3SGKC

Unique carbohydrate/carbohydrate interactions are required for high affinity binding of fcgiii and antibodies lacking core fucose
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
170
structure length
165
Chain Sequence
LPKAVVFLEPQWYRVLEKDSVTLKCQGAQSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTQLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVQITITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fc fragment
publication title Unique carbohydrate-carbohydrate interactions are required for high affinity binding between FcgammaRIII and antibodies lacking core fucose.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 165
sequence length 170
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgkC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgkC02
1YN7B 1MRCH 1A0QH 4I18B 3VFSA 3DRTA 1DDHB 3MBED 1O5DT 2EZ0C 1MCPL 1IQWL 5C92A 1FCCA 3CFBB 3FN3A 3NIGF 2ZUSA 4CUCA 1LK3L 4IMKC 3UEZA 3LKSB 4GQPH 5KSAA 2FSEA 2NY3B 4XB8A 5GISL 1IEHA 1S9WB 4J4PC 2HYMA 1A1NA 2XZAL 1WZKA 2P5EE 3MRPB 4LGRB 5FYKH 1CLOH 4PRID 2DQCL 2XZQL 2OMBA 4LCWD 3SE3A 5FYLD 3VRIA 1UZ8B 4YHOH 1A1MA 3LSOA 1JN6A 1T22B 2VQTA 5BRZA 5IG7A 4KKLC 5DD6A 3VFRA 2UV3A 2UZXB 4K3GA 4FQCL 1UVQB 3QWOA 3MLUH 1CN4A 1I3RA 2J4WL 4CN6A 4FQXD 1H15A 4XBGB 2R2EA 1GGYA 4OIIL 4OZHF 1ZLUK 2VL5A 4Y5VB 1PKOA 4JFYA 4WUUE 1DL7L 5IQ7H 2Z8WC 1NEUA 3NFSH 3ARBC 2FO4B 3DVFA 1YYML 5A16B 1S7SA 3OL2A 1A5FH 1TTGA 3PHQB 2F54B 2YRPA 4P2QA 1MIEL 2YD4A 4MA3B 5T5FL 1R5VA 3ZHKA 2MHAA 3ARFC 4XAKE 3QXAA 4NM8L 4X0KB 5D7IE 1LNUA 3BDBA 4HD9A 1TJHL 3KPTA 4NOBA 4RZCA 4FXGB 5DVKA 4MNGB 1Q0XL 2N1KA 3G08A 3I6KB 3OKEB 3H6JA 3VRJA 3FFCE 3HMXH 5D6DC 3VWKD 2CIIB 3V7AE 5HHQB 4KHTL 4YIQA 3MNVB 3T0EB 3HAEA 3BH8B 4ONOA 4P4KD 4NQDD 1CDIA 2BVPB 3GNML 4L3EA 5HHVL 1QLEH 2XPGA 1K5NB 3TA3B 5DO2C 5AD0B 3SDAB 2EXYD 4N9GA 5EZIL 3EGSB 2O5YH 4L3AA 3NCBB 1UA6H 3O3EB 2GCYB 3HUJF 4JHWH 4KUZH 4XGZB 5HGAB 4PPTA 5DD3L 4F7PA 3W39A 5B8CB 5EU7E 3BT2L 2GJZB 1XIWA 3TC9A 2D31A 1W72B 4YC2B 4GG6B 4PRHD 3FQNB 4NZRL 1MRFH 3FONA 3WSQH 4QXGL 2HRPH 4U1SB 3G5YB 1QSFD 3W0WD 4DOHE 5K9QG 2DI9A 4N8VB 3O3BB 1BQLH 1IKNC 4PJ9B 2WBJA 1NMAH 1FGNH 4E41D 4WUKL 3O8XB 5EZOL 4HKZA 1LP9E 5C7XL 3HAEG 4M4PA 3F12B 1CF8H 1IGYA 2D2OA 3T2OA 2H3NB 3QAZB 4G8FB 5IVNA 4Z5RA 5I73C 2DB8A 1NCUA 2XIDA 1AR2A 3C5ZB 4TUOB 5I6XC 4PUBH 4LK4A 5IGXL 1MPAH 1VFBB 3LEXA 4JE4B 2OI9B 1ZHNA 1V7MH 5C0IB 2A73B 4PRPD 4YZFE 1MNUH 1SVCP 3FT3A 4MLIA 2XQBH 2Y6SC 2G5RA 3I6LE 1KENL 3MR9A 1N0XL 3NCFB 2HFEB 1A7NH 4NWUH 2B1HH 3MJ9A 3HE6A 3U7YH 4X5WA 1PBYA 5AWNL 4EOWH 5T3XH 3TPKA 3CDGA 3MYJB 4NCC2 3TBWA 3ZKQD 4U6VH 4ZOAA 3TFKC 1AHWA 1WTGT 2HJKB 3EFDL 3THMH 3P2TA 1R0AL 3L3KA 1KPUA 4HWZB 1HXMA 2X9WA 3RWGA 1KG0A 2YMXL 5EU5B 4PLKD 4PGJA 3TIEA 1KJ2H 4UB0H 1SM3L 4HSQA 4QHLB 4MXVE 1BIHA 5E4EC 3AGVA 1Z9OA 1JF1B 5D71H 3B5HA 4F37F 3D0LB 5IOPB 2ZCHL 4DW2L 3L3IB 4MSWB 5TFSH 1LK2B 4KKCD 3K1KC 1K6QH 1G9NC 4LBEA 4UAOC 1CGXA 3Q2CA 2NY1C 2Q8BH 4HX1A 5AZEL 3CK0H 2JB6B 1NCWH 1QA9B 2PO6D 4P2CG 5B3NA 4V1DE 1F42A 2R2BB 1FVDA 3DTXB 4MDJA 2IEPA 3MNZB 5C70A 2ICWI 2XTLA 3DXAA 4ZDHA 3HHRB 1GXEA 4U31A 1ZGLM 1WCBA 3TNNB 2A9NH 1UM6H 5TQ0L 1QEWA 3MV7D 5HYSG 2ED8A 2XWBA 4YJZL 1I1AC 3Q1SL 4YNYA 3IDIA 3KG5A 3BKCL 1X44A 2HN7B 2P8LB 4X6EA 2KQNA 5DHYA 1RI8A 2ITCB 3QJHA 4BKLB 4JFHD 4HKBA 1OF2B 5FB8B 4PJFF 3C2AH 4LQ1A 1CLZH 2QQQA 2IMMA 4TSAH 4IRSC 2PCPA 3QQ9D 1RUQH 3WNNA 5F6IC 5CCKL 5ALBH 4RRPG 2NTSP 4TNWK 2ADIB 3WLWC 3I2CL 3NZ8A 3B2UC 5E9DA 5C0DA 1N4XH 4LLUB 2IANA 2CRZA 3EYUL 4ALAL 3HS0B 2DQUH 5BO1L 3NACL 1ONQA 4L4TA 5IB4A 5LXGH 4XI5D 1T66C 4ZUTB 2WBKA 4LP4A 1R3IH 4Y4KD 4HWEL 5CZXC 5ADPL 1AGDB 4OLWL 4BZ2L 4FFZH 4TOYH 5E2WH 4HGWB 2K9UA 3IXTA 3VXTB 3FQUB 5D1ZB 1QR4A 4HUWB 5DS8A 5I15L 3WFBL 1JHLL 3BP5A 1F6AA 4K71B 4M3JA 1UH3A 3KPRE 3C5JA 3PWVA 3MGTA 4G7VL 2YUVA 1EHLL 4H5SB 3HC0B 1FNEB 3JWDH 1OTSC 5EU6B 3OJDA 3MGOA 3F7VB 3A6BH 1E6JH 3KJ6H 3CZFA 4PG9B 3RKDD 5HHMD 5SX5H 4EUPH 3QHZL 4K2UL 2MQ0A 1OY3B 1NLDH 5FUZH 4YXHL 3OR7A 5IBLD 3MRKA 4NQVB 5DRXA 3RVWC 5MEOA 1UH4A 1ZHKA 2RAMA 2EIEA 2W60B 5GIRA 1R3HB 4CMMB 3FB8B 3GJFH 2ATKB 1TVHA 2AJZB 5E99H 5H35B 2PR4H 2P8MA 4EIGB 4LDOB 4L8CA 4MS8C 2VDNH 1AC6A 5EO9A 5B39A 5GS0L 3HPJA 1RPQA 3X12B 5JA9A 2ZSWB 3UTTA 3MV01 4GQ9L 3ETBF 4MB3A 3K1DA 4IHOB 4JR9H 4PD4J 4FNLH 2EKSB 1SJEB 4S1QH 1ERNA 3S3JA 4J8RB 4PJAE 5JOEA 3ZSTA 5HGBB 3KYMB 4MA8L 1MUJA 1ZSDB 3B6SA 2VLRD 3MLXH 3KPOA 1BVKB 2W0FA 3CU7A 2NY7L 3HRPA 3HI1A 4IRJB 5E6ZA 1G7IB 4R4BB 4OM0H 2W9LA 2EDQA 5CHNA 4DGIL 5ABDE 3Q6FB 4LVHC 4X9IA 3WHXA 4XXDB 1B0GA 4R2GC 5HHNA 3IJSA 1JZ8A 3QULA 1A7PL 3NBNA 2IQAB 4NHUB 1OLLA 4OT1L 1P9MC 1CLCA 2IADB 5B39G 5HD8C 4YGVB 1N2RA 3DBXB 1RURH 1JL8A 4PRAB 3MNWB 1ZT7B 4Z78B 3O4LE 4QYOB 3P9WB 4Z7OE 3NGBC 3BZFB 3C87A 1IILE 2W9EL 4X5XB 2C7UB 1J05A 1XF3B 1R5WB 4OCXH 1EVTC 3ZO0A 1U8NA 1JPFA 2YD8A 1N5YH 4XP4L 3BQUD 2JJSC 5B22A 2BFVH 4OI9A 1J8KA 3MLVL 4PJHA 1DQLL 1EEQA 4C54A 4S0TD 5I8CA 3BVNB 3DYOA 4P2QD 4OB5L 1T04A 4JLRB 3V4PH 3T2QA 3BDYL 2DQDL 2VQ1B 4WFHD 4ODHL 3GSNH 1WEJL 4RGNB 5IJVA 5CFHA 1EMTL 4I3RL 2LV4A 3SCMC 3B9VA 1A6UH 4PJ8B 3O2WL 3BPCB 3EOBB 3F7YB 1LMKA 3RKPA 3H3PH 1HSBB 2VXVH 3TV3L 4XNZB 4CVZA 1QYGH 3NABL 5TE7L 2IH3A 2V2TB 4G8EB 3HC4H 1H0DB 4NO0B 2YN3A 3MFFB 3DURB 5C0AE 5GS0D 1CICB 2PTTB 3CLFH 3GGWA 3PWLB 5ANMA 4S1SH 4YDKH 4YR6A 1KJVB 1E4KA 1A6ZA 5IT2H 4HPYL 4XC1H 3U0PA 1N7MH 3ALWA 2VIRB 1ES0A 1KPVB 4X98B 3HC3H 2EH7L 1DVFA 2VLKE 4P2OA 4P46D 5KSBB 2HA1A 2YSSB 3A6CL 4LSUH 1EAJA 5DURD 4GAJL 3U4BH 5C09B 4PJ5B 2ICES 4JY5H 4YDVA 5I18H 1NUNB 5HHOD 1A6AB 2GAZA 2XKNB 1FNFA 5GGQL 4HKJA 3BX7C 5DRZB 1HSAA 5EH1A 4M7JL 5IHZA 2W0LA 3OJMB 1OTUD 3VMNA 2CXGA 3D85B 2X4OB 2HTKD 3BP7A 1C08B 2DQIL 1ZLWH 2Z91A 1GZQA 3IFOB 4GKSA 4P5TA 1J8HA 3MBEC 1L7TH 3QUKB 4HS6B 5L2KB 1GGBL 1T7VA 1PW3A 3G9AB 4JM4H 3QIUC 5DYOB 1ITBB 3MV9B 3QQ3B 3PABA 1NKRA 3NCJH 1TETL 4LQFH 5D72H 1NGQH 2R0KH 4N0YL 4ETYA 1YY8B 1A6VH 4LSVL 3ARUA 2P5WD 2XTJD 4JDTH 2IF7A 5L9DH 1TFHA 3O2VL 1NFDF 3GKWL 3HE6D 1BD2A 4DVRH 3CVHB 2XNAA 2PXYA 3N9GL 1BQSA 2X40A 3L3JB 3BD3A 4C56E 5T1DH 4BFIB 3KGRA 4K7PL 2LVCA 4N0FA 2PETA 3SPVB 2UY6A 3TZVD 1P6AB 1X5LA 3GBNL 5DJ6A 4PJBE 4RAVA 2BNQB 4OZIF 2RIKA 1KIUA 1D5XA 4M6OH 3O6LL 4FQXC 1W0WB 5F9OH 3KPPA 2G2RA 4DN3L 5HDOA 4XP1H 4HIJB 3G04B 5IMLA 4JQXC 4LKXB 3PG2A 3QFJA 5B4MD 3S36L 4OCYH 3VG0H 2E6PA 4D94A 2R23A 4CNIA 1AO7D 2VDQH 3O0RH 4U1IB 5DI8B 2EYRB 4POZD 4W4NA 3D2UB 1RUKL 4KZEH 1RJYA 3EZ8A 1EEUA 2DWEA 3U0TA 1Q0YL 4NSKA 1QZ1A 4C57C 4D9RE 4K3JH 5I74B 4XMPH 4I9WE 1AIFB 1M7IA 3DYMA 3DO7A 3MXWL 2XXMB 3VGBA 3SKUD 3NTCH 1AI1H 1CBVH 1FFQA 4U1JB 4Z7UA 1J11A 5FGCB 1KTLB 2VZ1A 2IBBA 5JUEH 1QTYT 3S4SB 4LCIL 3BIKA 1ZWIA 1FVCA 3VWKC 4Q97A 1A1NB 1BFOA 4OV6F 1UWXH 3SJVA 1RULH 1YEHH 2FIRT 4HIIB 4I2XB 5TH2B 4P4KC 2B2XL 1B4JL 4KQ4L 4PY7B 4Y1AA 1CT8A 1WLHA 4YEFA 4HKXA 1LQSR 2EXYC 1OARH 5DJCB 3ARDA 1ZGLB 4Y4FA 3WD5H 5E8EA 5IG7B 3TF7C 2VQUA 4GBXA 5IK3A 4G3YH 1CFSA 1BX2B 5EUOB 2HWZL 3TN0D 3I84A 4UINL 2Y5EA 3ZE1E 1H15B 4G8GA 4F7CB 1LE5A 3BD4A 2H26A 4HS8H 5EBMB 3OMZA 3E3QC 5BCAA 3OX8A 3HE7D 5I1GL 4APQB 2OTUA 4WGVB 4GW4A 1TDQA 3ZTNH 3BAEL 5DJAB 1AH1A 4WW2B 5FUCC 1U8OB 3S3SA 1YQ2A 1R5VB 1RIVH 5IB1A 4YHZL 3WCYA 2HH0H 2B5IB 3QI9B 1HQRA 4F9LC 5IB5A 5D9SA 2Y7QA 5DR5L 3ZTJG 3RDTD 2IBGA 2OR8A 3U2SA 1F58L 2XKUA 1NC2A 3AS2A 1CDBA 1UENA 3BXNA 4HQQH 4P59L 2X4NA 1BM3L 3VGAB 4Q58C 2A9ML 1NDMA 2NY5C 4K3EL 3ZYJA 4UU9A 4KTEH 5EPMB 3PHOA 4N0RA 1CD8A 3BSZH 3MV11 1T80A 4FQHB 4OZ4A 3NIGE 1MAKA 3GRWL 4NYLA 4UTBH 4ZOCA 2GJ6E 4Y2DD 4BFEA 1HEZA 4PJ7E 3EYVA 2YBRB 3GK8L 1M7DA 1N5AA 2QQLL 2H6PA 1QBBA 1NL0H 4JFDB 4DQOL 3QZWB 4ONHB 3NCMA 2HFFA 4IMLA 1N8ZA 4S1DD 3MRQB 1KULA 5LGHH 3DMMD 1XIWB 2VISA 4PLKC 1CYGA 1QFWH 1WJ3A 2B0SH 3I9GH 1K4CA 1U8IA 4LHQB 5K9KB 1JGVL 1QVOB 5IVZA 3FN0L 4MCZA 4R0LC 2VLJD 3QG7L 5HPMB 4KKCC 3RQ3A 4Q9RL 2AW2A 1F4WH 2F5BH 1X5YA 3T77B 3WN5C 3KLSA 2PO6C 2JELL 2BNRE 1DN0A 4J3XA 3UJTL 5BS0A 5J3HD 2RFXA 4OZHE 1IGYB 3UTPE 4RGOH 3B3IA 3RGVA 1JNHA 5KW9H 3OB0H 4OD2B 2NW2A 4QRPD 1KPRB 4A6YH 3H7BB 4OLYL 5IW6B 1DBAL 4D0CA 5FKPB 5FECB 1MI5A 5INCA 1YQVH 1RIHL 1QLRB 4WHCA 1F00I 2BVTA 4LAQH 3O81A 5JIKA 1JP5A 1R5IA 4WVRA 4ZNEA 4OKDA 3QDMA 1DE4A 2J5LC 3MR9B 3EYFA 1URLA 3RGHA 2R0WL 3GO1L 5CMAA 5IVXA 3ME0A 4FABH 3DV6A 3QQ9C 3EBAA 2ZOLA 4I3SL 3VXRA 4M5ZL 2J8OA 1KN4L 2F74B 3ECBA 1KIPB 5I2IB 4QRRA 3L3KB 4TRPH 3HCVA 2VKWA 4OM1H 3BDXA 1JV5B 4JG1H 4EI5A 4WTXA 2F54E 1JHKL 5ISZD 3D3VE 1SY6H 3MRRB 1FO0H 4QRQB 4ZFGH 5GJSL 4OFPA 3TIEB 1LO4L 3K2MC 5ESQA 5E1AB 3KPNA 1I1YB 4XI5C 4NN5C 1F2XK 1QFWI 2FR4B 3RFZC 4UIMA 2AI0L 4Y4KC 3EHBD 2VZSA 2WZPD 4LSRH 3WFCH 3MLZH 3C8KB 3GMRB 3IYLW 4OCRH 4NBZB 5EU3B 3BE1H 3UJIL 5E2TL 1EXUA 3O3DA 3QSKB 4MDJB 4N0CD 5I75C 5KTEL 3GMPB 5DEZA 2HKHL 4AT6A 1OGTA 5FM4A 3K3QA 3L3DB 4C83B 4XWOD 3P11L 1W72L 2VLME 2NY3D 1NSNL 2DLTA 3K0WA 4MJ6A 1Z3GL 1IM3B 2D0HA 5FOBB 4M48H 3O3UN 4ODUB 5KOVC 4JFOA 4N8CH 2C4FU 2M1KA 4JPIA 3RKDC 5ALCL 4FZEL 2F19H 3QJHB 1NUGA 4Q6YA 1E4XH 2E27H 1N59A 3SDDB 4BSVA 3BRGC 3T0BA 4JM2D 4ZMAT 3F65A 5BW7C 5E2UH 5I8OL 2PCPB 2WQRA 3MXVL 3VFTB 4I0PA 3NZHH 2XN9A 3K4DA 1IL1B 4CKVX 1YMME 4I77L 3AROA 4PIRF 5DJ0A 5AEAA 5CP7A 1V3LA 4O2FB 5E9DB 5C0DB 1P7KA 4Q6IA 2APWA 4MNQA 3LKQB 4M93C 1UB5A 4MLSA 4P23A 4KDVA 4K3DH 4ZYKA 1IEBA 2FJFA 2VZUA 3QNZA 3ZL4L 2ZUQC 1S9VB 4OZGF 4LLYA 4YQXH 5AZ2L 4XHQA 2R0LH 2XZCL 3RIAK 2I07A 2RHEA 43CAA 1WWBX 2Q20A 4DKFH 5EOTB 1QSVA 1F6AB 5C0FA 3QFDA 4X6FB 3SKMA 1RVFL 1G7HA 3MRDB 4Q9QH 4JANA 4KZDL 5HYQA 3MGTB 3KWWA 4JFEA 4NQXA 4V2BA 2DQJH 3VJ6A 4OIAA 1XAUA 3IDUA 3IDXH 1U42A 3MGOB 1S7TB 4J1UA 4UQ2B 5FKAA 4LFHD 4X8JA 1S9KC 4U6XB 1F6LL 4XNUH 3T0ED 3CZFB 2XRAH 1QBMH 4H1LB 5KBNC 4UV4L 3E8UL 3BWAA 5H2BA 1AGFA 4AH2A 5KJRL 3TA3D 2FCBA 3MRKB 3TM6A 1MQ8A 3FQWA 2RJMA 2I26N 3U9PL 1E4XI 1IGTA 4LEXL 2VDOH 5EUKB 4OGYH 2VDMH 2GUOB 2OX5A 3E6HA 3OKOA 5EWIL 1D5IL 2P8MB 2BMKA 2CIKB 4PJFE 5I19H 4KJQC 3BQUC 1WF5A 1CFTB 3R1GL 1FNSL 2W91A 2DQTL 1PLGL 1BZ7B 1AR1D 4B5EA 3LS5L 2FZ3A 1FYTA 5HYFA 1MFAL 3O8XD 4HXAH 3SKJL 4YHYC 4EJ1C 1FFNA 2Z93B 4M6NL 4KU1A 3OV6A 3VDCA 4JKKA 4GAFB 1I3UA 4EN3A 4HUVA 3P4LA 1S9YA 1CFQB 4KDWA 3GI8L 3KXFA 4ZQKB 4DZBA 2X4PA 3KYNB 3C5ZD 4GXVH 2VH5H 3HPLB 3IDGB 2AK4B 1DQTA 2CO6B 5E6ID 3CFCL 3HLAA 2QR0A 4NT6B 5GS0C 4TN9A 3RL2B 1EA9C 5E2VL 1BVLB 2HFGL 4Z6AT 2Z92B 4KVCH 3NA4A 4EVNA 4XRCA 3K7UA 1CXLA 2KUTA 4TQEL 1MIMH 2MMXA 1T03L 1NGPL 1Z6JT 3MLYH 3KJ4B 4GBXD 4ZTPH 2BDNH 4P46C 4QCIA 2DKUA 4JRYB 1E6OL 5CAYB 2BJML 5I8EB 3EJZD 2YS4A 1UFUA 4OF6A 3DX8B 4TPRL 4HULB 5JMOC 2XG4A 2R4SH 3L1OL 5C07D 3ZHLA 5IESL 4E9LA 2DICA 3WIHH 3TEUA 3FRPA 1OAYL 4UT9L 2VLLA 4LMQE 4QRTB 5ITFB 2VAAB 1UWGH 5DMYA 3Q5OA 5I8CB 1SVZA 3MODH 1EHNA 2HTKC 1QFHA 4LIQE 4QOKB 2FBJH 1FZMA 4KGLA 4DEPB 4PJDB 4O2EA 3O45B 2XWJB 1I4FA 3RNKA 1KOAA 3DOSA 1IGML 4JZJB 5SWZB 4ODTH 3TBTA 1RK1B 4MQ7B 3WIFA 4HJJH 2CRMA 3HNTL 4YDIL 3RWHA 3UYRL 1NFKA 3IU4L 4ZAKB 4HIXH 4OSUL 2BVOB 1J0JA 3DRQB 4PJHF 3RWFB 1MHPH 2JE8A 1INQB 2X9YA 5GQBA 1GC1H 4OLXL 2CLZB 4M6MH 4XPBL 1RZKH 2XTJC 2WIMA 4PP2B 3JVGC 5JDJA 1DN2A 3MLSL 2SEBB 3LVEA 4JN2A 2Y23A 5E24E 3QCUL 3FRPG 2P46B 5GSRA 3SE4A 3U30C 5T1LA 3TZVC 4WFGD 3D18B 2DLFL 1FJ1A 4PYGA 3RZCB 1AGCA 5DHVB 2BERA 3O6KH 5FOJA 4XVJL 1QQDA 1TZGL 4YDVB 1E4WH 1KLGA 3I50L 2F9BT 3P9MA 4NHCH 5BV7L 5DVNA 3IVKB 3JWOH 3QNXB 2P1YA 1Q9LB 1NC4B 4H26B 1JMXA 2ADFL 3TLRA 1C8PA 2CKBA 5B4MC 3K74B 3BP7B 2W59A 3LDBB 3UC0L 4ETQB 1F5WA 4Z7VF 3RPIA 1U93A 4POZC 5D1ZD 1GGUA 1JGUL 2A74A 3MJ8A 1XGPB 4JM2F 4PJEB 2CUHA 5D2LB 1IARB 2PTVA 4N1HB 2FIKB 1VDGA 1E27B 2D7PA 2A6JB 2QQKL 4G9DB 4RDQG 1FNGB 3BISA 5EU6D 5E5MB 4I0KA 2IBZY 3QO0B 3UTZB 3K81A 2AV1B 3BO8B 4AIZB 1KJMB 4LPVA 3OXRA 4AY0A 5DFWH 4CJ0A 3AMLA 1CVRA 2YPLE 1JGLL 1UJ3C 4PV8B 3LKNB 3Q0HA 1XGQA 4TUKL 3QBTB 3KNBA 4GMTH 3SGJA 4HIHB 3DROA 1MAML 1S7UA 1IAOB 4X9BA 5HYJE 5BQ7B 4PJIE 1FQ9C 4PRDA 5DMGD 2H9GB 1X9QA 1B6DA 4RAVB 5I1HH 1ZVHA 2CGRL 5MEPA 4Y4HA 4LLVA 1YNLH 3TN0C 1D5XB 1DTUA 3N06B 4RGNE 3V6ZA 3MCKB 1M1SA 1MREL 2G2RB 5SX4H 1DUZA 1F4YL 1EEYA 4AIXA 3VXSE 2BOBA 3D48R 1X5KA 1HNFA 2YUZA 3O6FB 4F33A 4YFDB 3FTGB 4PGCA 2EE9A 3HE7C 1UM4H 4P99A 1RMFL 4WJ5B 3SKNA 3WXVL 1DCLA 4D9QE 3QUZB 4HV8A 4M7LH 3K4AA 5EDXA 1I9JL 4ODVL 5IMOB 3GMQA 4M61B 5T3ZL 4G42B 4NSKB 3MO1A 4EZMA 1QHPA 5F7UA 1PVHA 2QLVB 5K9JL 1OAZL 1IVLA 5EORH 1D5BA 4IRJD 3RDTC 1BFVH 2R4RH 4XP9H 1MCCA 1BGXL 2RR3A 4Z7UB 1MLCB 4FA8A 4UZGA 3D39B 5FHAL 2ZKHH 1WIPA 1QNZH 1VEMA 3NN8B 3MRLA 3ARGB 1M4KA 4UNUA 4XCCH 1GSMA 3HKFA 1CIUA 3OPZL 5IM7B 2UY7A 2ZG2A 4JFZH 4Y1AB 1CR9L 3C6LB 4Y2DC 4WDIA 5E0QA 1T0MB 3ARYA 3HFMH 1BIIA 4HKXB 5HGGS 3O6MH 4FXKB 4RGMC 1HHKA 4CVXA 5CJXA 1XT5A 3BHBB 3GSVB 2EDLA 3G5XA 3SBWC 4AENA 4KVNL 4UNVA 2DTSA 5KSUB 4S1DC 3HNVH 4ZSOE 2VKXA 3DMMC 4PRNA 5CEYB 3UBXB 2C3VA 5CINL 2H1PH 4G8GB 5GS1C 3WFHA 1XF4A 2J88L 1OOAA 3L3HB 3MV9E 5HI5D 3WUWA 3BMWA 3L5XH 3CVHL 3NFPA 5CZKA 5SX4I 1X4YA 1K3IA 2VITB 7CGTA 2GT9B 4KMTL 5GHWH 2OTUB 1MRDL 4D0BB 3MLWH 3IKCB 4JRXB 4ZUUB 5J3HC 2VC2L 3PP4H 3P4NA 4JN1L 4IOIA 3NH7H 2YR3A 2AEQL 5EBLA 2Y7QB 4PFEA 3DX7B 1LO0H 5GS2D 1ZHLB 2X4NB 4NO0D 3P40A 1BJMA 3PHOB 4LSSH 4MD5A 1B0RB 2QHRL 1A9BB 2F53E 3EYSL 2EKJA 4NO2A 4NQCE 1SJHB 4PGZA 2VZTA 3OKMB 2HVJA 4M43L 1M7DB 3ABZA 3T4AA 1S7VB 1NKOA 5FM5O 3WUWG 4BQCA 4G9FE 4WU7A 5BVPL 1FL5B 5ILTL 5T3ZD 1U3ZA 3JTSA 5IEHA 4HFWB 2YXFA 1P4IH 5C09D 4PJ5D 1A2YA 2AXFB 2B1AL 3T0DA 4LIQH 5CIPH 1GZPA 2CPCA 1EZVX 1AFVH 3U4AA 2YKLL 2EDFA 25C8H 2EIZA 3D85D 1KELH 1CD1A 2WLZA 5JIHA 5CP3A 5EOCL 3OKDB 1QO3A 3QEHA 4TVPL 1WICA 3MLTA 4NNYA 4Y2OA 3TCLB 1G6RB 5FGCE 3NFNB 1W2KT 2OK0H 4I18C 4P9HL 3H9HB 5L2KD 5BS0B 4N0CC 2BSED 3Q5YA 3NIFF 3AY4C 4KI5D 4OD1H 1CU4L 1JNHB 4XWOC 1PY9A 5IR1A 3V5HA 1MFBH 2CKBL 3BPNB 3SY0B 2NY3C 3OKKB 4P57A 1J0KA 1MCPH 2ENYA 5EZJB 1IQWH 3VXPA 5D1QA 5BRZE 1ZLSL 5CKGA 3P0VH 1PZ5A 3T3MF 5IMMB 3DNKA 2UYLA 1IQDB 1MWAA 4MQXD 5DDHB 4P3DA 3V6FB 4OZFA 5L7XL 2CLRB 5CMAB 1OSPH 3WDJA 3T2NL 4JM2C 2O5ZH 4PJXB 3TBVB 1FC2D 1JZ4A 2YD9A 1AE6L 4CU8A 1ZLWK 2DQCH 1WZMA 4IBLT 1ETZA 2BNQD 2OSLB 2DQEL 4X6CA 4L3CA 3WNLA 1KXVC 1CZ8H 3PE9A 4LMQI 3ARZA 5D5MA 3CSPA 3WS3A 4LEOA 5CBAA 4Y5VC 3FB6B 1S78D 5ESQB 1A02N 2YC1B 4HF5L 4JO3H 1MCHA 4NO3A 5IVXF 1BQHB 4F9PC 3L3OB 2GSIA 1FYHB 2B8OT 4O9HL 2DTMH 1TZIB 5KSVB 4H8WC 3DHJA 2BSTB 1AGEB 1EXUB 1A47A 2BSSB 3F7RA 1MCEA 4NRZA 4WHDA 3ALXA 1MLBA 1NCDH 4AT6B 3LQZA 3EW3B 2JIXA 4L3EE 5INDB 4KJWD 4XCEB 4JFDE 4PB9L 4NM8H 3FO1B 3TH4T 1HXYB 3V52H 3T0EC 1Q0XH 1A4KB 5C08A 3L7EA 3BEWB 4TVPD 2ESVD 4BH7A 3DI2B 3ULVD 2OLDA 3TA3C 4YHKL 2X4UB 4G6JH 1QR1B 1ED3B 1RQ5A 1XH3A 2CQVA 3SQOL 4L29A 4HZLA 4M7ZB 4ZD3H 1JZ2A 2HT4D 3B9KB 3GNMH 3WE6A 4FOMA 5HHVH 1PYWA 1DFBL 3IDYC 4FQLH 5DJ0B 5FYJD 3WLBA 5ETUB 5B8CC 2F8OA 2IAMA 3NPZB 4YC2C 3BZ4A 5KG9A 1SEQL 2BCKB 2XACC 1BQUA 4U1KA 1A1OB 4XNYL 4JZOA 5DD3H 4JFQB 5ESAA 2EECA 1G0YR 4ZYKB 4PJ9C 4X4MA 5IF0B 1FG2A 4APQD 1AR1C 3CMGA 4NZRH 2JCCA 1UADC 3JV6A 4YO0A 3MOBL 3O8XC 4NRXB 5JO5A 2QV2A 2NQCA 2YD1A 2HMID 4CAGA 4ELKA 3QAZC 3QI9D 4PLNC 2FX7L 2HJFA 4FHBD 3MV8B 5TE4H 3C5ZC 1NBYB 4WUKH 5DUPL 3VFGH 5T1KB 3W9DB 4O5LL 4KTDL 5EZOH 4U0RB 4JFFB 5C7XH 3GI9H 3RVUD 3O9WA 1DUYB 5IBTL 3MZTA 5E6IC 2VXUL 3H9SB 4LCYB 2IALB 4L8DA 4LCUB 4FG6D 5IGXH 4D9LL 1RK0A 1E28B 2CMRL 3BW9B 1HILA 4QO1A 3D69B 4AH2B 4H0IA 4JQIL 4P2RA 1VGKB 5HYEA 1VEOA 1WBYB 4PJCA 2FEEL 1KENH 1N0XH 3EJZC 3VE0B 1VADA 4TTDD 3TO2A 5DTFA 1BZQK 3STLB 1NAKL 2VDKL 1EFXA 2Q3AA 1IAMA 4D0DA 3TWCH 4K8RH 3G9VA 4NZUH 4OLVL 3EFDH 3N85L 1U3JA 2Z31A 3DXAE 5DD1L 5ESVB 2CD0A 1JK8B 3QUXA 2P45B 3RWJA 3GBLA 1FAIL 3C60B 1Y6MR 4Z0BL 3GIVA 5LGJB 3QXUA 3A67H 4N90E 5LJYH 2PW1B 2VXQH 4F3FB 1NDGB 2YPKB 1SYSA 4EN3B 2ZCHH 4DW2H 1KB9K 4YXLH 2ARJQ 1LEKA 5AZEH 2B39A 2ICWJ 3QUMA 2OXHA 3EFFA 4X7EC 4X6DA 1DLFL 3IDJA 4MCYB 4H25A 4GMSL 5JIIA 3RRQA 5MI0B 4BFBD 5C0CB 1WT5C 3RTQB 5J9PB 2A6KB 4LKCA 2J3SA 3X3GL 5E9DE 2H32B 2IANE 3Q1SH 5T1MA 2ARJB 1TMCB 3S88L 3BKCH 3FOLA 3CDFA 2GTWB 3WFDL 3O2DH 1G7MA 2VUYA 3MMEA 4L4TE 3REWA 1ORSB 3VW3L 1KCVL 1TCRB 1A21A 5HVGB 3QIWB 4XCNB 2FECL 4PB0L 3QA3A 3BJLA 4CADB 1MSPA 2APXA 4FQQB 1QPXA 4PBVC 1N6VA 5F44A 4KI5F 3OAZH 5DUMH 1F4HA 4YDJB 1IRAY 3OZ9L 1MWAL 3RY4A 2OR9L 5DMJB 3OB0K 4PJGA 4MDIB 4ALAH 1T0NB 1AD0A 3ARSA 4ZFOA 4NOFA 4PREA 2EICA 1J1PL 3NACH 5D1ZC 1JZ6A 5J6HA 4ZFFA 3UJJL 4S1RH 5D7JB 3TJEH 4K71C 5BVJB 1T83A 4UUJA 4OLWH 2WQ8A 3SE8H 4L4VA 1CI5A 1GPOL 1RFDL 1XGTA 2FHCA 3PWPB 4M8QA 2FD6L 4CGTA 2D03L 5IW3A 1JZ7A 3ZE0F 1EO7A 2I60L 1NCNA 1M71B 3UYOD 4FQ1H 4PR5B 2UUDH 1EERB 2BHZA 4JO1L 4LL9A 3KS0H 4G7VH 4ZPTA 3V8CA 1EHLH 1WBXA 2OP4L 4JN2B 4X9HA 1JPGB 3ZT5A 4YHNB 5FO8A 3ULUD 2CLVB 3AS3A 3FMGL 1H5BA 4Z0XA 2DQGL 3GDBA 3ORJA 1KIQA 4YUEL 5T1LB 4Y88A 3MLPA 3UTTE 1VCAA 4K2UH 1P84K 5DMGC 3WV0A 4CDHA 1F45A 4UNTA 3L5WB 5EC2B 4UDUA 4P3CL 4EDWL 1BPVA 1K8DA 4JQVC 4J3OC 4GRLA 4OKVA 4Y8DC 3T0VA 3AB0B 4Q0XL 1EGJH 4XH2B 2R39A 4EDXA 3AREB 5JHDB 3K4ZA 4HBQA 5D2NA 4RDQF 5F1IB 3CFEA 1IKFL 2OQJA 1NBQA 2X4QB 3E6FA 4XT1C 4OLUL 2D0FA 1VB9A 5DJXB 1HKLH 4KAQL 4K94C 4LPYA 2V7NB 2QADB 3MRFB 4QXUH 1JIBA 5EZLB 2CKNA 3VFVA 3CIQA 4U1LB 4IRJC 5L0QB 1CDGA 1P7QA 1R3LA 2D7MA 4XPHH 3GM0A 5F3HA 2X4SB 4MA8H 2VNCA 4QHUB 1YEKL 4D8PA 2VO5A 1BFTA 4QHKJ 2P8PA 3WHE1 5ID1B 2V5TA 1O7VA 3LMJL 2C3WA 1CTNA 1IC4L 4TUJB 3VWJA 1KFAL 5TQ2L 2OZ4A 5I1KH 2CDFB 4PJHE 1S7UB 3BZDA 4WW2F 4X4ZA 1CGVA 3SDXA 4F7MA 1KT2A 5E7BA 1SEBA 3FFDA 4YX2L 1A7PH 2EO1A 3SGKC 4O4YL 1T0PB 1WUNT 1UKTA 4PJDE 2X44D 4OT1H 1BAFH 4Y4HB 4LLVB 4ZUWB 2Y5TB 3OBAA 1FZJB 4PBWD 5I66A 3RNQB 3ILPB 5K9QI 1DBKH 2D7TL 4PV9A 3AC0A 1P5UA 4QKXB 1OGAA 4NNPL 4AL8L 5HI5C 2EYTB 1I8LC 4R7NA 2A77L 1G7LB 1OQXA 4WTWA 2W9EH 4WHYG 4KWUA 5JQ6H 1NGXA 5KAQG 1KCLA 3CFIC 3KYOA 3FO0H 1I7TB 3NOIA 4DJMA 4O2CB 5DQ9A 1OAUH 5EC1A 2VOTA 6FABH 4HUXA 1DQLH 4HV8B 4TNVK 3MJ9H 3LKPA 3JV5A 3GMQB 4PTTB 3HG1D 1KGCE 3BDYH 5ANME 4PJ8C 5I1AA 5TDOA 1Q72L 4Y19A 1DQML 2DQDH 3PIQA 4IMKA 1X5HA 3AS0A 1JCKA 4XNZC 1RZIA 5EA0H 1ZT1A 2AK4D 3QDJA 4J4PA 2Y25A 5IBUB 5ECJE 1ND0A 4XC3L 5DC4B 4JCMA 5E94A 1KCRH 2ICWB 3O2WH 5DK2B 5JTWA 1TTUA 4QTHB 3F58L 3EO0B 2R0ZL 4FZ8H 2H8PB 4GRMB 5DHXB 12E8H 2OYPA 3GMOB 1YDPA 2F15A 3QUML 4JRYD 3N1FC 3VU2A 1XCQA 1REIA 3RI5F 1EO5A 5F9WB 4HPYH 3LY6A 3T4YA 2WAHA 4NQEB 2I5YL 1MCNA 5K33A 1J8HE 2GITA 4U3CA 5I1DB 4ENED 3I75A 5GGUB 2EIDA 3A6CH 4P49A 4U1MA 3LS4L 2JJVA 3L5IA 1NGWA 4JB9L 2AP2A 2NX5A 4QOKD 4WRLA 3ARBA 2DJSA 1FH5H 3P4OB 4DN4L 1XGRB 3MSPA 4UILL 5AYUH 5SWZD 1GRWA 1RZJC 3P4NB 3ARFA 2DQIH 4RFEA 1MCWM 1KJ2B 1BD2E 4ISVA 4KI5C 4ZAKD 3LB6D 5EBLB 4DKEL 4HCRH 3R0NA 5H37G 3MBXL 1U0QA 1EAPA 1GGBH 4LNRB 4JKPH 3ZKMC 4QT5B 2QEJA 4ZFOL 5D6DA 5CBEB 4DFHA 1IFHL 1RD6A 1T1ZA 4Y0GA 1F3DH 1MJUL 4R3SA 1OAQL 4ELMA 3LPGA 4WO4B 3KYAA 3MRJA 5LKNA 1LO2L 3MREB 4LDEB 5EO1A 4N0YH 2AJ3B 2W0PA 1D9KB 4MQXC 1N6QL 1C12A 3U6RB 1X5XA 2V17H 4DUXA 4MJIA 1IMHC 1UB6A 3T4AB 3QRGH 4ZUSB 5E56A 3PQYA 2Q1EA 5LWYL 3ROLA 3QFJE 1X5ZA 1Y0LA 4BH8A 4LSPH 3RZCD 3FQRA 1N26A 1U8PB 2NZ9D 3OKNA 3VDBA 1BQHG 3QUXD 4DVBB 1S78C 1NC4D 3UTSA 1GIGH 1EIBA 1ZHBA 3ISWA 5LGKA 4M1DH 4XX1G 3WUZA 4NFBA 3AAZA 1A3RL 4WI5A 4Z95H 3O6LH 1IKNA 1C5CH 4H1LH 4HZAA 1X4XA 3GBML 4Z7UE 3L95B 2AJYL 3FAXA 3FQXA 3OXSA 4XP5L 3V4VL 4L8BA 4BSJA 4YBLB 4LAJH 3M1BB 4K7FB 1LEGA 2C1PB 2EDHA 4FTVA 5BZWB 3S36H 3SJVE 4EQ2A 5HVHB 1AJ7H 3BRFA 1SJXA 2Y36L 1QLFB 3CCHA 4Y1AE 5BJTA 3MA7B 5IR1B 4KJWC 1RUKH 2WUCL 4LNVA 5DRNB 1G7PA 3DSFL 3LQAC 4P57B 1Q0YH 4KUCD 2F8XC 4LLQB 4JY6B 4IEFB 5T33H 3GHEL 2FX8H 5DFVD 3MXWH 3F6IA 4EI6B 4AG4H 4MNHA 3SO3C 1KNOA 4OZFB 3ULVC 2E8ZA 2EH8H 2P5EB 1BOGB 3HZKB 4P4RA 3BZEB 1G9MH 4RAUA 4G8GE 5C0EA 3L5HA 4HDIB 4G6KL 1EBPA 4YPJA 1I9EA 1B4JH 3LN9A 2HT4C 4I0CC 2M8XA 1QSEA 3IF1A 5MENA 5D5MB 5DQJB 4OI8A 4NGHL 4U7SA 3J7HA 3O6FD 3ZDZE 3QP3A 1MJJA 2A6IA 4X7SH 4OUUA 1KN2L 4NO3B 3FZUD 4APQC 4X7TB 1TVDA 5FK9A 3T65A 5KVGL 3GMMB 1CFNB 2D7QA 5FGBC 2A83A 4WW2C 2PUQT 2FGWL 4WUUB 3QUZD 3HZYA 3CH8A 3CFDA 1T20A 5JXAH 2HMIC 1U58A 4HH9B 5I1GH 3QI9C 1S9XA 2B5IC 4CMHB 4C4KT 4UT6L 4H88L 3UO1L 2JIXB 3SDYL 2A1WH 4OCMC 4D3CH 2BSRA 4HS3A 1LDSA 5CEZL 1BECA 3FT4B 5D7IB 3D39D 3DVIA 1FVEB 4WHTA 2R1WB 3RVUC 1NCBL 3IU3A 1I1AA 3VXMD 5JW5A 2FEDD 3VGAC 4RISH 1HE7A 1MHEB 2YHGA 3DO3A 4YH6A 1I3GL 4E0RB 1IGCH 3EDJA 1YJDC 4FG6C 5C08B 2CDEB 5DEGA 4AM0A 3NIFE 3L7EB 5C8JA 4HAGA 5E6YA 3C6LD 5HI3D 3GMNA 4BH7B 4X6BA 5ICZB 1BM3H 3PWJB 3ULSA 2A9MH 1WVZA 3BI9X 4K3EH 3W81A 3ROOB 3KPSA 5GRVK 4X80L 3IS0X 1MJ7L 4IRSA 3PGCA 4NRYB 4HK3N 3MRMB 4HZLB 1Q94A 1OCWH 2X2YA 5IHLB 4TTDC 5L8KB 4WFED 1OWWA 3EYOB 1U6AL 4F37K 3OWEA 4DQOH 4F80A 5BS0E 4U1GB 1T1XA 3L7FA 2EYSB 1NAMA 3B5GA 3VA2C 3IGAA 4MVBD 4OGAD 4GJTB 5CKAA 1JWUA 4R7DA 2AJXL 2R69L 3QWRD 1H3VA 5KS9A 5ICYA 1YNKH 1MI5E 4JRXD 1F97A 4ORGA 3ZKXC 4DOHB 3WDIA 1A9EB 1XEDA 3FN0H 1IAIM 1D5ZA 3D25A 1HOCA 3O41B 3QG7H 4Q9RH 3QDME 4G8IB 1EV2E 2GSGB 1M05A 3RUGA 5A43C 2X05A 4UOW1 2JB5H 5D70L 3CC5B 1LP9B 3SDCB 2HLAB 1CVSC 3VXRE 3K2UL 1UWEH 3GSNB 4QRRE 2JCCF 1S7XA 4HK0B 4OLYH 1DBAH 4G7YL 3P0YL 4M5YH 1J87A 2I9LB 1RIHH 3LZFL 3MROB 2VDLH 1I1FA 2EDNA 4NUGL 4KY1L 1ZLVH 4FFWD 5CSGA 3BGMA 1UYWH 1DQQA 1ZGLP 4MD0B 1HIML 1KB9J 1JWMA 2NY0B 3PGDA 2JK5B 1SYVB 2Y4SA 4UDTA 5TGBA 1RHHB 4I3SH 4OD3H 4W4OC 5CEZD 4M5ZH 1HHIB 4Y16B 3Q6GL 1J1OL 1N6UA 1KN4H 1CXKA 1D7FA 1RHFA 3EO9L 4XMKH 3TVMB 35C8L 5SWSA 2CH8A 3B5TA 3PNWB 3PV6A 1G0DA 2JJTC 4R6UA 1AXSA 4GG8B 5GGSY 1SBSL 1VSCA 3IS1X 4JHAL 4WU5A 2PN5A 2DYPB 5IFHL 4CVUA 5FCUL 1LO4H 1C7TA 4PJCF 1G1CA 2R56L 3D6GA 4GKNB 2EDTA 5CUSH 4HW6A 2FH6A 4PGBA 5E00B 4NFCA 2AI0H 2RB8A 2KBGA 5B38B 3QDGB 1CL7H 5C0BD 4LARL 1U8LA 2KH2B 1RIUL 4V1DB 1INDL 3G5ZA 4Y7MA 2R1YB 5E2TH 1NGYA 4J3SA 4H25B 5KTEH 2XN9E 1YNTB 4KXZI 5E08L 1X7QA 4RX4A 3P11H 4BZ1L 1A7QL 2Q76A 2NY2D 4RNRB 4MNQE 3ULUC 4S10A 5HGHB 1P9MA 3IXAA 1CXFA 5GGSB 2J8UA 5ICXA 4FZEH 1IM9A 2ICCA 4PJEF 1YPZA 4HWBA 2G9HA 4NN7B 5C0RL 1CLYH 4X6DF 3MRNB 2BNUB 3DGCR 5I8OH 3MXVH 1VGEL 4QY8A 4PGEB 4NZJA 2O61A 1LO5B 4AMKL 4WCYL 3B8YA 2JJSA 1DLHA 2VABA 3OHXA 1VACA 4DFIA 1V3JA 4PJGB 3MV8E 3QQ4B 2ADJB 4ZO6A 4F57L 1M7XA 5LAXB 1BJ1H 3VFWA 2HVKB 2IFFL 4JFEE 2Y07L 1MCOL 3JV4A 1OPGL 3S98A 3BJ91 1QKZL 4NUJA 2X4TB 4G6FB 4OQTA 5FO9B 3H9SE 3NMEA 2C1OB 4UUJB 4DKAA 3SCMA 5IB2A 2FL5B 5AZ2H 4UQ3A 2DDQH 4I5BA 4NN6B 3QPQC 5GSVA 1CL7I 3VXUA 5JR1L 4ONGH 3WBDA 1NBZA 4GT7A 1U2HA 3GJEB 2E7LC 1G9NL 3KPRB 4FFYL 5MEQA 1RVFH 2D3VA 4ZODA 4DK6A 4P5MA 1WWWX 3QIBB 4WNQA 3BN9D 4KZDH 3O11A 4LF3A 4X83A 1PKQA 1A6TB 4KDTC 4KK5C 4KJYA 4BUHA 4YHML 4HGKC 3Q3GA 5DVLA 4QTIL 2UWEA 5ITBH 4IM8A 2L4OA 1JTTA 4U6YA 1RV6X 3B9KD 3S5LB 2WINB 4K23L 3E8UH 5JPNB 3QEGL 5I8KL 5JOPD 4XZUB 1FYTE 2VDPH 1K9TA 1T5XA 1YYLL 3WFEL 3IAGC 2GKIA 3OF6A 1BZ9B 3GMLA 5DMKA 4JFPB 4I3GA 3RWEB 1TZHB 1DQJB 2FWOB 5FUOL 3H0TA 3KXFE 4JVWA 5DZNA 1K2DA 1D5IH 3OR6B 1T2QL 4NIKB 5D6CA 3F5WA 4B0MM 5I9QB 1OM3L 2J12B 5DJYA 2Q86B 3MBEA 1EO8H 1X4ZA 5DJ2B 3SGDH 5CSZA 5DUBA 3QIUA 3OG6B 3AM8C 3LS5H 4NC1E 1CFVH 1MFAH 1UEMA 5T1KD 1J0YA 3S96B 3HRZB 3QWQB 4N0UA 4JFFD 4M6NH 3V4UL 4OBRA 3TPUA 3QQNA 2V7HA 1F2QA 1XR9B 1U95A 1IC1A 5JHLL 2ILLA 4PRIA 2EDYA 1H3PH 3GSWA 2DL9A 4YHIB 3KDMA 4LCWA 4UBDD 3TBYA 2X70A 5IFJB 1A7OL 2HFGH 3EJYD 5F8QC 2J7LA 1KT2B 5KAQF 4M00A 4GKZB 3ZYOA 4YE4H 5MHSE 2XFXA 3V79C 4KKBD 1YEFH 2ZSVB 5D8JL 4NZTL 4U3XA 1YECL 4O51A 4DAGH 1KEGL 5E8DL 4ENEC 1IE5A 1AGBB 5I1CH 1T21B 1E6OH 1H3GA 3O4LB 2BJMH 3PP3H 2A0LD 5HVFB 1MRCL 1A0QL 2N56A 2RBLA 1B4RA 1U8JB 4OGXH 3O4OB 1OHQA 1FRGH 4JQXA 4P5KA 1LEIA 5JPMA 4DEPC 3C60D 2BVUA 1TPXC 3SDXF 4C58B 4QRUA 2YN5A 3CDCA 3LKPB 2VMFA 3QO1B 5DGQA 3Q5TA 2XI9A 5C9JA 4Y5YB 2EDXA 1D6EB 3F7PC 4M1GH 4ZAKC 5FYKL 1J7VR 3LB6C 3DVGA 3SGDI 1FFRA 3MTRA 1IGMH 2HKFL 3IDNA 4OQ1A 4HUUB 4JO4L 3VFMA 2Z9TA 4YDIH 3UAJD 3VWKA 5C0CD 5JNYB 3RTQD 3CH1B 4MA7L 3IU4H 2J6EH 1NEZA 3EUUA 5C6WH 3KPSD 4P4KA 2NTFA 4NQDA 1D6VH 4OLXH 4PRBA 3VFNA 4LDLB 5C0AB 4XPBH 1JI2A 1RUPL 3KPLA 3LQMA 1CE6B 3QIWD 4FP8L 3WXWH 1G0XA 4LPWA 2YEZA 3RZCC 3FO9B 3FAWA 2P47B 3P73B 4F7TA 5IQ7L 4CVWA 2NZ9C 3BIAX 2VLKB 1YMHB 3H9YA 3ES6B 3GM8A 1RZGB 5MERB 2GY7B 1FC1A 1A5FL 1YUHB 5DC9B 2DLFH 1QSFA 3W0WA 4RCAA 3U46B 2G60L 2APBA 2NX5B 4IS6B 2DN7A 2E6QA 1TZGH 4IDJH 3LDBC 2N7AA 1XR8A 1RJLB 2HJLA 3G5VA 3WEXA 3VGGA 1AP2A 3AXLA 4LLWA 5BV7H 4L1DA 1MHCA 4NO5A 2EO9A 5H94A 1KXQE 4E41A 4HWBL 3IAQA 4LLAA 4J3VA 2ADFH 5EO0A 5D7JD 1I8MA 2AXGA 1CGWA 1NEZG 1NANH 1T1YB 5IKCB 4ISVB 1FSKB 4F9LA 3PWPD 4U1HA 1MCJA 1R3KB 3C08L 4HH8A 1JGUH 4JY4A 3X11B 5HDQL 1IGJA 1EAPB 4W70A 1OB1A 1JNLH 5DFVC 1C1EH 2EEAA 4PRPA 2NLJA 3KPQA 3MRJB 1U8KB 2O5YL 3OAZK 3QXDA 4OQTL 4ESKA 1GAFH 4JFXA 4JHWL 2ARWA 3BPOB 5DJ8A 1C12B 4L9LC 5A3ID 3RWCB 2AVGA 3D1MC 3VD7A 3RA7H 2X1QA 3R06A 4EUPG 1MRFL 1BREA 5HY9B 3OGCA 4XPTH 4C56B 5CJOH 5DJDB 5FYKD 4TUKH 5M95B 1BQLL 4ZPVB 1HHGB 4RFNC 4M6AA 1MAMH 3TIDB 1FFOB 1NMAL 4ELMF 1FGNL 4PJBB 2OTWB 1HQ4B 2QQNL 1C5BL 3O6FC 2VB5A 2UZIH 4YWGH 3ARED 5JHDD 3E2HB 3MCLH 4R0LA 3TO4B 5KVMC 4UTAL 1CF8L 4KROB 3DUSB 3FZUC 2G5BB 1YY9D 2C9AA 1I3VA 1Q9WA 5GGRB 3DECA 1F4YH 3WN5A 3QUZC 4HFUH 2PO6A 3VXOA 3T0XA 1ZV5A 5KZCB 4HPOH 2X7LB 4JJ5A 1MPAL 2P7TB 2QADD 3VFOB 1QRNB 4YAQB 1V7ML 3MUJA 4LU5L 2WIIB 3CCHB 5BJTB 3LKOB 3IFNH 3FT2B 4HBCH 2MPAL 4XCYA 1NANI 1RJCA 4XNMA 3MV7A 1DEEA 1A7NL 4NWUL 4LCCB 2B1HL 1MVUA 5K59F 5K9JH 1X5GA 3U7YL 1AQDB 4EOWL 4J3UA 4U6VL 2X89A 4K55A 2FGZA 4GW1A 3EDKA 4OAWB 4Z8FH 3C6LC 5HI3C 1GYAA 1JUFB 3P30L 4QHMA 4HGMA 1U9KA 2ADGA 2BK8A 2QKIB 4Q74A 3LRGA 5JW4Q 3OPZH 4M62H 3FB5B 5DRWA 3I6GA 1CR9H 2R29L 1ZT4B 1WAAA 4Z7QE 2PYED 5D71L 5ENWA 1K6QL 2VE6B 1OP3K 3I02A 2Q8BL 2Z35A 4L5FL 5J6GA 1KB5A 3OGOE 2AABL 2OJEB 3FKUS 3CFJB 2PF6A 4MVBC 4OGAC 2V9TA 2ATPA 1S7WA 4OUUB 1HWHB 5CINH 3VXNB 4GRWF 2OL3A 5BXFB 2J88H 2YWZA 5L2JA 3M17A 3EO1A 3PJSA 1I8IA 4NP4H 4HXBH 4WV1B 3U7WL 1NCTA 1BOYA 1S9XB 5KVFH 4OZIA 2C4XA 1PZUB 1NFIB 4NQSB 3MUGB 1LILA 5J8OA 3ZT6A 5C9KA 1HDMB 5D7LD 2VC2H 5JW5B 4R96A 1AD9B 3C2AL 1VKXA 1DBBL 2R2HA 4TSAL 2WMPA 1RY7B 5EBWB 2AEQH 1RUQL 3VFPA 3BP6A 5ALBL 4XPAL 5K9OA 4AM0B 2FYYB 4YK4B 5IP4A 1EDQA 5JDSB 5DK3A 5C1MB 5DSCB 1N4XL 2DLIA 4FFWC 5BW7A 1KLUB 3QNYA 2DQUL 3EYSH 5HDBE 4U6HA 3IETA 2YA2A 1UZ6F 2JKXA 5LXGL 4PJ7B 4EXKA 4NQED 1R3JB 3FN9A 1K4DA 5D7KD 3G6AB 1J1XH 1EEZB 1HH9B 4FFZL 4TOYL 5ILTH 2AV7B 2MFNA 3AFLA 5I76B 4HJGA 3L9RA 5T3XD 4LGPB 4K9EC 3S35H 1U3HB 4W81A 1I7UB 2PW2A 2WLYA 3GUTA 3QIUD 4CW1B 2IFGA 3BIBX 3CXHJ 1R6VA 1FN4A 5DJZB 2CJUH 1KIRA 5EOCH 3MYZA 2X10A 3KAAA 1A22B 1JWSB 1E6JL 2VLRA 2Q7NA 4O02L 2BNRB 2IQ9L 2XWTB 5IUSA 3BPNC 3T1WA 4P9HH 1NCCH 4LSTH 5DK0B 3QYCA 5SV3A 4OZHB 2P24A 3QEUA 5AG8A 5FUZL 1JGEA 4MXQD 4OV5A 1PQZB 1DQDH 1NH6A 5GRUH 3NAAH 3CSGA 3DYPA 4Z76A 4X6CE 5KS9F 1D9KD 2CKBH 2CUMA 4XTRD 3W5NA 1U91A 1TVBA 2NW3A 2NY2C 5GJTH 4NKOA 5I1EH 4KV5F 1S7RA 1F4AA 2NXYB 5D5ME 4JPVH 2WK2A 5C0JB 4N8PA 1L0YA 1HHJB 3NA9H 4RQQB 5KOMC 1ZLSH 3EIFA 3TH2T 1MCSA 4KK9D 2PR4L 2LU4A 3RUGF 3BP4A 1DQQB 3INUH 1CK0L 1Q9KA 3EOYG 4ZUVA 3WNKA 4IRZL 2VDNL 3O3AA 1ZAGA 5L7XH 5CLWA 3QISA 3MRGA 2NY5L 5F89A 1PSKH 5E8NB 5TGBB 2X42A 2ZUUA 3FOMB 2IPKA 3WIIL 2DMBA 2V2WB 1AE6H 1FL6A 1NMBH 3BQUA 3PWNA 4X4XA 5CJ5A 1QACA 3BKML 4KKAD 3D3VB 1H3WM 3V0VA 4R90H 3FCTA 1RJZA 5E8OA 4A2MA 5C71A 5HJ3B 2VL4A 5GRWA 1ZVSA 3FRUB 1Z0MA 3HUJB 4HF5H 4NKDA 5JOFA 4ZXBB 4OI7A 2ID5A 5C08E 2NYYD 2QJDA 4TTGA 4NM4H 2GIYA 1HI6B 1OSZA 1MJ8L 1WSST 1QFUH 5GRJL 2AGJH 1FL3B 1OAKH 1M6OB 8FABA 4KRPB 2XZZA 4I48B 4GXUN 1ZMYA 3GB7B 5T5NG 4FFVD 5I16A 1GVIA 3VD5A 1AXTH 5E8PA 3C2SA 1FV1B 2IH1A 1PY4A 1X7QB 3BN9C 4LPCA 1U92B 1RURL 5ACZA 5I1LA 3PWUB 4RMTA 2IBZX 3DV4A 2LFGA 1XF2B 4PB9H 2P5ED 3CUPA 3LN5B 4O58L 5F7NC 3KPMA 2R1XA 3STZB 1YN6A 1I8KB 2GY5A 4WW1A 3H42H 2JJWA 5IWLC 4ODSL 1O0VA 4QF1B 4ORZC 4M7ZC 3QPXL 1N5YL 3ARXA 3B9KC 1ZK9A 4P46A 5IROC 3DX9B 4PP1D 2BFVL 4X4ME 3PDDA 4R4NC 1XF5A 2LQRA 4JDZB 2G75A 1L0XA 5I0ZA 5HHOA 2Y9RT 1IT9L 3SQOH 3HR5A 4ZO9A 1QD0A 3H3KA 3MRIA 1YMMB 3CFKB 4WFFE 4DTGH 3MJ7B 1A6WH 3GSNL 1PG7X 1DFBH 3MRBB 5H8DA 3TT1H 1D5MA 1A6UL 5ID0B 3VH8B 2X5PA 1SEQH 3GSXB 1MFDH 2UVEA 2J8UF 4DKDC 2DWDB 4WUUD 1YPZF 3HZVB 4XNYH 1UT9A 1QYGL 5D7SH 1NJ9A 2ZCLH 2CXKA 2VR4A 4JKWA 3SCMB 4KQ3L 1KB5L 3MOBH 3GSQA 4S1SL 4U0RC 4X99B 4XAKD 4P2RE 1BLNA 3BGFB 4HIEB 1WFTA 2OL3L 4KH2A 2P5WA 4PJCE 1N7ML 3V5DA 5J56B 2B20A 5DUPH 4E5XA 3JVGA 5HYSA 4O5LH 3FFCD 2IGFH 1DJSA 4IOSD 1P2CB 3U4BL 2ZUWA 5IBTH 3U9UB 4F15B 4UBDC 4JY5L 2VXUH 4YLQT 3C6SB 5F97E 1A4JB 5IW1B 1F02I 3EJYC 5C0ND 3VFUA 5IMKB 4XXCA 3TZVA 5E95B 3PGFH 2CMRH 4A6YA 4XNXH 1WCQA 1ADQA 2DBLL 3QEQB 4Q2ZA 4KKBC 4JQIH 2C26A 5JXED 1CCZA 4RRPA 1WK0A 5DMKB 5CGYD 2A0LC 1T1WB 1WZLA 3LIZL 3QDGE 4MWFA 2HT2C 5F7DA 3DLQR 1FE8H 5IB3A 2VDRH 1R24A 4W68A 2V2XB 4PS4H 4JM4L 4PJFB 5KN5A 2UWEF 3C60C 1ZANL 4AQ1B 5A2JH 3P4MA 3RWDA 1AO7A 4X6DE 3CX5K 3NCJL 4H20L 1J5OL 1Y18B 4LQFL 4QRSA 1NGQL 2R0KL 3ELAT 3A0OA 3LH2L 5D72L 1G7QB 3N1MC 3W5MA 2P44B 3VXQB 3TBSA 2V5YA 1A6VL 3C9NA 3WL9B 3PDOB 5DUBB 4ODBD 5CLTA 1GOHA 1GL4B 1JPTH 4NCC1 5D1XB 1RZ8B 3JBG7 4Z0BH 4WWKB 3SDCD 4M7KL 3KLAB 4KHXH 4YHPA 3UXFA 1FO0A 2WBWB 4QEGA 1F3JB 1QFPA 2X89D 3UAJC 3RTQC 2VN4A 1FZKA 3TYFA 4NDMA 3C5SA 2YUXA 1U95B 5CP3H 4PLJD 1U8QA 4OZGA 4GW5B 3GSWB 1UJ3A 1DLFH 1TXKA 3TNMA 3LPWA 1HH6B 4CN4A 4GMSH 3VMPA 1LE9A 4RBPH 1YEEL 2X4RA 2PYFA 4X4YB 5J0BA 1GHFH 3I6LD 3QIWC 4NNXB 1IEAB 4PJGE 4YPGB 4MJ2A 3DUUA 2NY0D 5TE6L 4XP1L 3CXDL 1BBJA 3X14A 1VA9A 4BQ9A 5JW4N 4OCYL 3GSRA 3MACH 3TN0A 3OAUH 1KCVH 1RZFH 5I17B 4FQXB 4M1CD 3UX9B 3VG0L 1X6LA 2W65B 5F88B 4PB0H 2VDQL 3S37H 4F58H 1UQSB 3LEYL 1JGDA 4NKMA 1TENA 3FQTA 4L4VE 3IKKA 4QHNA 2KPNA 4MAYB 1P1ZB 1MCIA 1VERA 1T5WA 4K3JL 1LEIB 3HE7A 2DYPD 5JPMB 4POYA 3OZ9H 4XMPL 4L8SA 2GFBA 5I1IH 1H3XA 1MWAH 5J1AB 4NC2B 4OZFH 3JZ7A 2FJGA 3NTCL 1L0QA 2OR9H 1CBVL 4BSWB 2EC9U 4OF8A 5D7JC 5CIPB 4WI3A 1CG9B 1I9RL 3UPRA 4ODWA 2YK1L 3PV7A 1FFPB 1RULL 3DVGB 5IIEA 1F4XL 1JF6A 4V1DD 1ZLVK 3RDTA 2AEIT 3CMOH 3UJJH 1JYNA 2H2PD 4AEEA 3WHE0 4QXTB 1MCRA 2YA1A 3T8XB 1MCLA 1ROWA 2ITDA 1OARL 1ZA3A 3KVQA 3WKMH 3BD5A 3VGEA 2FD6H 4NQDB 2B4CH 3WNMA 1W0VB 1NLBH 4LVEA 1AKJB 3BKYL 3BOVA 3T3PE 1RZ7L 4E42A 3VD3A 5A3IC 4Y2DA 1FORH 4U05A 4G3YL 3RVVD 3KPLB 1J0IA 3MUHL 4JO1H 4JAMA 1T4KB 4ZG1A 3SBWA 1ORQB 3X13B 5D2NE 3V5KA 3U4EA 3BH9A 2ZWLT 3BYTA 2DQGH 1ZS8A 4UIKH 3DMMA 4PTUB 2P49B 5IFAL 3RP1A 2EDWA 4XBPA 4PRHB 1WGOA 4GUPA 3ZTNL 3IJHB 1N3NB 2ZUVA 4WI7A 5GS1A 2L0DA 3AREC 4P3CH 4X5LA 4EDWH 2V6HA 5TDPB 1RIVL 2VLJA 3UMTA 3WEXB 1YY9C 2HH0L 4JDVB 1Z5LA 3V6OC 1HINL 4G6FD 4LLDA 1OAXH 1UM5L 4RWYH 5GZOD 4MJ5B 2QADC 4HQQL 5F9AC 4G80A 5IHBA 5FCSH 2DMCA 3DIFA 1PX3A 4J7RA 1P4BH 4QRPA 5L0QC 1XCTA 4JY4B 3RL1B 3RWIA 1A3LH 1JHTA 4CBPA 4U1NB 1MH5A 3QH3A 4UTBL 4IIQC 4WTZA 4XNQB 3SDXE 3KPRD 2VRAA 2FLBT 5SWQA 4DZ8A 4DCQA 2NMSA 3QIBD 4DGVH 1NL0L 1I7ZB 5J1SC 1VFAA 4FS0A 1C16A 2YD6A 3IFPA 3EOAB 3D9AH 4HHAA 5LGHL 5IEKA 2R8SH 1YEKH 1OGAE 2B0SL 3LV3A 1LVEA 2YPLB 3UTQA 3LMJH 4JO2H 3U0WH 4KJQD 1IC4H 1U8HA 5JLZA 5KANG 3QUYB 3B2VL 1X3DA 2BOCB 5HYJB 5ISZA 3GSOA 1F4WL 3G6JA 3IT8D 3JTTA 1FZOB 3LPFA 4PJIB 4Z7WA 1NGZB 3F6LA 2VAJA 1HZHH 1I7RA 3DGGA 4XMLH 3HZMB 1YEIH 4LRNL 3ZDXF 1UC6A 4Y19E 3NIDF 4RGOL 1EK3A 4OFDA 1MEXH 3GRWA 5KW9L 2NNAB 3VXSB 4WTZG 4A6YL 3QDJE 3UPCA 1YN7A 1ADQL 1ZOXA 4I18A 2PO6B 1DDHA 4ONFL 3ARPA 4MX7B 3ESVF 1WBZB 1ZTXH 1YQVL 2OJZH 3CFBA 1L7IH 1PDKA 3AY4A 4LAQL 4ODXB 3LKSA 3IDMB 1LD9B 4XNMB 2D9CA 4OF3A 4BELD 5IQ9B 5L8JB 2I9TB 3MRPA 1EHXA 2E7CA 2RQ8A 2EXWD 4Z7VA 4GW1B 3U48A 4LHUB 2J5LB 4WY7L 4TRPL 4QHMB 2A6DB 5FGRA 1FLRL 4XC3H 2RGSA 1UZ8A 1WFNA 4JM2A 1FO0L 4ZFGL 1PAMA 2NX5E 4J6RH 4OJFL 3F58H 3L3GB 1A6PA 1UEYA 2R0ZH 3JXAA 5F9WC 4OF5A 2F58H 4WENB 4U4BA 4MD4B 3AU1B 1MAJA 1UVQA 3J8F7 1I9IH 5EIIA 3QUMH 5EN2B 3WFCL 3O4LD 3MLZL 2OBGA 5F7LB 5HHPB 5J6GB 4Y5VA 4PG2C 1YEJL 1MHHB 2FRGP 4ZSOB 1NFDB 4XX1E 2I5YH 2WSKA 4Y4KB 3HB3D 1IAIL 2FO4A 4F9PA 5CZVH 5A16A 4YXKH 4R4FH 3PHQA 2F54A 2ERJB 4MA3A 3L6FB 3PJSB 4ELME 2BRQA 1WAAF 4X0KA 1WC7B 1FG9C 4OZIB 4M48L 3BUYB 4DN4H 2C3GA 4FXGA 3OKLB 4MJIE 4D2NA 4MNGA 1T7XA 5AUMB 2KL6A 5JORA 3I6KA 3OKEA 2F19L 1QSZA 1T7ZA 4IJ3B 2VWEC 5EFIB 1FDLH 2QSQA 3PQYE 3CDYA 3DARA 5HHQA 2CIIA 4MXQC 4WEUD 4WO4C 5HGDB 5E2UL 3RJDA 5CEXB 3T0EA 3BH8A 2BXZA 3ESUF 1KCSH 5C2BL 1D9KC 3BEVB 4XTRC 2MKWA 2BVPA 2O26U 5C0AD 3PP3K 3TA3A 1IFHH 3UTSE 1J0ZA 1MJUH 3MRCB 1OAQH 4KK9C 2Q7YB 5AD0A 2F53B 1LO2H 2D7OA 3EGSA 3PL6D 4MXVF 2FB4L 4NQCB 5CGTA 3O3EA 3FO2B 4XGZA 5HGAA 3GHBL 1FHGA 5EB9A 5B8CA 2Q6WB 2GJZA 2VLKD 4G9FB 4NPYB 3K8LA 1W72A 4GG6A 5LWYH 1F11B 3FQNA 5CD3B 4FTVE 4I4WB 4U1SA 3F62A 3S35X 1XZ0B 1QRNE 1Z9LA 4HLZH 1KCUH 1Q9OB 5GGVL 4N8VA 2Q8AL 3O3BA 4KKAC 3QJFA 3VFSB 4PJ9A 3DRTB 4MMZC 4NWTH 2AQ3A 2AJVH 5JQHC 3O8XA 2GJJA 4LFHG 3X3FL 2DQJL 3F12A 5HVHC 5JIPA 5KSAB 2FSEB 2NYYC 4G8FA 3QCTH 4XP5H 2XRAL 4OCSL 1QBML 3C5ZA 4TUOA 2M2DA 2DKMA 1CDYA 3BUTA 1VFBA 4GRWE 2P24B 4FFVC 4GAGH 5C0IA 1HNGA 1JFQL 2A73A 3NVQA 5E6IA 1PEZA 1QSEE 4MXWH 2UVFA 4R97B 2WUCH 3VRIB 4OGYL 1A1MB 3LSOB 3S7GA 2HFEA 1JN6B 1S7RB 5MENE 3KHOA 3PDGA 5BRZB 5DD6B 3VFRB 1F3DJ 3MYJA 4LLMA 3BP4B 3QWOB 4N8VG 3JWDC 5I19L 4WEMB 1I3RB 4PP1C 2HJKA 4C56D 2R2EB 4FQ2L 4HWZA 2XQYG 2CUIA 2VL5B 4XBEH 4JFYB 5C07A 5EU5A 2IPUG 4JRWA 1U36A 4HXAL 1S7SB 2NY6B 4QHLA 2GK2A 1JF1A 4HT1H 4KROD 4M03A 1B6UA 3D0LA 4P2QB 4XWGH 3L3IA 5DC0A 4MSWA 5IOPA 1LK2A 4YDLB 2MHAB 3QXAB 1LNUB 1QA9A 5T5NF 4UOW0 4GXVL 2X6MA 4RZCB 5ERWA 5KZCD 2OZ4H 1CS6A 2R2BA 3DTXA 2JF1A 3G08B 3MNZA 4C59B 4NBXB 4CMHC 3X17A 3VRJB 3W2DH 1EUTA 3B9DA 3TNNA 1UCTA 4YIQB 4KVCL 3HAEB 3RIFF 4D9RD 1LDPH 2EDKA 4I9WD 1OW0C 1H8OA 4HUNB 2HN7A 2P8LA 4B53A 2XA8L 4L3EB 3MLYL 2H2SD 4H88H 1WT5A 3VI4F 2XPGB 4TVSa 4ZTOL 1KEML 2BDNL 4X9GA 2ITCA 4BKLA 4N9GB 4JG0L 3RX8A 1OF2A 5FB8A 1NCBH 1WZ1H 3ZYZA 1UCBH 1SQ2N 2R4SL 4G6ML 4F7PB 5FV1L 3W39B 5C0NC 3BKJL 5F21B 4P46B 1UKQA 1FPTL 4NJ9L 2ADIA 2D31B 1EZVY 1UWGL 1UXWA 3FONB 1Q1JH 5F6HI 1JRHH 5KS9E 4LLUA 5JXEC 3HS0A 5HHOB 3MGAA 4ZS6D 4U1GC 4KV5E 2FBJL 5J4MA 4PJAF 3V9FA 1BEYH 5CGYC 2WBJB 4GH7B 2BY0A 3JV0A 5EU7C 4ZUTA 4V2CB 4ODTL 3RUGE 2EC9T 1L6XA 1AGDA 4HKZB 4JPKL 1B2WH 2VXSL 4HGWA 5CD5D 3VXTA 3H8NA 3FQUA 5D1ZA 5H37H 2Z8SA 3TYGH 4MZ3A 4Z5RB 2DIBA 1MHPL 3LAFA 4M9OA 1GC1L 1N64L 5FF6A 4RSVA 3LEXB 1ZHNB 4F8TA 5CILH 3SDCC 3ARQA 5TF1H 4H5SA 2DKSA 1B9ZA 15C8H 3HC0A 3FT3B 3K46A 1FNEA 5EU6A 2IG2L 1MELA 3F7VA 5HBBA 2P43B 3V5DB 4PG9A 2RCSL 4H8WL 4PLJC 3HE6B 4X5WB 3CDGB 2HP4A 3TBWB 3RY6C 1AHWB 1V8HA 3O6KL 4NQVA 2VYRE 3CX5J 5SWSE 1Z9MA 1KPUB 4HC1H 2W60A 4JPWH 3U30B 1HXMB 1R3HA 4NHCL 4CMMA 3FB8A 1TJGL 3RWGB 1KG0B 2NY0C 3JWOL 4G7YH 2GJ6D 2ATKA 1J9CT 2ORBH 1IGIL 1JTOA 3GIZL 4OFYD 5H35A 4JQVA 3N1PC 4M1CC 1JRHI 3HUJE 1HIMH 4LBEB 2BHUA 1UACL 3X12A 4HX1B 5BMFH 5DLMH 4AEHL 1GGTA 1R24B 2ZSWA 3OKYA 1U3HD 4M4RA 2ZNWA 3HMWH 3Q6GH 4IHOA 1FVDB 3P4MB 1XMWA 2MTPA 3RWDB 3DXAB 1A7RH 2PKDA 3NPSB 4ZDHB 1PD6A 1SJEA 3WJLC 1WCBB 1WQVT 1KF9B 4HEME 1QEWB 3KYMA 4JHAH 2XWBB 1Z9SA 4YNYB 2C5DC 2I27N 3IDIB 4ZFZA 5FCUH 5IFHH 2K1MA 2BNRD 5FDWA 1BVKA 2ZG3A 5HDLA 4IRJA 4X6EB 1G7IA 3EOTL 4R4BA 3U1SH 2H2PC 3SKOA 3UTPD 5DHYB 5J11B 2J8UE 4HKBB 3Q6FA 1YPZE 2W0KA 4XXDA 2WWMD 5HI4D 1RIUH 4K7PY 3M8OL 1U8QB 2NXYD 1UJ3B 3TNMB 4NHUA 5I1HL 3QB7C 5AYQA 4P9ML 3RVVC 1YNLL 5E08H 3NZ8B 2IADA 2CK0H 4YGVA 2FX9L 2WUBH 1A7QH 4PRAA 2IANB 3MNWA 1ZT7A 5CJQH 3PXJA 2J1KA 4NN7C 4Z78A 1RUAH 4QYOA 3V6BR 3SGKA 5FXCH 1FIGH 1ONQB 1QBLL 4L4TB 1S3KH 2C7UA 4X5XA 3S37X 5IB4B 1XF3A 4EKXA 3EZJB 1QRKA 2AJSH 4PY8I 4UV7H 2HTLD 5C0GA 3MJ6A 1ZXQA 5C0RH 1TNMA 5J13C 4AQOA 4M7LL 1I8LA 4BQ6A 2F54D 3IXTB 3BVNA 5HSFA 3U36A 3D3VD 4JLRA 5DS8B 4H0GA 3VXUE 3BP5B 1P5VA 1MY7A 5EORL 3HR6A 2R4RL 4XP9L 3C5JB 5GZOC 3PWVB 4GRWH 4ZXBD 3G6DL 3OB8A 4PJ8A 1C5DA 5DGRA 1PKQE 1OPGH 1QNZL 2DM2A 3OJDB 4NN6C 3EOBA 3F7YA 1L9NA 2ZJSH 1HSBA 4HUMB 2BY3A 4KRPD 4K07A 2UWEE 2V2TA 4GSDH 4G8EA 5GS3A 5GZND 1H0DA 3HFML 4NO0A 3MFFA 3DURA 3QIBC 5F7MC 1CICA 3O6ML 3OR7B 2VLMD 3H7LA 5DRXB 3SDAD 3QEQE 5MEOB 1ZHKB 1KJVA 5I71B 5JR1H 5GIRB 1G9NH 4FFYH 3HNVL 1TVHB 4X98A 5FA4A 5KSBA 1ZVYA 2H1PL 3IFLL 2YSSA 4L8CB 1CTOA 1JPST 5C09A 4PJ5A 3T1FA 5EO9B 1DBMH 5B39B 3HPJB 1A6AA 5DT1H 2XKNA 3DMMB 5DD0H 5DRZA 1YMMD 4PJ9D 5GHWL 3UTTB 4K23H 3MLWL 1A7BA 3QEGH 5I8KH 4MA1C 5F7EL 5HVWA 3D85A 1S5IH 5DMIL 2MCPL 2X4OA 1IC7L 1P53A 1C08A 1YYLH 4N0UE 1T7WA 4OF7A 5I9QC 3IFOA 1MUJB 2ZOKA 3B6SB 1H3UA 3QUKA 3KPOB 4HS6A 4LLDB 5L2KA 1MQKL 2W0FB 3W11D 3HI1B 2FNBA 5DYOA 4FQJL 2D9QB 5BOPA 1BJ1J 3QQ3A 4PRIE 5CHNB 2MOVA 1OM3H 4LCWE 3WHXB 3FHQA 3R8BB 2B7DT 1B0GB 5FYLE 1YY8A 4MHHI 5HHNB 3IJSB 2Y72A 3QULB 1ODAA 2EXWC 1WFOA 1NAMH 2Q87A 2Z4QA 3CVHA 4ZOBA 3V4UH 3RI5K 1N2RB 4XPGH 1C16B 3L3JA 3IFPB 4BFIA 2E8YA 2WP3T 1AFVL 1J05B 1U8NB 4PLOB 1JPFB 25C8L 5DVOA 2BNQA 1KELL 4AIOA 1T2XA 4PJHB 5C6TH 3DWTA 2V9RA 1HCVA 1T04B 1RU9H 5I30H 4OCWL 4HIJA 5TF0A 1MCWW 3G04A 3O4OC 4LKXA 4O00A 5D8JH 1YEGL 3STBA 3HB3C 1YECH 1KEGH 5IJVB 4U1IA 4OD1L 4LPUA 5DI8A 2EYRA 3D2UA 1F8TL 1MFBL 4Y5XC 1SJVA 1OLZA 4Y5YC 4CVZB 5D1XD 3FJTA 3WNPA 3UDWC 4NQDE 1AIFA 2IH3B 1YC8A 4WWKD 3G6JF 4PJ7F 3P0VL 4Z7WF 1K8IA 3DX6A 4U1JA 3SE9H 3GGWB 1KTLA 2IJ0C 5ANMB 1EJOL 3S4SA 4NKIH 4YR6B 5EU4A 1OSPL 4X7FC 1A6ZB 2O5ZL 1U2CA 2PTUA 3U0PB 4HIIA 4I2XA 3V0AC 5TH2A 3RX7A 1ES0B 4JGUA 4Z7VB 4PYHA 4PY7A 2HKFH 4RMWA 4K94L 1DVFB 4P2OB 2ESVA 4XXCC 1TJIH 4JO4H 4PRHE 4MA7H 4JM2B 5A2KH 1CZ8L 5DJCA 1GJIA 1QSFE 3W0WE 3PL6C 1T3FA 1ZGLA 5GGTA 3TT3H 2GAZB 4LSQL 4HKJB 2OS7A 3E3QE 1WWAX 1HSAB 5IHZB 1GGCL 2KQMA 1EBAA 1MCKA 4E41E 1RUPH 1BX2A 5EUOA 4JO3L 1QUNA 2EDJA 1ZEAH 5EIIB 4KC3B 5FUCE 4IOFD 1OL0A 1MFNA 4FP8H 2W9DH 2DTML 2E9IA 4F7CA 2Z91B 5L6YL 2AJUH 5EBMA 1GZQB 4MAYD 2BY1A 4GKSB 4P5TB 1J8HB 2EDOA 1ITCA 1BBDH 1NCDL 4NKQB 4AEIH 5LBSL 4APQA 2WP3O 4M3KB 5MP6H 3S4SG 5FGBA 1OWRM 5DJAA 4WW2A 3PABB 1U8OA 2G60H 4PRPE 3PF2A 5KVEH 5ADOH 1FSKC 3QI9A 3V52L 1CE1L 4HWBH 4RBPK 3ZDXE 5JORB 1FBIH 3NIDE 1EGJA 1BD2B 2XNAB 2PXYB 4G6JL 5EPMA 2EDDA 4TULH 3C08H 4FQHA 2NCMA 4ZD3L 3BPOC 5HDQH 5FM8A 1AKJD 3F8UB 2XKSA 1TQCB 4N0FB 4FQLL 3HI6H 2R9HD 2YBRA 5DJ6B 3T04D 2E5EA 2D4FA 1F90H 4JFDA 1DR9A 3QZWA 1JVKA 1BWWA 4OQTH 4ONHA 5LQBH 3S34L 1TIUA 1GGIH 5AAWA 4WI8A 3KPPB 3IDYB 3MRQA 1FP5A 5IMLB 2EE2A 3QFJB 4MB4A 4L8SC 5K9KA 1QVOA 2R23B 4CNIB 2VZVA 3E2HC 3TO4C 5BZDA 4KROC 5F96H 3QJFB 1RJYB 2XICA 5HPMA 1QPPA 2DWEB 4ERSH 4MZ2A 3MV7E 3T77A 3U0TB 5TE4L 1NMCB 4LVOB 2QQNH 1C5BH 3VFGL 1M7IB 1CGYA 3DO7B 3CLEH 5FHBL 3GI9L 1MFEL 4UTAH 1MF2H 4RA0C 4WI2A 2AEPH 2YPVL 1G7JA 4JFHE 4GG6F 1VFUA 3BIKB 1ZWIB 1FVCB 4OD2A 1KPRA 1BFOB 3H7BA 5IW6A 5FKPA 3SJVB 5FECA 4OLZH 1K85A 2DAVA 3QZWG 4LCCC 1QLRA 1RUML 4LU5H 5E6IB 2H2SC 8CGTA 2XY1A 1CT8B 2MPAH 2ZZUT 1GCFA 1WAAE 1RZJL 4OLEA 3ARDB 4Y4FB 1KJ3H 4LGSB 1X5FA 5E8EB 4B41A 3I85A 5FV2A 1NCAH 3QXWA 2YD2A 4GBXB 4LLMB 2YPLD 1NFDE 5IK3B 3TWCL 1CFSB 4K8RL 2F74A 4JHBA 4NZUL 1KIPA 2HAZA 5I2IA 3P30H 3QUYD 4LRIC 4XVSH 1JV5A 1LE5B 5HYJD 4GO6B 4ZNCD 2H26B 4ZS6C 1UXSA 5C07B 3MRRA 4QRQA 4W4OA 3OX8B 5E1AA 3WJJC 4W6YB 1I1YA 2ZCKH 2R29H 4OZIE 3A67L 4GW4B 2VXQL 2JJTA 3RU8H 2FR4A 4RGND 2EIBA 4YXLL 5IB1B 3VXSD 3C8KA 3GMRA 4L5FH 5CD5C 4PJ8D 2AABH 2D0GA 1HQRB 5EU3A 5LG1A 5IB5B 1I75A 3JUYA 5D9SB 5ERWB 5M94B 5FYLH 1T6VN 4WV1C 3QHFH 1W0YT 3GMPA 3U2SB 1NC2B 5HHME 3U82B 3BXNB 3L3DA 2DI7A 4BQBA 4C83A 4D9QD 4UT7L 3QCVH 1NDMB 5DQDL 4UU9B 1CICD 3C8HA 1KUMA 5DWUH 2EDEA 2IPTH 1JPSL 3U7WH 1JNNH 4OZ4B 1IM3A 5FOBA 3O2DL 4NYLB 4G5ZH 4ODUA 1HEZB 3EYVB 1N5AB 2H6PB 1HCFX 4YK4C 1CGSL 6CGTA 1AQKH 4LHUD 5DFTA 3SDDA 4LP5A 2IMNA 2DM4A 2HFFB 1DBBH 4IMLB 5DUML 3TCXA 3VFTA 4B7IA 1N8ZB 4XPAH 1IL1A 2VISB 3LQAL 3P3YA 4WEBH 1UXWB 4HCRA 1K4CB 4O2FA 1U8IB 4HEPG 5IVZB 3LKQA 4MCZB 3FL7A 4TSBL 3ULVL 2AEWA 4MYWB 4FN0A 4S1RL 4LPTA 5HHXH 2VLRE 3NCEB 3TJEL 1U3HC 1DN0B 5GGTL 5IJKC 4L9DA 3SE8L 3WS6C 4EBQL 1S9VA 2RFXB 3MV9D 4KK6D 5FYJL 3VRLF 3UZQA 3B3IB 3RGVB 3DUHA 2NW2B 5EOTA 4D0CB 4X6FA 4K8RD 4FQ1L 5FF6B 1MI5B 3ZKMD 5INCB 3MRDA 4ZO8A 4ZOEA 3AS1A 1LK3H 4LVNB 1R5IB 3QDMB 4UQ2A 1DE4B 1S7TA 1I85C 5GISH 2E7LA 3EYFB 4U6XA 2WWMC 5HI4C 4O02H 1T7YA 2IQ9H 2DQFA 2XZAH 5IVXB 4H1LA 4GAYA 3DV6B 2ZOLB 3VXRB 2NXYC 3OSKA 3BYYA 4KDTA 3ECBB 2LTQB 2XZQH 5DVMA 4QRRB 2F53D 5EUKA 3HCVB 2QSCL 4NQCD 4EI5B 1KTRL 4KMQA 1GC1C 2GUOA 4P2QE 4P2YA 1EGJL 1RZKC 3EKCA 3VI4E 3KPNB 4G9FD 3P77A 2W1NA 4WFHE 1JI1A 4FQCH 2CIKA 1YJDL 4UIMB 1CK0H 4OBSA 2HTLC 1FIEA 2J4WH 1CFTA 4IRZH 43C9A 4OIIH 1HKLL 2NY5H 3D2UD 3MOAL 1U8MA 1DL7H 4QXUL 1BZ7A 1G1YA 3WIIH 2CR6A 3O3DB 2Z0BA 1OGTB 1YYMH 3WYRA 2Z93A 3BKMH 3MCG1 5F9JA 5KSAD 4ZXBC 1MIEH 4XPHL 1IJ9A 3HG1A 4H1LG 5T5FH 3JWOC 1CFQA 4XP6L 4H0HB 4MJ6B 4ZFZB 3AM8A 5FDWB 4ZQKA 3KYNA 1TJHH 4KRPC 3HPLA 1IZJA 4JFOB 4JPIB 3IDGA 5EOCJ 3SKOB 2AK4A 5GZNC 5BV7B 1Y6NR 4NT6A 2X41A 1N59B 4QHKI 1LWRA 5I1KL 4YEEA 4BSVB 2W92A 1MJ8H 5GRJH 3RL2A 3SDAC 1BVLA 4KHTH 2Z92A 5EBGA 2APTA 5DA4A 4KTYA 5HHOE 4I0PB 2XN9B 5BRZD 4HK3J 4KJPD 5J89A 1BAFL 1ZE3C 5CP7B 5D96B 1P7KB 2EEBA 4Q6IB 4JRYA 4OCLC 1DBKL 4MNQB 5EZIH 5I8EA 1UB5B 1PFCA 3DX8A 4Y8AA 4O58H 4P23B 3UPAA 5JQ6L 2ZG1A 4J23A 4ODSH 3QPXH 1IEBB 2FJFB 3QNZB 3BT2H 3FO0L 5C0GB 3VD4A 4QRTA 1OAUL 5ITFA 2VAAA 6FABL 2NY6D 4LLYB 4QXGH 3MJ9L 3CAFA 3U36B 2I07B 2GYSA 4QOKA 1IT9H 1ZA6A 5FM5M 43CAB 2YD7A 5FA3A 4PJDA 5C0FB 3O45A 2XWJA 3QFDB 2A2QT 3SKMB 2P5WE 4JZJA 5SWZA 3FB7A 1G7HB 1RK1A 4MQ7A 2XTJE 4JANB 3W11C 4Y89A 5EA0L 5HYQB 3KWWB 3KR3L 4JFEB 4NQXB 1KSRA 2ICEA 1C5DB 3VJ6B 1KCRL 2OI9C 4WGWB 4ZAKA