 4JANB 1PJ9A 3KNBA 2R8SL 5ISZB 2BSRA 5LWYL 2BY3A 4E42B 1QSFA 2NY5C 1KJVB 4ZDHB 4B41A 3VJ6B 2IPUK 4UOW0 3RPIB 3LKSA 4HF5H 2O26U 1MVUB 2EZ0C 4Y4HB 5K93A 2XXMB 5JO5A 3VXSA 4AEEA 4Z7UF 1U8OA 1CDHA 3FOLB 1G9MH 3FOLA 1T7YA 4V2CB 3R0MA 4U1NB 1CDJA 3D1MC 3V5DA 1MY5A 5T3XE 4JHWL 3O9WC 4JQXC 1HILA 1MOEA 5SX4I 3LRHA 3PQYD 5D5ME 1C5BL 2YD5A 2ZNXA 1S5IH 4PRDB 2R1WA 2FDBP 1I9RL 2DQEL 5GRYA 1C1EL 5FXCH 4WW1B 3PP3H 1N2RB 5FYLD 1IQWH 4U1IB 1V8HA 5I19H 4X7SL 3WFCL 1LO2L 3GO1H 2Y5TA 4LSQH 3HC4L 4OZIF 5HHMB 1VSCA 1N8ZB 5DJZB 4AQOA 4N0RA 4BZ1H 3WKNA 3DI3B 3Q0HA 4HEME 4MA3B 3VFSB 1G7MB 2HJLA 3UTPD 4P3CH 4PJFF 1WZKA 2VZUA 1AIFB 1QKZL 1FVEA 1MCJA 4N0UE 1LD9B 3BO8B 1VEMA 1JF1B 1C7SA 5DA4A 4PJIE 1Q9WA 3SJVD 5HI5D 3TO2A 4OKDA 1JTPA 2X7LB 4FTVD 5I8OL 3NCJL 5T5FL 4PJHE 4WGWB 5IW1B 4P59H 3WIHL 5DRNA 4I3GA 5TDPA 1RZKL 1WISA 4KZDH 4NYLA 5BJTB 1IFHH 3V6ZB 5T3XL 1FGVL 1W0VB 1CU4H 1DVFA 2H8PB 4N0UB 2G60L 1URLA 5CLTA 1JGVH 1ERNA 5DI8A 4KH2A 5E1AB 2QQKH 3VXUB 4PTTA 1UWGH 4BZ2H 3W0WB 1AO7D 4E0RA 1CE6A 2Y1VA 3RX8A 4PJHB 2AXFA 1CK0L 1AD0B 3IFPA 5C0BB 3ZT6A 4KVCH 2NYYD 1CR9L 2PO6B 4G6AD 3D85D 3FTGA 5IM7A 2NZ9D 4H5SA 2BNQD 4IMLB 3BUTA 2ESVB 3HUJF 4YBLB 5IB5B 3VXMD 1OB1A 2A6IB 4CN6A 3ZDZE 4MNGA 1KEML 1I7RB 3HPLA 2V2WB 3WEXB 1IQDB 1DUYA 2NLJA 1QYGL 4KDWA 4HWEL 2VR9A 1A6UH 2GJZA 5EOCH 3MOBL 4F57L 5CWSA 1CFNA 3NIFF 3KR3L 3OJMB 3UBXG 4HIJB 3PL6C 1RJCA 4P4RA 2BXZA 1DANU 3QG7L 1TZGL 2EDKA 4X4ZA 3T1FA 4PB0H 3GI9H 5JXED 4LL9A 1CLOH 5DUBB 3GSQB 4JN1H 5GRUL 4RWYL 4PD4J 1VKXA 3SO5A 2Y06H 1I1AB 1WC7B 4OLXL 1AKJB 4S1RL 3FQTA 3IDGB 4LSRH 3X13A 4FXGB 1E4XL 3WJLA 1NC2B 3GBMH 1IGJA 1QFWI 1DR9A 4YXLH 2CXKA 3CMOL 5FM5O 3PHQA 1IEBB 4EQ2A 4I18B 5JOFA 2CH8A 3HG1A 5F7HA 4QTHB 1YMME 3QDJB 3RY6C 1BX2B 1R3LA 5JTWA 1GXEA 5IR1B 2GTWA 3BXNB 4U6VH 3H7BA 4OLEA 4XNZB 3I3EA 1HKLL 3CFCH 3VRJB 4H8WH 2FH8A 3Q6GL 4OZHE 4Z77B 2B4CL 1HDMB 3BRGC 5F21B 4RNRA 1SEBA 1UKSA 3NGBC 3MV7B 5IVXE 1PG7H 2RBLA 4OZIA 2VN7A 1F3RB 4KGLA 2GAZA 1MCPH 4OF8A 4G8FA 4XBEL 1JF1A 1DDHA 4WFGE 5EZJA 2B39A 5CBEB 3TNNA 1P6FA 5ID0B 3PGCB 2Y5TB 1A6AB 5IVZA 2PF6A 2X4UB 1UXWA 1G6RB 4L4VD 5EFIB 4MA3A 2Z8SA 1QFHA 5JIPA 3JWNC 4FZ8H 2NY5H 4UBDC 4JKLA 2UY6A 1YECL 3EO0B 3GBML 4MZ3A 1ZA3B 5MHSE 4GG6F 5LGJB 4XPGL 1O5DT 1T2QH 1OPGL 2IAMB 1FE8L 4LLAA 4WJ5A 3BKJH 1VFAA 1AQDA 5HHNB 3UZQA 4FG6D 3EOBB 4GXUM 4PJAB 3QXTA 3FQRA 5CIPH 2E7BA 4MJ5B 3QEQD 3QO0A 4ZQKA 3QYCA 3SQBA 4O2CA 4DZ8B 1YEGH 3CPLA 4I8DA 5H2BB 3UTPE 4KKBD 4D0DB 5JHDD 4TUOB 4RMWA 1B6UA 3PWUB 3ILPA 3WDIA 3HAEH 1IARB 4YWGL 1LO4L 4OB5L 4RAUB 4WEMB 4DOHB 4L9LB 4OCRH 1J8HA 5D2NE 3MJ6A 4PJAF 4V1DA 5IFHH 4JY4B 3S3PA 1T04A 3KPSA 2RAMA 4F37K 4G3YL 1J05A 4R26H 1S8DA 4I48B 1IZKA 3N9GH 2L7UA 4F7TB 3MV01 3KLHD 1Z5LB 3CFEA 1CXEA 3PQYE 1KNOB 2F5BH 1JYWA 5EC2B 1JGUL 5CINL 1N5AB 2ZKHH 1ZVSB 3LQAC 4XNUL 3O6KL 1U3ZA 2BVPA 4HLZG 1C12A 4WFFE 1A47A 1UWGL 4M7ZC 1MQKL 4MNGB 2BHYA 2BXYA 3LSOA 1KLUA 2O5ZH 1FFRA 3WBDA 5DQ9A 1DBKL 4P5TC 1XGYL 2GKIA 4LVOB 3F12A 3NACH 5EUKA 1GH7A 2P46B 1BX2A 1R3LB 1WFNA 4HS3B 4HPYL 1DEEB 2WWMC 2YD8A 1T1ZB 2YN5A 1F8TH 4P59L 1AKJD 2VL4A 5IMOA 4Z77A 3ARGB 1UC6A 2UYLB 1F6AA 3MROB 3U9PH 3AXLB 3E8UH 1W72L 3IDMA 1RPQA 3AREA 1ZGLP 1CXIA 4RMQA 1QO3A 5E03A 5E6IC 3VFUA 5TDNB 3OF6A 4RRPG 1T7VA 2CJUH 4NUGL 2H2SD 4QLRA 1YPZF 4TVPL 3T0EE 3VXTA 1U92A 4P4KA 4KTDL 4KY1L 3TN0A 5IHBA 3HC4H 5DMIH 4QO1A 1SY6H 1XFPA 1TNNA 2FWOB 1PSKH 3HCVA 2QSTA 1U8HA 2BVTA 2GAZB 2RCSL 3WIFA 5C9JB 5EA0H 1KB5A 5DJYB 1EHLL 4LU5H 2YRZA 1PYWB 4PRIE 5D7IE 2NY2B 1K85A 2CKBL 5HI3C 2HTKD 4KZEH 2WBJC 4FQXA 4P23A 3KYKH 5C0EB 5L9DL 1J5OH 4IRJB 1YMMD 1FYTE 3QISA 5GS0L 2BVOB 5DDHB 2DQCH 4PRHA 3HKFA 3THMH 2NY6D 2F8XC 3H9SA 2VDOH 3QP3A 5IK3B 1HQ4A 1VFMA 5EFIA 3SKNA 4Y8DC 4QXGL 4JPWL 2VUOA 2XNAB 4EI5A 1VPOH 1HNFA 1MWAH 4ZUSB 1KCUL 3QIBC 1YDPA 1V7NL 2ENYA 3ZL4H 1CE6B 3I84A 4UQ2B 3RL1A 4IJ3C 1VGKA 1NGPL 2B1HH 3EOBA 5GGSY 4PRAA 2DD8L 5EU4A 3TESA 4H8WC 3ALXA 4HX1B 4Y4KA 1JZ3A 3DUSA 3OB0K 1RZKC 4GKZA 2VRAA 4KV5E 2I5YH 2AGJH 1ACYL 1N64H 1JNNL 2B1AH 2EZ0D 4U4BA 4UILL 1XR8A 3KPOA 4PJAA 3SPVA 1XIWB 5EUOA 1J8HE 5D2NA 3LSOB 3V6OA 3P9MB 2I60L 2X1PA 4G8IB 4HH9A 1YEDA 4DK3A 2H6PB 5D7JB 5GZND 3IU3B 1I85A 1INQB 5C2UB 3B2VL 5F96L 4JG1L 1HINH 2XWJB 2XWJA 4FQLL 1FV1B 1BVKB 5K9JL 1BWMA 3VGGA 4HUWB 3MJ8B 3MJ8A 4L9DA 5E56A 4G80A 1RFDH 15C8L 1HXYA 5EZOL 5HGHB 1FFNA 5DD0H 5FYLL 5IOPA 1MLBB 3UZEA 1UWEL 4NO5A 5KBNC 4HIJA 1IJ9A 1A7QL 1IMHC 4LRIA 1OQXA 1HWHB 4EUPB 3U46A 1CGVA 2H2PC 3DSFH 1RZJH 3V4UH 2ZJSH 2C26A 3V4VL 3W11C 5ADPL 4WW1A 1T21B 4NKQB 1DZBA 1V3LA 3MLSH 3BSZH 4GG8A 1X5LA 3ZTJG 4DKAA 1BWWA 2DQDH 4HKBA 1SY6A 5C09B 4Z7NE 3VXRE 1KCLA 4X9FA 4EKXA 1BBDH 1EZVY 4ZAKB 3RL2B 1NC2A 4LMQI 5KOVC 4U1LB 5HGBB 3L3OA 2XKSA 4DVRL 5HVFB 1LD9A 2DM2A 2AV1B 2FHCA 2AV1A 4N9OB 3FQTB 3DWTA 1L6XA 4Z7UB 3OKYA 2HKFH 5HY9B 2AABH 4RFEA 5TH2B 4KXZH 3IB4A 3RVXC 5EZLA 1AGEA 3HZYB 3QJHA 4X9HA 1U2CA 4F58L 4JB9H 3FHQA 4R90H 1QSEB 2DOCA 3G5VB 4FOMA 3PXHA 4PGCA 3IAGC 2XG5A 3LD8C 4CVXA 4PJGB 3WIFB 1ZS8B 1U3HB 3REWA 1Z9OA 1QBLH 1XIWD 3RI5K 4ENEC 5CAYB 2N56A 1YMHB 3TNNB 5ID0A 2V9QA 1BVZA 3T3MF 1HHKA 4CVUA 2F8VA 3VXNB 4PV9A 4YDKL 2NXZC 2EDBA 2M8XA 4XP5H 2DBLH 4NNPL 5C9JA 4NM8L 5J1AB 5DYOA 1YYML 4HK3J 3IRPX 1L9NA 5D93C 4NRXB 5LG1A 2XZZA 4Q6IA 3UPCA 4GXVL 2AJ3A 2AXHA 2DWDB 4HUMB 5HGDB 1R3IH 1S7SA 5I17B 3QR2A 5FECB 3GI8H 1KYOK 2HLFC 4JFDA 1CGYA 3QI9A 3O45B 5CJ5A 3QAZC 4WWKA 4GKSB 2ZOLA 5IMMA 2AXFB 1IRAY 4R4BB 3B6SB 3D0VA 2ZKHL 1LK3L 3MRDB 3GMNB 3FJTA 4UV4L 3FMGL 5EN2A 4P2CG 2QQLL 1RUAL 4E0RB 4IEFB 5FECA 1J1XL 1K5NA 3F5WA 5DVNA 1YA5A 3KLHC 3SJVB 4KJWC 1N7MH 4GKSA 2AVGA 4G9DB 1IC1A 4F7EA 5KANI 2ADIA 5J12B 4NOBA 4OCWH 1BZ9B 4YGVB 2GJZB 4GG6E 4OLZH 3T08A 2DJUA 3V95A 4HMDA 4YHKH 3C2AH 3NBNA 4LAQL 3HPLB 1CS6A 4PP1C 5DRZB 4XP6H 4ZFZA 4R96B 1MCSA 3T0ED 4GXVH 3UTSA 1FRGL 4Y16D 1B0RB 4O2EB 4TNWK 4JZOB 3ARDC 5IUSA 1HK6A 1S8DB 4RZCB 4KZDL 4Q7DA 4ZUTA 2ZP0T 2AJVH 1LP9A 1BM3H 1E4XI 5KW9H 4FFWD 3ULVC 3RVVC 1WZLA 3LH2H 4NQEA 3IETA 4L8CA 5LBSL 2XWTA 4UOJA 3L5WA 3L95B 1A1MB 3AY4C 3S35X 2CRIA 3UDWC 3MXVL 3QUXA 2VITA 3G6JE 3KGRA 5JW4R 4P4KB 4K8RC 1TMCB 1JZ4A 1BF2A 3QFDA 2CGRL 2DKMA 2R2BB 3S37L 5JIIA 3S5LB 4P46C 5E8PB 4UZGA 4TULL 4FRWA 3ULVE 4X98B 2GTZB 1T5WB 5B4MD 5GGRY 2ED8A 1MFCL 1BAFL 1BGXL 1GOGA 4MAYC 2CGRH 1LP9F 1YQVH 3P11L 5F9JB 1I8IB 1G84A 3U7YL 3QA3B 3UJTL 3RWFB 5HYSB 3H3BC 4FQ2L 3TFKD 3CVHA 4R8WH 3BUYA 2J5LC 5FGBA 2ZUVA 5IB4A 3OAYH 1NFDF 4LASL 5GJTH 5I1EL 4QHKJ 4M93B 2QHRL 4P2RA 5E2VL 2LU4A 4R0LB 2YXMA 2CXGA 3LEXA 4K94L 3QUXC 4CNIB 3GSRB 3HUJE 2G5BA 1XGTB 4BQ9A 3EYUH 1QA9B 4XCFH 1DUZA 4R7NA 4XNXL 4WUKL 2NQCA 1NCCL 3WS6A 2X05A 2R2EB 1QBMH 1HHGA 2Y6SC 3MGTA 1UM6H 5J13B 2JB6B 4ZYKB 3MOBH 4F57H 1K9TA 3RL1B 1RVFL 4R2GB 5CGYD 3VGAC 5C0JA 4JDVB 5I74C 2D7NA 1QRNA 4MB5A 4UV7L 1SM3H 4P5KA 1S3KL 4ZD3H 4HBCL 3B8YA 4XNYH 1D9KB 3O4LB 3MACL 2FEEL 1ACYH 1N64L 2B1AL 5E0QA 5BS0E 1PG7W 1JCKA 1MUJB 4JO2H 1RUKL 1WBYA 3Q3GA 4XHQA 3FMGH 5TFSH 4EEEA 1X5HA 3I6LE 4UIKH 3VH8G 3P4OB 2XWBA 3ZSTA 1WT5A 5DVMA 4IIQC 2E9IA 1RHHB 1NCAH 3N1PC 5F89A 1KCUH 1D5ZB 1UH4A 2PXYD 1I7RA 3JV4A 1OP3H 3U46B 4WTXA 3U2SA 1GIGH 3ZHLA 4XPHL 3NOIA 4K71C 1JZ7A 2P7TA 3QDGB 1HE7A 5I1GH 3DETD 4KMTH 1IM3B 5HSFA 1P7QD 4M9PA 1F2XK 1OGAB 4LVHB 4WO4B 5TDNA 4JRYB 4YHOH 1J5OL 4D8PA 1UEYA 2A77H 2D03H 3TYGL 2YZ8A 1IGTB 3AROA 1CGSH 4LFHD 4N8CH 2HLAA 4QRUA 4ZFOB 2NW3B 5DURB 4L8DB 5T33L 2IG2H 4TN9A 3ULUD 4G8FB 4Z7OE 1AH1A 4YXHH 4XCCH 1QO3B 1NAKH 2C1OB 3O6LL 4RGOL 5IMOB 1T1YB 3GSOB 3P2TA 4L4TE 1R3KA 2XTJE 5E00B 4OZFH 3LQZB 4TUJB 4JKWA 2P4AB 3M17B 5D1QD 4GQ9L 5E5MA 4YHPB 4APQD 4LIQL 4YBHA 2EE3A 2VITB 5FM4A 3VFPA 4PGEB 3EHBC 3MC0A 3VXPB 1TJHH 3TO2B 5LQBL 4C54A 1I75A 5EU6B 3O3AB 1QA9A 3GI8L 3V79C 2VC2L 4XVJH 25C8H 1M7IA 1MRCL 5CHNB 1AIFA 4JFED 2R0ZH 3ARVA 1S9VB 4HKXB 1JIBA 5CBAA 3CCHB 1RZFL 2IFGA 1ADQH 3WDHA 4OZIE 3U48A 1Q9WB 4JGMA 3IFLH 1QD0A 3TA3C 4W4OC 5D1ZD 1NKOA 1C08A 2R0ZL 2E8ZA 1UACH 4G9FA 5KTEH 2DQHL 3MCLL 1INEL 1F3DH 3CVHB 3RTQA 4ODSL 2R0KH 3V7AG 4G43A 4Q9BA 3HE6C 4BJLA 4APQB 1P7HL 5I1KL 4JFDD 1ZSDB 3GJFA 3RNQA 1FSKB 1MAML 1CF8H 4WNQA 4I2XE 4KV5F 1CD8A 2I9TA 2FD6L 1ED3A 1DFBH 4TTGA 2D9CA 3BJ91 4U1KB 5IVXF 1S7XB 3IRZA 4RCAA 1NMCC 4ALAH 4AG4L 1WV7T 4HBCH 3KJ6H 1KBGH 3QO0B 5IFHL 5L2KE 3DMMA 5EU7C 2BDNL 4OFYA 1P5VA 1FVCB 2IH1B 3C9NA 1YC7A 3EOYG 4LHJB 4GLRH 3PHSA 1CD1A 3UCRA 2N4IA 2AGJL 1IC5L 1NCCH 1DE4B 5F1IA 4EOWH 5I1LB 1K2DA 4Z0XB 3P40A 5FO7A 3QEQE 3BEVA 4WDIA 2V5YA 4OLVL 1EEUA 4WU7B 2PCPB 1WBZA 2OS7A 4LDEB 1KC5L 2X1OA 5DO2C 3PWJA 4LCWB 3PGDA 5CJ8A 1HSBB 2H32A 2DAVA 1V7NH 2CSPA 1DLFL 2QHRH 2IADB 1PX3A 2C3GA 4XRCB 1FNEA 4R96A 3Q1SL 5I6XB 3NZHL 4OLWH 3SOBH 2NY4D 4MJIB 3GM8A 3KS0J 3OL2A 3T0BA 4YGAB 4KTEH 5TFSL 4YHYB 4BM7A 3GEWB 4W4NA 2OI9B 3ZKXB 3QHZL 4POZD 4QHUB 5MENA 3NTCH 2FHBA 4PY8J 4A6YA 3MACH 2W0FB 5B38G 2DWEB 5J0BA 1JE6A 4FTVB 3S4SA 2RR3A 5D7JD 1T80A 3H42H 4NO0A 5JOFB 1DTUA 4PJBF 4EI5C 1IC4L 2DB8A 3M8OH 2UZXB 2FRGP 3O2DH 4CVXB 2EC9U 3BXNA 4R6UA 4I4WB 1GOFA 3LN4A 3LV3A 4P49A 2M2DA 5I16A 5T1MA 1CT8B 3V5KA 4B7LA 1Q9OB 2R1WB 4ODVL 1A3RL 1PY9A 3MFFB 2SEBB 2XYCA 3T0EA 2HN7B 4BH8B 5KVEH 4NCC1 3GGWB 4GUPB 1BJ1H 1I7TA 3BGMB 3EO9H 1NMAH 4DWHA 4DQOL 4ZS6D 4YHZH 1KOAA 4BQBA 4XWOD 3VXNA 2RHEA 5KW9L 5KTEL 2Q8BL 5IV2B 3EO1A 3MLUL 3VWKD 2O61B 4IRSA 4XPTH 3HI6H 2KL6A 3AS2A 3F6IA 1B4JH 4Y2DA 1XF3B 4JM2D 3U0PB 5EU7E 4PG2C 5TDOA 3GJFB 4KI5E 4L4TD 1TENA 4WY7H 2PW1B 4UTBL 4BFGA 5JW3H 1M6OA 4OIIL 5CSBA 1KJ2B 1U3JA 1CFQA 2E9JA 2OR9L 5FK9A 1MHCA 2VXVH 1J11A 3CH8A 5IBTH 4KRMB 4LCIL 4OLZL 1AFVL 1P2CA 1T66C 4WWKD 3HMWH 4GJTB 3L1OH 3ARDD 4LPWA 4TULH 1QYGH 4JDVA 1S5HA 1X6NA 3BAEH 4Z7WB 3MMEA 1T5XA 4QCIB 2OP4L 3MUY1 4YGVA 3WFHB 4D0DA 1KTDA 4H0IA 5KSBF 4NQSA 3GSXB 1KULA 4U1GB 2XZAH 3AM8C 4YPGB 2CO6B 4OCNC 1AXSB 5ANMB 5HVHB 2GEEA 4FQXD 4P23D 2AJXL 4Y16C 3U9PL 2GJJA 3TZVA 2AEPL 5B3JE 5GQBA 3SE8H 4PGDB 1F6LL 2HVJA 1QSZA 4RGNC 4WHYG 5FCUL 3E6HB 3E6HA 4JO1L 2N7BA 3VXUD 5J6HB 5I9QB 3SKJH 3P30L 1K3IA 2H9GA 4GXUN 2DL9A 1I8LC 4HXAL 1FFOB 5ALBH 5KZCB 4P9HL 1NQBA 4W6XB 1DCLA 1G7PA 5CGYC 3SN6N 5BW7C 3RTQC 3H3PL 4KJYA 3C8KB 1H8OA 3EYOB 3HE6A 3WIHH 4XPAH 2F5AH 1X5YA 3FT4A 3DV4A 4EDXA 2R15A 2B2XL 5C3TA 4OTXH 1IM3A 5DJXB 2OZ4A 1QKZH 3BKCL 4OM1H 5DMJB 2AAVA 2VSDA 3N9GL 1Z3GL 1OHQA 3W82A 3U2SB 4MNHB 1F4XL 1CIUA 3VRJA 1FL5B 3OAYK 2ITCB 1S3KH 3X12B 1GSMA 1NAMA 1OSPH 2FWOA 1VEOA 3DROB 2QADD 1I85C 4JFPB 1CVRA 5ADOH 4LFHG 1F11A 1MCPL 5ENWA 1EPFA 1JHLH 4JJ5A 5BVPH 4OQTH 5AUMA 3L3HA 1FPTH 3V5KB 5F7FA 4Y8AA 3WKML 3Q6FA 5D9SA 2A6KB 4U1LA 2F53E 3AXLA 4JPKL 2VR4A 1AXTH 2HN7A 4BH8A 1CWVA 1G6RL 3KPMA 4LOUD 2F54D 1R0AH 2X5PA 1JPSH 5DGRA 1NEZA 5C0BA 1AGDA 1Q9OA 4Q97A 4DUXA 5J6GB 4NNPH 3X11B 5IK3A 5DC0A 2X9WA 3MFFA 4L3CB 3PJSA 4AYFA 4HIIA 5C8JB 4XVSH 1MCBA 5HPOA 4RGNE 3MCG1 3QI9B 4NWUL 5J3HC 3V0VB 1A1NB 1MIEH 4NN6C 4X6DF 3RFZC 3FZUC 3BW9B 5J1TC 3LEXB 5IGXL 1R5WB 1PFCA 1XGPB 1XZ0B 4G8EB 3MNZA 2MCPH 2P44B 3UPAA 4YFDB 3IS0X 5DQJA 3LKPB 5CEXB 3BZEA 4Y4KD 1BFTA 2J12B 4ZO9A 4NN5B 5SX5K 4WTWA 1YQVL 4MB4A 5ESVA 1BQLL 1WIUA 3EYVB 2NY0C 2NY1C 4YC2B 1HYSC 5F71A 4GAYB 4PJ9B 3G5XB 3BN9D 1QP1A 1P9MC 1PG7L 2FYYB 3BWAA 5F44A 5GGUB 4NP4H 3I3BA 2AJSL 4WWKB 1HCVA 3Q6GH 3OJDB 4MD4B 5B22A 2NY6B 3MXVH 1EAPB 4RGMC 5F1IB 2P8PB 5HJ3B 3PIQB 4MDIA 4U0RB 4RIRA 3QNYA 5I2IA 3CMOH 1OLZA 5E1HB 5CD5D 1L0XA 4M6AA 4MAUL 2APWA 2P5WB 1MF2H 4JM2F 1OF2B 5IQ9A 2GHWB 3L3KB 3I6KB 4L3EA 2Q87A 3LS5H 1XF5A 4LKXB 3SE3C 5DQ9B 2B8OT 3LAFA 3C6SB 3G9AB 2I9LA 2KPNA 2P7TB 2OZ4H 3QDGA 3C5ZD 5IESL 1QRNE 4YDLC 2EDTA 4S1DC 3C09C 2HFTA 2MQ0A 3BVNA 4KRPB 4E41B 4JFPA 2VIRB 4M6NH 3U6RA 3IFNH 1IC5H 2P24A 3NH7L 1TTGA 4DZBB 4DZBA 3K1DA 1TITA 4LPCA 1QNZH 3PGFL 4QT5B 5EOCL 4FA8A 3O6FA 1IAMA 1N5YH 4GG6A 1AHWC 2VLLB 4MMXC 5EO9B 3N1GC 1ADQA 4Y19A 3JV6B 3RGVB 4OV6F 1X6LA 3GBNL 1ORSB 2XZAL 1S9XA 5AAWA 4W68A 3DV4B 4EDXB 5J57B 3FO0H 4ZXBD 3D39A 5IW3A 3WUWB 5GGQH 2OMBA 3GO1L 5CBAB 3RA7H 3TBSA 4IBLT 4LEOB 5FO8B 2BZDA 3QUMH 4JQXA 4O2FA 1BOGA 1NGPH 1FZKA 3FQRB 3OXSA 4PGEA 3AM8A 3E8UL 4HKBB 3PUCA 4NHCH 2F53A 4NWTH 5D2LF 2N1KA 3ZT7A 4U1MB 3X12A 3ZKNC 4B53A 2A38A 4H20H 4E9LA 2OR9H 4HJGB 1B4RA 3VFVA 5DHVB 1A1OA 3B4NA 4JKPL 3MRBB 4U33A 3O0RL 2DQCL 3P0YL 5F1SA 3OG4B 4P99A 5GGTA 3TN0C 1RZKH 2DQFB 4WFHE 5GGRA 3MUGB 1AHWA 3F7QA 5I8OH 3GHBH 4KK8C 4M6OH 4LHUG 5BZWB 5DHVH 3IKCB 3CZJA 2DM4A 4Z5RB 3VRIA 2GSGA 4JFFB 3EOTH 3EYVA 3AY4A 5DFVC 1WEJH 3CDGB 3DHJA 2RCSH 1NBYB 5D1XB 4PY7B 1T5XB 1OY3B 2VLJB 4TUKH 3RA7L 4FQ1L 2F53D 3BZEB 1N59B 4BZ1L 2PETA 2OXGA 2FATH 5DR5H 5DYOB 3FFCA 4UT9L 1P84K 5J11C 3MBED 1INDL 5DJ8A 1XZ0A 4G8EA 1EA9C 4F7TA 4U6HA 4ZUVB 1AQKH 4XCNA 1YEEH 4TOYH 2MSPA 4Y4KB 2PKDA 3MRQB 3O3DA 4LPYA 4L8BA 1ODAA 3HE7D 1OTUC 3UTZB 4HIHB 3L3DA 1I1YB 4WI3A 2OTWA 1X5GA 3MOAH 5FGRA 3OAUL 4M8QB 2J8UA 4XCEA 1P4BH 4HJ0C 2OJZL 1F8TL 4RAUA 1RSFA 1NL0L 4OCSH 1UZ8A 4Y1AB 5EPMB 4JPVL 3QUMA 3AREB 3OXRA 1ZT7B 3V4UL 1ZT7A 2FCBA 3O8XB 2YRPA 1FC1A 5JLZA 3G6DL 1QEWA 1I1YA 1KXQE 3RBSA 1O0VA 3CUPA 1J86A 1UJ3B 3GFUA 2HRLA 1GZPA 2DI9A 5C09A 3ARGA 3MLPA 4IDJH 1UB5B 3OB0H 4RISL 3G6DH 4LKCB 4N90D 5EWIL 5I1IL 1EERB 2A2QT 4LSUH 2VDML 5KSVA 3AB0C 3T2NL 2J6EL 3BOVA 2QR0B 3PDDA 3WN5C 3OKEB 1YNTA 4UDUA 1MJ8H 3BPCB 1Y18A 1S78D 1X5AA 4OBSA 1H15B 1X44A 5IG7A 2AEWA 4TSAL 2R1YA 3U1SL 4WUUD 3DUUB 1FHGA 5ALCL 4EI6B 1Q0XH 3PV6A 1SJHA 5IT2H 4ZNEE 1FJ1A 3VD5A 3FB6B 3FQNA 1JGDB 4PJBA 1A21A 3O4OC 1FO0H 3KPPB 2ORBL 3DI2B 3D2UA 3SDAC 4PJXE 3QULA 3MROA 1INDH 3L7FA 3QWRD 1F5WA 1YEJL 1U8LA 1UA6L 2DQFA 1DFBL 1IAIM 1KTLA 1EEYB 4DUWA 1EGJL 5BZWA 1N2RA 3D9AH 3R4DA 4P57A 3KYNA 3O9WA 3RZWA 3BRDA 1CFSB 4KAQL 1S7WA 4LARH 2BFVH 4JJ5B 3TO4C 4C4KO 5A2IH 2HT3C 3UTOA 3MLZL 2J2ZA 1HNGA 4Q58C 3BT2H 4KMQA 5E5MB 3ULVF 1Z9SA 3BMWA 4X6BA 4LSDA 2Q7NA 5GZOC 1S7TA 1CYGA 4PJEF 2O5XL 3HA0A 2BNRA 1C16A 3CX5J 2FBOJ 4XXDA 3WDJA 3KXFA 4NBYB 3F7VA 4PGBA 3KLAB 2JCCF 5A16A 5FK9B 1J1PL 5DJCB 4OF0A 5HYFA 5DJ0A 5DD1H 1U6AH 3C60B 1RZGB 4KVNL 5DF0A 4UUJB 1CGUA 3MZTA 4M43H 4JFHD 3MBEC 2JJTA 1LEIB 4YEFA 1U8PB 3ULUH 3S37H 2YSSB 2BNUA 1MHCB 2P5EB 1PBYA 2VWEE 1EBPA 5GGQL 3P0GB 1ZVYA 3HPJA 1BQHA 3WIIL 4EN3C 1I7UB 2LTQB 2BMKB 3A67H 3OKLB 1NLBL 4GMSL 4XNZC 2HJFA 4KROB 5GRWA 1E4KC 35C8L 3S6CA 2H9GB 5C0GB 3QHFL 4DZ8A 4OTXL 2AERT 4KHTL 1B0RA 2R29L 5CLWA 1U8OB 1DBJH 4QY8A 2VABB 5C0AD 1MHPH 3MLTA 5I1AA 2EDJA 1AI1H 5CJXA 3HI5H 4JFEB 4EDWH 2VJXA 3KXFE 3TPKA 5JOPD 3FQWB 1CG9A 4C56D 1D5MA 3ARYA 4TSCL 1C5DB 1G7JB 1QLRA 1G9NC 5C71A 5LCVH 2DLIA 4MD4A 3ZTNL 4QRTA 4QRTB 1GC1H 4PP2B 1RJYA 2HRPL 5L2KA 1JWMA 2A74B 1A22B 2HAZA 2JJTC 1ROWA 4HMEA 3ZE1F 4CU7A 4D8PB 4ZNCD 4N5EC 4FQIL 1FLRH 4HWBH 4K9EL 3SE8L 4NZUH 3MRCA 5M95B 1EJOH 5HYJE 1NFDB 3QH3B 3SCMA 4HS3A 1NPUA 4ZOBA 4C57C 4R9HA 1WTGT 3VD9A 1KEMH 5FAAA 4XMLH 4WWID 1OAZH 4PG9A 5DEZA 5L8LB 4OGAD 2FSEB 1GGBH 1G7QB 3CZFA 2CUIA 3SO3B 5BV7L 3F7PC 2QTEA 4JR9L 3BZFA 2R4RH 1QSFD 1V7MH 3C8DA 1AGDB 1WAAA 2ATPA 1CICB 4Z78A 3TLRA 1DLHA 2DQEH 2R0LH 3D69A 2ZNWA 1AGBB 5JORA 2QQKL 2E7HA 3SDDB 4NFDA 1R3IL 1WWWX 1HQRA 1A1NA 1CDBA 2UWEA 4EXPX 2HT4C 4NOFA 2YA0A 3KPMB 2BVEA 3DX7A 1KIPB 2FO4B 5IF0A 3DRQB 1A9EA 1HHIB 4NZRH 1KGCD 4EIZC 3DIFA 4HKJB 3MV7E 2DDQH 5ICXB 1U8NA 4ZPTB 3SDDA 4WUUE 2YPLA 3DBXB 4UT7L 4JM2A 5KJRH 4X6BB 1DBJL 5EO0B 3ZKSD 1I3RA 1G0XA 5E9DD 5B3NA 3MQIA 2ICEA 1A6WH 4I3SL 1BD2B 3GSRA 4X7TB 2CLRB 2V2WA 4DGVL 4P5TB 2QADB 5DVKA 5C0GA 2XKUA 3MV8A 1R0AL 2ICWI 1NLBH 4GMSH 4J3XA 3LS4L 2VLKD 1V3JA 5DZNA 3BQUA 1BQHB 1DQLH 5DTFA 2R2EA 2NY1D 3VWJB 3WL9A 2A6DA 1Q9LB 5KVFH 1DL7H 4KHXL 2V7HA 4QF1A 1FO0L 4IRJD 2BERA 2XFXB 1UG9A 2CDEB 2ZPKH 2DIBA 5IT2L 3H0TA 3JWDL 1MCWM 3F62A 5F7EH 1JK8A 4Z7QE 2DN7A 1X3DA 4WI2A 5ID1A 5DEGB 2R56H 4X4MA 5CJBA 1RJYB 4PJAE 1KT2A 4NQXB 3T0VA 4ZFZB 2ZCLL 3U30C 1FNAA 1TJGL 4MD5B 1CTOA 2Z92B 1QRNB 3BKCH 4OM1L 4R3SA 3T2PA 4OT1H 4CN4A 3AS3A 5D7JA 1E28B 2UUDH 2XFXA 2XZQL 5DRXA 4GBXA 4TNWF 3W9EA 4GS7B 1NBZA 2X4TA 4JFZL 3WIHA 3ARFD 2GTWB 4RISH 3OX8B 4ZOCA 1AO7E 2X4NB 1J1OH 1JMXA 5D2NB 2NY2C 1DBAL 4G6JL 4PBWD 4XBGA 3DMMB 3LDBC 3T2OA 3VFGL 4NQXA 2VDPL 5JIKA 1YEDB 3T4YA 1CQKA 1FORL 3ARXA 1MLBA 1FVEB 1MREH 3TBWB 2ZSVB 3O2DA 1TZHB 2NR6D 1CCZA 3GUTB 3O8XA 4HV8B 1QZ1A 1NBQA 3SKOB 3GSOA 5SWZD 1NGWB 4JPIB 5JW4N 3CIQA 2EDWA 4GBXD 2LV4A 3G04A 2K7PA 2BDNH 4QRUB 2QKIB 3L5IA 5E8EB 3I2CH 4YHLH 4L3AA 3HR5B 4JHZA 4ALAL 4LLYA 4RFNB 4F15B 1WZ1L 5I1CL 3NIFE 4HQQL 4C56E 4Y16A 4N0FB 4FFZH 5F7DA 2H41A 5D6DA 4Y19E 3PNWA 1NAML 2AK4B 4YX2H 5HYQB 2YPLB 3DBXA 1SMOA 5H37G 3ULVL 4WHTA 2IQ9H 4YFEA 5E8DH 1MLCB 3HMWL 5H94B 3FN9A 1LO5B 5DJAA 4EVNA 1B6DA 2HMID 1U92B 2QQNH 4PJFE 5CJQL 3KPNA 1U8HB 3PDOB 4H5SB 2FR4B 3L9RA 4YHPA 3VRIB 4KQ4L 4M6MH 1I3RB 5I71C 1U95A 3NPSB 4UB0L 1EFQA 3B8SA 5I16B 2YEZA 2CUMA 3KYNB 5DFTA 2AXGB 4HKJA 3BFOA 2E7MA 3KDMA 2V7NB 4G6KH 1K3ZA 1RJLB 4V2BA 3X14B 1X5IA 4ZPTA 3U0WL 1KLGA 2Q8BH 4P5KB 1Q94A 1WFUA 4N0YH 3NCJH 5H35B 1U58B 3QIWC 2B0SL 3DX8B 5ITFA 1TJHL 1A9EB 1HHIA 3I9GL 2Q8AH 1NSNH 2VLME 1HXMB 4LNRB 1NLDH 3ETBF 2ADJB 4Q6IB 4X9IA 4F33A 1J12A 3ELAT 4PRIB 1SYVA 4RBPK 4XTRD 3GJFH 2Y07L 2ZUQB 4PBXA 5FDYA 4P5TD 5AG9A 1WBXB 1EGJA 3BJLA 4UTAH 4UT9H 2PYEE 2CLVA 2GCYB 1MCRA 1C12B 2BSSA 4YDVB 4RSVA 1VFOA 4FQ1H 5CP3A 1LO2H 1BFSA 4Y88A 4N1CA 2F8OA 3T3ME 2VLJA 3BRFA 3KJ4C 3BN3B 3EJJX 4ZMAT 4WU7A 3TCLB 3QIBA 1A6VL 1JPFB 1QVOA 5HD8C 1G1YA 2XN9A 3PWJB 4LCWA 4RGND 3TVMC 1KSRA 1FDLH 1RUMH 1KJMA 3H7BB 4LPTA 1CD1B 1GGIL 2KDGA 2IADA 5BOPA 1ZLSL 1YPZE 2XACC 5KANG 3WFBL 5IHZA 3BEVB 2BSTB 3ZE0E 3OB8A 4XPHH 5C2BL 2JB5H 1KB5H 5KOMC 5L2KB 1U3HC 1QEWB 3RWCB 3LKQB 2EH8L 4PGZA 5I1LA 4OIBA 4IM8A 5E4IA 3SDXE 1LWRA 5D2LE 5T1LB 1AGFA 1EO8H 4ZAKA 1NCBH 1KTRL 3U0TA 2PXYA 5E7BA 3PQYB 2CRMA 3TBWA 3MRJA 5J56B 2FECL 4ZDHA 3QUYA 2Q6WB 5BS0D 4WO4D 3MRIB 2D7QA 2VMFA 4JZJC 4MXWL 4ELMB 5LGJA 4MSWB 4LF3B 4ONHA 3V6OC 3MRMA 1ZLUK 3MNVB 5CP7A 3VGDA 2EDNA 3WJJA 5GS1B 4WCYL 4I77H 4BUGA 3DVFA 5GHWL 3QAZB 1NCTA 4WIQA 4PJGA 4CGTA 1N5YL 1LP9B 3H8NA 2ATKA 2Q1EA 4QT5A 3M45A 3WNOA 5JPMA 2PR4L 3RKDD 4H0HB 5FKAB 2I5YL 3G6JA 1NGXB 4G5ZL 3LPGA 1ULVA 3O3BA 5IMKB 2CDGA 2FD6H 1FVDA 3KPPA 3U79A 1JUFA 3ISWA 3UYRH 5KSAB 2Z93A 4NQEE 1XR9B 4JZNB 3ZMRA 2HJKB 1CFSA 3NIGE 1EHAA 1UXWB 4UDTB 1DBML 4ZFFA 1RZIB 1JJUA 5EU6D 3WXVL 5HXMA 1UACL 5E8PA 1DQDH 2C1PA 4XCYB 4LEXH 5E5UB 2UV3A 1S7TB 1GGCL 4NO3A 1S7WB 1UB6B 4FZ8L 2WIMA 4JG0H 5HHOA 4TVPD 3FQXA 35C8H 3P9MA 5F7KC 5GS0H 4LAJH 1WBXA 1FAIH 3ARDB 1KLGB 1BEYH 1P4LB 1S7UA 1VFBA 2FBJH 1BLNB 3G08A 4KZEL 5HHMD 5JQ6L 1T83A 3FRUA 2IFFL 4H25A 1W72A 1LNUB 3VXRA 2R69H 3FFDB 1I8MA 4UMGA 4AIZB 4D9QE 5ICXA 5HI4C 3SGKC 3QEHB 2VOTA 2C3VA 4G80B 1S7VB 3IVKB 4LSVL 4P2YA 1FZJB 4WW2A 4HJJL 3QWRA 3HC0A 3RDTB 4JFEE 4DJMA 1DQLL 4Z95L 3H9SD 4WI7A 4TVPH 1KCRL 5C07A 1LEKA 1N4XL 2J8UB 4XCEB 2OTUB 3AAZA 4UINL 5SWZE 3GMMA 5TE4H 3QO1B 4U6HB 1IQDA 1ZLWH 5DQJB 4DGVH 4HIEB 2UVEA 1T22A 4LLVA 4ZS7H 5TF1L 5CEZH 4AL8L 4HK3N 3DRTA 3RVVD 5L2JB 3S36H 4N9GB 4P46B 1Q1JH 2IQAB 4NWUH 3PWNA 4YDJB 2XPGB 5F3BB 4LSRL 3GIVB 1MUJA 2EYSA 4O02L 2W9LA 4AT6A 4M61B 3FT4B 2AJZA 3GMPA 2NX5D 2NLJB 2BRRH 3GMLA 3B5GA 4D3CL 3QT2A 1RHHA 5HHXH 3L3OB 1KJ2L 4BQCA 1MIML 1CIDA 3WD5L 1LMKA 2VDNH 4GO6B 1ZHKA 2X42A 1DN0A 3U4EA 4Z76B 2NY7L 1WBYB 1MJ7L 2YA1A 4MGXA 3JBG7 1BQSA 1J0ZA 5T1LD 3WHE1 5C70A 4G6MH 2AJZB 1OP3K 1GGTA 1EDQA 3CFKB 5FF6B 4F3FA 1GAFH 4WEBL 3ARBA 4GKNA 4YZFF 1KCSH 2FIKB 1FLTX 4HLZH 1MAKA 4ODTL 4JN2B 3RWGA 4K3DL 1YYLL 3VG0H 5MP6L 3GUTA 4NQCD 3CK0L 2BVQA 3HNVH 4Q9RL 5F6HI 5FFLA 3QQ9C 2EDDA 1MJ8L 3MUJA 4M5YH 4K3DH 3VG0L 1SM3L 1W0WA 4ZUWB 2MFNA 1RZIA 5C0BE 3NN8A 4A6YB 3VGAB 2X70A 5EZIL 1AC6A 2DTSA 1T4KB 1GRWA 1ONQA 4U2ZA 3PJSB 3QCUL 4AEHH 4XNQB 1QLEH 2HRPH 1LDPL 4PRBB 4IRZH 3IJYB 5DJ6A 4NFBA 1IFHL 3A6OA 4Y5XA 3BI9X 5F9AC 1I8IA 3HI6L 4TVSa 5MI0B 3QA3A 1ND0B 4L4VB 5F88A 2H6PA 1MHHB 5ERWA 4PJ7A 1TVBB 4R7DA 1PVHA 4OCMC 1RUPH 2WIIB 2JJVA 4EQ3A 1JPTL 3BE1H 1TDQA 4KC3B 4XVUD 1LK2A 2VLJD 3RHWK 1I8LA 1I7ZA 2ZG2A 3MV8B 5C0CD 4M5ZL 1FGNL 1KIQB 3L9RB 2M1KA 4X8JA 4TUOA 2BSRB 2IH3B 1VEPA 4G7YL 2I25N 2EIZB 3V6FA 1CL7L 3RZCA 1D5BB 2WIIA 5IVOA 3LKSB 2F54B 1MCDA 2H3NB 1A0QL 4JVWA 5CD5C 5DFWH 4OAWB 3VXSB 2Q7YB 4D9RE 1XGQB 1OARL 3WV0A 5IBTL 5EUOE 3K8LA 3I6GB 4FFVC 3RY6A 2R39A 2VE6B 3UDWA 4DEPC 5IVXB 2BK8A 4TVPE 4F9LA 3QHZH 2R2CA 4KI5D 1YEIH 5EBLB 1HHJB 1WVZA 3MGOB 1YNLH 1ZHLB 4OAWA 4Z7WF 3SGEH 4LSSH 1Y6NR 4M6ML 1RZJL 1A7OL 3ABZA 4YAQB 5ESQB 3ZLQC 5L88H 1I3UA 1GOHA 4OZ4A 2R23B 4Y2DC 3QDMA 1MVUA 4PS4L 5CS7A 4F7CA 2HT3D 4HAFA 4G42B 3TPUA 3T4AA 2IQ9L 2IAMC 5BS0B 3VCLA 1MCLA 1R5IA 1BF8A 1X4XA 4PRHE 3ARGD 1EGJH 4L3ED 2VXUH 4PRNA 2A1WL 4I5BB 3UX9B 1F58H 5KVGH 4XBGB 5DT1H 4AM0A 1JWMB 5DUMH 5KSBA 4NCC2 5SV3A 3S98A 3MODH 2QEJA 4QOKD 1G7JA 4P9MH 3GHEH 5FYJH 1QSVA 4K3EH 4CBPA 2A74A 1OAKH 1FJ1B 1E4WL 1KXTB 1MFAH 1WITA 4JO3L 1UCTA 4ODHH 2J8HA 2C7UA 2AJ3B 3L7FB 2R1YB 3CSYA 4DN3H 2JE8A 2NX5E 3DUUA 2DLHA 3Q6FB 4BSVB 4XNQA 5L0QC 1KB9J 2NW3A 2CRZA 1ZTXH 3KLDA 3QCVH 1NMCB 3OKEA 1HEZB 4BFIA 4OFVA 3DLQR 4U6XB 3MNZB 3TJHD 2V17H 1CI5A 1G6VK 5H94A 4HXBH 5FYKE 1PAMA 4X0KB 3QUZD 2EH8H 5E4EC 5IM7B 1H5BA 3ARFA 5L88L 5CD3B 4PGCB 5DHXB 1ZT4B 3L5JA 1HXMA 4BSWB 1MCOL 1REIA 1FFPA 3JV5A 3MLXL 5F1KC 1CE1H 2B5IC 2FHFA 3HZVA 2MHAA 1IAIL 3QQ4A 4L9LA 3PWLA 1TJGH 4LVOC 4JGUA 3D85A 4LHUA 3QIUD 1F4WH 2IC2A 3X17A 4JY4A 4P2OA 4R4FL 3WNMA 5C0IA 3R1GH 1HHHB 3H9YA 3TWCL 4I0PC 1B9ZA 5C0BD 1GC1C 5ILTL 2LVCA 3JWDH 4QHNA 3SDCC 1I8MB 5EH1A 1NJ9A 3ARGC 2FEDC 1RJZA 1QLFA 5MEPA 5E8NA 3WYRA 4P3CL 2C3HA 3BIBX 4FFWC 1I1FA 4PJDE 5KVFL 5SV4A 4F58H 5DMIL 1JNHB 4MNQE 3FRPA 3BKYL 5IEHB 3FFCB 1F3JA 1LGVA 4IS6B 4TYUA 3SKUD 1XGTA 3ZZ1A 1G9MC 12E8H 1QFUL 5T33H 1YN6B 1I9RH 3D3VE 1NBZB 3I9GH 3UBXI 5KJRL 3UROR 5IB1B 4MQXD 3RNKB 4QHUA 1EXUA 5CUSL 2IBGA 3IDYB 2OTUA 1UKTA 1QOKA 4GAYA 3BHBB 5GRJH 2EIEA 1WCBB 5DURD 2WBJB 2NXZD 4NJ9H 3ARZA 3DYPA 4P2OC 1W2KT 3OJVC 3T0EC 4I2XA 4K94C 2GYSA 1YN6A 4XMKL 4PJEA 1P7KB 1BJ1J 2VE6A 1P7KA 4OZFG 4YLQT 4HV8A 4WRLA 3DXAD 4G7VH 4OLYL 5B39B 1EO5A 4OD1L 4HUWA 1P84J 3ARUA 5F9JA 4FFYL 5ANMA 4PLKC 1JZ8A 2R8SH 4PFEA 3CH1B 3VDBA 3C6LB 1A7PH 5C07E 1U91A 1GPOH 3HG1B 5HGGS 2XKNB 2NX5A 4RX4A 1A02N 3QXUA 2PXYB 1JV5A 1SJVA 4AENB 3ZDYF 1BFOA 3SHSA 3OXSB 3NCCB 1L9MA 4PUBH 4PJDF 3QUYB 2Q6WA 2NW2B 2PTTB 2WLZA 1YEHH 3FO0L 2Y36H 3T77B 4HZAA 4FQLH 4U1MA 4LKXA 4G42A 2ARJQ 4OGYL 2FLBT 1NCNA 1S9WA 3TPUB 4OD2B 3GBNH 3MRMB 1DQJA 2JLLA 3N0PB 3QFJB 1YN7B 4I18A 4YHLL 4MS8C 4ELMF 4JRYD 5FV1L 1ZAGA 1TZIB 5DJDA 2NMSA 3GGWA 2Z93B 3EFDH 5KSBE 4N8CL 2AK1L 5CEYB 43C9B 3KPSD 3TYFA 4NRZA 1IGTA 3K8KA 3O6FB 4UILH 2YMXL 1TCRB 5D7JC 3HAEG 1NGXA 2IALA 4I3RL 4WUKH 1RK0A 2DLTA 1RK1B 2D7TH 2ATKB 5HHXL 2FB4H 2H8PA 3BDYH 4N0UA 1ZWIB 3V7AE 3T3PE 1MCOH 2NXYC 3Q5YA 2H1PH 1IAKB 4QRRB 4HFUH 5TDOB 4U6XA 4JVPA 1ZGLB 5IVZB 4F8TA 4MA7H 3LS5L 3C2SA 2DLEA 1DBAH 4G6JH 4ETQA 1MFDH 5IMLB 3X3GH 5A16B 5HYJA 5JXEC 2XY1A 4L4TA 4LLQB 5CD3A 4M7JH 4LRNH 3WE6B 4YDIL 3RKPA 2AJXH 1LO0H 3JTTB 4MQ7A 4X0KA 4KMLB 1UWXH 1N6UA 4KK6C 4LPVA 1MH5B 4OF6A 1KPUA 3MA9H 3UC0L 4DN3L 2R56L 2VQTA 4ZNEA 3HC0B 4XNYL 3E6FA 2GW5A 4F7PB 4M00A 5I75B 2FZ3A 3ARTA 2X1WL 2AJSH 3DX7B 1CICD 5ISZE 1TVBA 4R7DB 1MI5D 1E4WH 2NR6C 5DHYA 1BAFH 1BGXH 5F7YC 3GMNA 1MRDL 3OAZK 4ZAKC 5E6YA 5FYKD 3KYOB 4POYA 1IC7L 2ITDA 1XF2B 1MI5A 4OV5A 1QBML 1MI5B 2VERN 4RFOL 4OV5B 5KSAD 1HHGB 1WC7A 2VXVL 5ESVB 4A2MA 4LNRA 1BREA 2AP2A 4NQDD 3LS4H 2R1XB 1MCWW 2ED9A 4OGXH 5CZXC 3VFTA 3LN9A 4LSTH 4ZTPH 3F8UB 3WHE0 1H3WM 4QOKE 3UTQB 2V2XA 1JPTH 4C55A 1TQBC 1CFNB 2XWTB 2EECA 4UT7H 3RBGA 5F3BA 2UVFA 4YDJA 2VWEC 1JZ5A 1TQCB 3QUZB 2Y6SD 3GJEA 4XP4H 5CMAB 3LIZH 4JFYB 1T7XA 4QWWC 3D5OF 2DLFH 4RWYH 5FUCC 4ONFH 5I8EA 1U42A 2EXWD 1H5BC 3ARFC 4DW2L 2PYED 3EYFA 4Y0GA 1DBKH 2Q3AA 5D5MF 2NZ9C 3HB3D 5DJDB 1A3RH 4B0MM 3QCUH 1CVSC 5ECJE 1UGNA 4AMKL 2AQ2A 3RJDA 3WFEH 3O2WH 2KZ1B 4MCZA 3OXRB 4HWEH 3CDFA 3B5TA 5HPMA 4PR5A 1PEZA 1FIGL 1OD9A 3U6RB 1BFOB 1T89A 3FT2B 1JRHL 2Z8VC 3L3HB 4NDMB 1G7LB 4OFYD 1U91B 1S9WB 1ZVHA 2D0FA 3VMNA 3BGFB 1OAUL 1CL7I 5F3HB 3Q2CA 5IBLC 3S97C 1AQDB 5HHNA 4OLWL 2OL3H 3DXAE 1A6TB 1GPOL 4YUEL 4YC2C 1LO4H 4OB5H 3RUGE 4PJCA 2MPAH 3C08L 5F88B 4BZ2L 1OM3L 1XH3B 5GS0D 1RIUH 1I9JH 2DQJL 4NQVA 5D1QC 4B7IA 4ELKA 4OIAA 1T3FB 4OCXL 5D7KD 4N8VB 3UMTA 3GSNL 43CAA 1RZGA 4RGMB 1KUMA 1RI8A 1U41A 5DUPL 5EORH 3ZHDA 4NJ9L 2DYPB 2ZUYA 1M05B 5BZDB 1HWGB 3G6JB 3RVXD 3QQ9D 1A7NH 1KIRA 5L6YH 3DV6A 3MRPA 4OFKA 4CMMA 5EZIH 3UTTA 1MHPL 3LKOA 3LEVH 2X89A 2V7HB 1FG2A 2DI8A 4OD3H 1R3HB 1MJJB 4I13B 2DQGL 4OM0H 1A9BA 3DX9B 5FYLE 3UZVB 1L0QA 5EOCJ 1T1WA 1WFOA 3EHBD 4HIIB 2FJFA 5C8JA 2ED7A 4HBQA 4RA0C 3K81A 3QEGH 5ACLA 5DHVA 3UTTD 3A67L 3DVIA 1CLZH 2O61A 1R24B 4NQCA 2OSLA 1QBBA 2JKXA 5DTFB 5J9PB 4PV8A 3QJFA 1RJLA 4WUUB 3M1BA 4K2UL 5IVNA 4Y4FB 1Q72H 2QBWA 3IETB 4O4YL 5DRXB 5GRZA 4X6CB 3SCMC 3WFEL 3CLFH 4E42A 5DD1L 1FG9C 2J3SA 1I1AA 3L5WB 4OLYH 2UZIL 1HOCA 4MA1C 5J4MA 3B9KB 5DEGA 3MZGB 1TPXC 4U6VL 4KPHL 5IQ7H 3UTZA 5DUBA 4YNYB 1NMBL 3P0YH 1IAIH 1HSAB 2H26A 3B9DA 5JIHA 5ADPH 4UB0H 3AGVA 4XPTL 4DCQB 1UXSB 1OTSD 4GRWE 5ELIA 2JELH 5AZEH 1KJMB 4PTUB 3VGEA 3OKMB 4HFWB 4Z7WE 3OKMA 4HFWA 5C0RL 4YDKH 4X6CE 5A2JH 3FT3A 5IIEA 1ORQA 5GZOD 3TBTA 5D7LB 1OCWH 2FSEA 5DWUL 4NWTL 3RVUC 2CK0L 4M61A 4FS0A 5L2JA 2Y06L 2HFGH 1E4JA 3OHXB 4X83A 3PG2A 3OAZH 4LSTL 4NQUA 5BQ7A 2QSVA 4N1EA 6FABH 4OZFB 3I6KA 4FQPA 5D8JH 4J3OC 1V05A 3TN0B 4PLNC 3BKYH 3CSYB 3MLWH 4BSVA 3HCVB 5MEQB 2X4SB 4YXHL 1IC7H 1QFOA 1IBGL 3BISA 3HS0A 5F9OL 3FONA 2I60H 4N8VA 4KKCD 3EGSA 4ZUUA 5FYJL 2ZSWB 1RQ5A 4AH2B 4P3WA 4MJ6A 1CTNA 4ZFGH 5I74B 3RKDC 3MRCB 5TDPB 2VXQH 1YEFH 1S7SB 2G75B 3QRGL 4HZLA 1D9KC 2A1WH 2C9AA 4TNVF 3SGDI 3PL6A 1CR9H 5FYKU 3A6CH 4KMTL 4U1HB 1ZKAA 2DD8H 1PQZA 3REVA 2RFXB 3DSFL 3ILQC 5EWIH 3ZE2E 2VDLH 4HX1A 3BQUD 5E6ZA 4ZFFB 2JF1A 3TIDB 3VWKC 5KSAA 4QHNB 2GSGB 4GAFB 43CAB 4NQDE 1R3HA 2VDOL 3BDYL 4WENB 5E9DA 1V3KA 1QUNA 1Z5LA 3RTQD 4NQCE 5MENE 2GSIA 2FGZA 4U6TA 1HQ4B 4FQCH 1VACA 2ZCLH 4ZG1A 1HHKB 2I27N 4HS6A 3MLYL 2ADGB 1RK0B 2OJZH 2PR4H 4JO4L 4OUUB 3G5ZB 1BHGA 1RUML 3CLEL 3NABL 3J7HA 4ZFOL 1KB9K 5CKGA 2YPKB 3RZCB 1QFWL 5FYJE 3U0PA 4QNPE 1IM9A 5I1JL 5DRWB 5DRZA 2AK4D 4G8IA 3CX2A 3R06B 5E70A 3GKWH 3VDCA 4QHLB 3F7VB 4L8SA 1VACB 2VLRB 3RAJL 4M62L 1LE9A 5HHQB 4WTZA 2V2TA 4KTDH 2D2OA 3VJ6A 4QRPA 3CC5B 1F90L 3K4ZA 2J8OA 1WCQA 1KG0A 2APTA 2BY0A 2NY3B 3ULSA 4R2GD 4FZEH 5DVLA 2DQIL 3FL7A 2R0KL 1UCBL 3GIZH 3RWHB 1NUDA 1A7RL 2YUZA 3FO1A 3ZL4L 3WMSA 1OCWL 3H9ZA 1RZ7L 3LKQA 3QSKB 3UPRA 2K3TA 2DDQL 1JGEB 5INDB 3DYOA 2VLJE 4WV1C 3O0RH 3L7EA 3U83A 3MRFB 4I2XB 5GISH 1DEEA 1FYHB 3D6GA 5E8EA 1Y6KR 1H8NA 3LV3B 2O5ZL 3U7YH 4H20L 4MVBD 3EW3B 2K7QA 3GJEB 5MEQA 4F7CB 1S7RB 4U2YA 1FYTB 1NDMA 5D7KE 5IW6A 1FL6B 4G9FE 2ICWA 5D1ZC 4IRSC 1A3LH 4RMUA 4YX2L 5BV7H 5HGAA 1TCMA 4GW1B 1ZHNB 4DUVA 2IPKB 1OTUD 4HQQH 4Q9RH 3U7WH 3VXPA 4L1HA 3OKNA 4UTAL 4GSDL 5JMRA 2VDRH 3RGHA 3L6FA 1B0GB 3RWGB 4PREA 3ARBD 4UU9A 3FQUA 1YNTB 4UDUB 4F37F 4RRPA 1RUPL 1VGKB 4XP1H 3EGSB 4ZUUB 4J8RA 1OGTB 1U93A 2O5YL 5F8QC 3AMLA 4AH2A 2EXWC 4NRZB 2IEPA 3QPXH 2IWGA 3QJHB 3ROLB 4QRSA 3HE6D 3FKUS 4QWWD 1N3NB 4JFDB 3UTTE 1TZIA 3PF2A 4PLOB 3LMJL 3G5YA 2OJEB 4OZGB 3HMXL 3VA6A 4L3EE 1U95B 1LQSR 4L4JA 5T3ZH 3LEYH 1FRGH 4LVNB 2P5ED 2BRRL 3MRRA 1CFVH 3LB6C 3N85L 4XP6L 3DJ9A 4AEHL 5F6IC 2BJML 1MJUH 1RIUL 1MCIA 2C3XA 1T2QL 3V8OA 4L4TB 5D7SH 4WJ5B 2R2HA 5I18H 1CLCA 4AEIL 1FFPB 1AP2B 1I9IH 3BH9B 2WK2A 2ZOKB 4FFZL 2OX5A 3L3GA 5MEOA 4HDIA 3SKMA 4M02A 2VXQL 4R26L 2BRQA 2A9NL 3WIIH 2EDQA 4IOIB 3VU2A 2GFBA 2QQLH 2EE9A 4H1LH 1NCDH 3MJ9L 1X7QB 3QIUA 3MYJA 4RMVA 5CIPB 2PYFB 4K3EL 4PPTA 1TJIH 4AIZA 1IEHA 1KIRB 4PRID 3QEHA 2DQTH 2IAND 2J4WL 4DAGH 2GITA 1DL7L 1FZJA 4WW2B 3MLWL 3V6FB 1LNUA 2X1XR 4PP2A 1T0NB 2DS4A 2B4CH 4N68A 1BP3B 3ZDZF 3WLWD 3QG6A 6FABL 2CQVA 3DUHA 2ADIB 3IDXL 3FRPG 1D5MB 4XMPL 4HULB 3VFMB 4WUUA 5J7CC 1NANI 4OZGF 3SGDH 2VDPH 3LRSB 4PGDA 5EBWB 4NM8H 5IP4A 1NUGA 2Z31B 5GRVL 3MV9B 2ICWB 1F2QA 2VLMD 4OFDA 2W0FA 5C0RH 5D72H 4IMKC 1NMAL 3ZSSA 4J3WA 3JWOH 4LLWB 4F80A 4CN1A 2FNBA 3MO1A 4ZTPL 4DVBB 2E27L 4M48H 2AW2A 2P1YA 3SGJA 4E41D 5JR1L 4FG6C 3T3PF 3UYOD 4QGTA 4Y5XC 2X1QA 3BD5A 3CVIH 2J8UF 4RFOH 1A6AA 5FKAA 4OQTL 4X8XA 3U7AA 4F7MA 3BVNB 4TSBH 2R4RL 3TJEL 3VRLE 2C4FT 4PRPE 4NUJB 3P9LB 4RMRA 3O3EA 5F9DC 4JHBA 4K7FB 1OSPL 2FL5A 3KLSA 4X5WA 4M7LT 3C6LD 1BBDL 3F7YA 2FJHB 5FDWB 5FUCE 1H8SA 3VFNB 2HTLD 1HKLH 2OYPA 4X4YA 3BP5B 2HVKB 3DX6B 2LU3A 4M7LH 5KSVB 1MFEL 2FGWL 3VWJC 3EO1B 4JN2A 3MRJB 4U1GC 5F8RC 3FT2A 5DJYA 3VI4E 5B4MC 3DGGB 1M7DA 1XGUB 1UH2A 5SWSA 3VXQB 3U36A 4LHQB 3GMQB 2HFEA 1B90A 2AV7A 4EZMA 5K9QI 3SDAD 3ARBC 4PJHA 1JGVL 3D87B 3F5WB 4HGMA 2JB5L 3G5YB 2H1PL 5I9QC 2ICWJ 4MQXC 1J0JA 2IANA 3H9SB 1H3UA 2XQBH 1TZGH 3G5XA 4NKOA 1RAMA 1U8LB 1NBVL 4JRXB 4ISVA 4GS7C 5IFJA 2FEEI 3QPXL 3MOAL 3RY4A 1ZV5A 3DPBA 2VXTL 1A6UL 1NDGA 3TIDA 3S96A 1N6QL 1A6VH 2WV3A 5CJXC 5B39G 3TBYA 5C0CA 2DMKA 3AS1A 1CXKA 3LDBB 1OAUH 1JWUA 5C0ND 4UDTA 2EICA 3BKML 5D7IF 5KAQG 1MH5A 4Q9QH 3F7RA 4FQXC 4P23C 3PHOA 3D25B 2BVPB 3CK0H 3DVNA 2ADJA 1R5WA 2YD4A 3RJQB 4MB3A 5D1XA 5C0CB 3TBYB 1LK3H 4GRWH 4XRCA 2ERJB 4J12A 3T0AA 1T0MB 2JJSC 2CD0A 4G6ML 5EBWA 1NGZB 3KPSB 5C3LD 4XX1E 1W72B 3VXRB 1YMMB 1SEQL 1KB5L 3WUWG 2AQ3A 2BY1A 2EDHA 5ETUA 2AKRA 1IEBA 2ITDB 5ICYA 2O5XH 2NXZB 1JF6A 1IGIL 3ULSB 2DLFL 4L8DA 4I1NB 1EX0A 3SE4C 3FO1B 1AKJA 5HHME 4X98A 1AI1L 4LIQE 4AM0B 3EFFB 1DVFC 1A1MA 3CFBB 4HK0B 1KG0B 4YHZL 5GSRB 4N8PA 1QSEE 3K46A 3QDMB 4D9QD 1LE5A 1S7RA 4FZEL 4XH2B 5E8DL 3TBSB 4Q6YA 1QSFB 3RRQA 3MLTB 5I1AB 3P9LA 5I71B 1MSPA 4GQ9H 3MNWB 5KZCD 2EDRA 2NTFA 4WW2F 4MWFB 4MZ2A 1WZ1H 5I1CH 2W9DL 4LKCA 4MMZC 5KVMC 5GIRB 5GIRA 5IHZB 5I19L 4M62H 2HMIC 5EO1B 3WUZA 1TVHA 2DQTL 5F7DB 4GW4B 4MDJA 2VNCA 4E41A 3B9KD 3B9VA 4XHJC 1W72H 2A0LD 4DTGL 1Q0XL 3M8OL 4QYOB 4NC1C 3H6JA 3HUJA 5D6CA 5CSGA 3VXUE 1IAOB 2EDXA 2XT1B 3MA9L 3CCHA 2FX7H 1RHFA 1GGYA 1VFAB 2Q76B 1BJ8A 1P7QA 3RIFK 5FHAL 1U8JB 4E41E 3PWUA 4PJ5E 4BQ6A 3T2QA 1U0QA 5JHLL 1XGYH 4LEXL 1J7VR 2PTTA 5F1OB 4EUPH 3Q1SH 1FBIH 1TETH 2DM7A 4KJPC 1GYAA 4U0RC 3WXVH 3BIAX 2WW8A 3SDXF 3WO4C 2KZWA 5IB2B 5IB2A 2AEIT 3LHPH 5EN2B 3V52L 1QR1B 2BFVL 1IT9H 3OJDA 4NQSB 3O9WB 1FBIL 5AYUL 1IM9B 3ZE0F 3T8XB 4JPVH 5FO9A 1U8JA 5HJ3A 3CXHJ 4HHAA 2ICES 3BPNB 3K80A 2D7PA 4GMTL 4FP8H 3VE0A 2PNDA 3F58H 3FB5A 1TLKA 4G5ZH 4KDTC 4HS6B 4X6DA 2VISB 5IHLB 2EC9T 4WFED 3B2VH 5F96H 4D9LH 4KK9D 4UV7H 1QQDB 3V9FA 3EFDL 3HC3L 3VD3A 5IBUB 2BSED 2VZTA 4KI5C 4UIMA 2ZOKA 5CWSB 1UZ6E 2GK2A 1YY8B 3SKMB 4OGYH 2NY2D 3S96B 3F58L 3HNSH 3S8WA 1F58L 1JPGA 3BH9A 5JDJA 4YK4C 5GGTH 2YD9A 1KNOA 1JWUB 4XC1H 2CLRA 3JWDC 3X13B 5GS1C 2VTFA 5GGVL 3MV7D 3TZVB 1HSAA 2H26B 2DQUL 2E3VA 1WWCA 1DSFH 4Z7VA 5K9KA 4YBQD 2VSCA 3BX7C 1OB1B 2A6IA 2EEAA 2D0GA 1A6ZA 3QZWB 4BKLA 5E9DE 3ARED 4OZHB 3VXTB 3WUWA 3PHQB 3L3JB 1OLLA 5E7FA 2ARWA 3IFLL 1XT5A 4N8VG 4CL7A 3MSPA 5SWQB 4KJQD 3SBWC 1BPVA 3GIVA 3C5JB 3IU4H 1P4BL 2VAJA 1JNLL 1RURH 2YK1L 5I66A 3T77A 4X80H 3WO3B 3HLAA 4EIGB 3X3FL 1JHLL 2DQIH 3QUYD 5JXEA 5DJ2B 3LB6D 3JSSA 4LLMB 5DEFA 1HCFX 3N50A 1BQUA 4W6WB 4RBPH 4D9RD 5ADOL 4NUJA 3MBEA 2EYSB 1D5XA 2XOTA 2IPKA 1ZHNA 2PTUA 3EO0A 4DKDC 3VFNA 5KSUA 1IVLA 3RWJB 2ILLA 3RAJH 1D6VH 5HI3D 1X5JA 4I0PA 4R0LA 4Y5YC 4TNVK 1YZZA 2PW2A 1HEZA 4YIQB 1A6PA 3T04D 1U8MA 5INCB 2HP4A 3UBXB 3MRKB 3QWQB 2G9HB 3GSVA 4V1DD 1F4WL 5EC1A 3RDTC 1N3NA 5BJTA 4UAOB 2H2SC 4HKZA 5I1HL 5I8KH 1IGYB 2C1PB 2A6DB 4U6YA 1X5ZA 3MGTB 3QIBD 4XCYA 3ZYOA 2YD6A 1RULH 4KUCF 1U2HA 4JFOB 1LDPH 2MMXA 2BOCA 4I18C 3NIDE 4N5ED 2E6PA 3DYMA 3AREC 2HFEB 4PRPA 1L7TH 4YHKL 1JNHA 5D96C 3C08H 3HI1B 3VXMB 3QPQC 2R0LL 2VDLL 4MXVE 1DVFD 1R6VA 3DGGA 3V6ZA 1J88A 4U1JB 2KH2B 1NAMH 1U8KA 2XZCL 4O2CB 2FGWH 4XWGL 3QHFH 1RUKH 3STLA 2EDOA 3QRGH 3GSXA 5C0DB 2GJ6B 4P3DA 5ACZB 4QY8B 4LLQA 1FNGA 4JANA 1UYWH 1NFKA 3VMOA 5GJSL 3HRZA 3JVGA 4QRRE 2GFBB 4ZFGL 2D7OA 4Y19D 4ODTH 4Z7VE 1NDGB 5F9WB 3T1FB 3QQ4B 1AY1H 3UJIL 5DRWA 3OKKA 4KVCL 1MWAA 1QSED 2VZ3A 3IFOB 5HYEA 1KCVH 4L4VA 4ISVB 2FO1A 1JYXA 4DGIL 5CILL 5I0ZA 2DJSA 4MJIE 5F1NA 3QXWA 4KK9C 3O4OB 3C60A 3NH7H 1JRHI 4L5FH 3TIEB 1PKQB 3HRZB 2P24B 1R3JA 1GC1L 3U82B 3RWEA 3UTSB 1KJ2H 1DJSA 2D3VA 1FFOA 4JFYA 5B38B 3GMRA 1CU4L 4D3CH 4GRMB 4OI9A 4NO2A 5FCSH 3BQUC 3UO1L 3HN3A 1SBSL 3PQYA 3KNBB 4NC1E 4Y2OA 3PP3K 4EDWL 3VFRA 5BV7B 1CZ8H 5GGVY 1MRFL 2A83B 2V9TA 5E2VH 5I15L 1OF2A 5IQ9B 3EFFA 3DETC 4PV8B 4HK0A 1J9CT 3DARA 1EFXD 3VW3H 4MJ2A 1RV6X 3QXVA 3TO4B 3R0NA 3RX5A 3EYSH 3IDMB 4YPJA 5ISZA 1YNLL 3EDEA 1KEGH 1FAKT 3B83A 2XQYG 2Z8WC 1HH6B 4WEUD 4P57B 3VFUB 4IOSD 2FIKA 3IDXH 4S10A 3DSNA 1PD6A 4JREB 4LCYA 3SDCA 3EDJA 4Z6AT 1E4KA 4LBEB 1WQVT 4QOKB 3IXAA 5D7IB 3P11H 5I1DB 2AABL 1OARH 2PO6C 1RIHL 3D2UD 2E7CA 3TJEH 2EIDA 3BMVA 2EIBA 2GI7A 5EZJB 4JAMA 2QV2A 4KVNH 5CBEA 5ALCH 2XV6B 4BELD 3BPOC 1H9VA 4G7YH 2YKLH 3MRKA 2WBKA 3G9VA 1G7QA 3ILQD 1JNLH 4KK6D 1FAIL 4ETQB 5ICZA 3INUL 4K3GA 1NFIB 4OM0L 3VFPB 1ZWIA 3JWOL 4YDIH 1N8ZA 5DJZA 3CSGA 4LCUA 1MIEL 1VADA 1YMHA 3VG9B 4LLYB 2Y72A 3SGKA 4XPAL 3O41B 3PXJA 5AZ2H 4NKMB 5ABDE 1IGFH 2YD7A 2Y5EA 3VI4F 2VQ1B 4JQVC 2BJMH 3VMPA 4ZSOA 4BSJA 5KG9B 1I1AC 3TBVB 1KC5H 3VI3E 5FYLH 2Y7QA 3I50L 5DHYB 1NEZB 2P45B 4HGKC 3BGAA 4AK1A 4LRIC 3OG6B 4DEPB 4DGYL 4MJ6B 2F54A 2IANB 3U36B 3GI9L 4Y4FD 4JPKH 3D18B 3KHQA 3MMEB 4QCIA 1FQ9C 5T3XD 4PJ7F 1KPUB 2EYTA 2YN3A 4LP4A 1L6ZA 1P53A 1BD2D 1UM5H 2F74B 2OTWB 5DQDL 5KG9A 4U0QB 4M8QA 2VLKA 2O5YH 4KUZL 4NNXB 1A64A 4X4ME 2BHZA 4U3CA 2VZSA 3MRHB 1AY1L 2ZCKH 3UJIH 4J7RA 3KPSE 4QHLA 2Z9TA 3NGBB 1NCDL 3DRTB 4OJFL 5MEOB 4V1DE 1C8PA 4U1KA 4M1CC 2X4TB 3RQ3A 2YPLD 2J6EA 1EEZB 1U8QA 1CFBA 5IB5A 1A4JB 1BVLB 1A9BB 1P6AB 2W60B 1QQDA 1KCSL 2GT9B 4JEGB 2VDMH 4YNYA 1H0DB 4ZOEA 5IBUG 4ZTOL 2XWBB 5AYUH 5D1QA 1WEJL 2BOBB 4UIMB 4OCLC 4DCQA 3O2WL 5D7SL 3SJVE 1N59A 5CP3H 2OL3A 4FQIH 4BH7B 4H26B 5C9KA 4FTVE 1PY4A 2X40A 1T89C 3BEWA 5HHPB 3EYOA 4S1SL 2ICCA 4DKEH 4P9HH 5C09E 3BH8A 1XCQA 4L1DA 1NEZG 3G04B 3K2UH 3LPWA 1D5IL 4DVBA 5T1KA 1ZLSH 1IKNC 1HH6A 4OCSL 3RNKA 2GK0B 4M4RA 1PDKA 3TVMD 4IJ3B 3V5HB 4XP5L 5DK0A 5CCKH 3QNZA 1T03L 1F3JB 3IXAB 4I0KA 2MKWA 1FCCA 1RY7B 1BMGA 2AEPH 4JFHE 3LRSA 4U05A 1QFUH 2R29H 3BH8B 4ZS7L 3ALWA 5CEZL 2AJYH 4U31A 4LEOA 3TVMA 4E5XA 5FO8A 1X4ZA 4HSQA 5FA4A 2VAAB 3OKOA 4L9LC 3D39B 1MPAL 1FYTA 4D0BA 1ZHBA 2OP4H 5GS0C 3TCLA 2FJGB 3QNXA 5JDSA 4PB9L 4MD0A 3FQNB 4PJBB 3HB3C 3EOTL 3HZVB 5F7UA 1LEGA 1S9XB 5IWLC 4PYGA 1KFAH 3HUJB 5D6CB 2OTPA 4ZXBC 3D85B 3GHBL 2D03L 1S9KC 2CKBB 5GSVB 1F6FB 5HYSA 3D39E 1M6OB 1FL3B 4PGBB 1DN2A 2NNAA 4X6FB 4QRRD 3ULUF 3NMEA 4KROD 4GRWF 4Y2DD 5HHOD 4X5LA 2A9ML 5F7LB 4UUJA 43C9A 2VLKB 4OI8A 3GRWA 3QDGD 1F02I 2YBRA 4JJHA 1ETZA 5EBGA 1G7LA 2KBGA 5EU6A 4NNYB 1RZ7H 4Z7VF 1DLFH 5A40E 4Q0XL 4NBZB 4NT6A 4U49A 5KN5B 2WMPA 4NKDB 5IBLD 2OK0L 4PJ8C 1QHOA 4XNUH 2FLRT 4U1JA 4XPBH 3RWIA 1JVKA 4CUCA 1K4CB 3UYPA 4OLVH 1M71B 3BZDA 5KVEL 2DKUA 2KKQA 1JYNA