3SGKC

Unique carbohydrate/carbohydrate interactions are required for high affinity binding of fcgiii and antibodies lacking core fucose
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
170
structure length
165
Chain Sequence
LPKAVVFLEPQWYRVLEKDSVTLKCQGAQSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTQLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVQITITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fc fragment
publication title Unique carbohydrate-carbohydrate interactions are required for high affinity binding between FcgammaRIII and antibodies lacking core fucose.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 165
sequence length 170
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgkC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sgkC02
5F89A 2O5XH 4IRSC 1S5IL 1TENA 5DEFB 2DI9A 3L9RA 1CVSC 3RVTC 1QSZA 2QKIB 3QQ3A 5EUOA 2Q6WB 5C3TA 4IOFD 3QCTH 3TVMB 3T0DA 5D7IF 1G1YA 3C9NB 2R15A 3CFCH 1LO2L 4Z7UF 2IBGA 1SBBA 3TT3H 3FJTA 2FNBA 4NQSB 4XPHH 4Z0BL 4WCYH 4JPIB 1NC4B 5KVEL 1AXIB 5KVMC 3F7VB 1TVBA 4M1GL 4IJ3C 3BSZL 3WJJA 1NC2B 3FQUB 5EU3A 5C6WH 2XOTA 3LEYH 4JFPA 4UV7L 3EO1A 4JRXA 5FB8B 3JV0A 4NKMB 4YLQT 1CTNA 3D0VA 2BNQD 2YK1L 1A8JH 4WV1A 2BMKB 4OM1H 4Y1AB 3K7UA 4LSVL 3UJIL 1RUQL 3QI9B 1NCUA 4NO2B 1TZHA 3CLEL 2VUOA 4JFZH 5BOZG 5HYIA 5JMOC 3IKCB 4CMMB 1FGVL 2QADB 1BGXH 4J23A 2CK0L 1T0NB 4MD0A 4XBGB 1V3MA 4P2OA 4XVTH 3NCYS 4NN6B 3QIBB 3CVHA 2DQFA 4PG2C 3CSYA 5HDBF 1QSED 4AQ1B 3GSUA 1JNJA 3QUXC 1MVUB 1HNFA 1RMFH 3OAZH 4HH9A 4KRPC 2DAVA 2FIKA 4EN3C 2VN4A 2Q87A 3T3MF 1T0PB 4PG9B 4K23H 4HV8A 2C1OB 4Q6YA 3O6MH 4LNVA 2BOBA 1TJHL 3SDDA 4JHBA 1IAIL 1T03H 2EO9A 3P11H 4FFVC 1P7HL 4UU9A 3S4SB 4XB7A 1D5ZA 5D71L 5INCA 4WW2C 1GGBL 2EDTA 2FLBT 1I8IB 3VFUA 1MCRA 2BNQA 4N0CD 4JM4L 1CG9B 1NFDB 1RUPL 4U3HA 3T65B 3BKCH 3SDCB 1SY6L 3FQNB 4GBXC 4YE4H 1HIMH 3L1OH 5D7JC 4YR6B 1GJIA 3D1MC 3MJ7B 3BP6A 1T22A 1P5VA 5FO9B 1AR1C 4FHBD 4M7JH 4S0TD 4PREA 1S8DB 5I1AA 1FL6A 5GRWA 1KN4H 5IM7A 12E8H 2DLFL 4HGWA 1ITBB 1IT9H 3WFEL 2R4SL 3MQIA 5D2LE 2AEWA 1TJGH 5D96B 2F54A 5EORH 4OIIH 2JJWA 2ZG3A 4WRLA 3MREA 5SWSE 4YAQA 5L6YL 2XXMB 4U1MB 4XRCA 3S34H 3TGXA 3U4EB 2I9TB 5TF1H 3MLRL 4KQ3H 5SX5K 5CJOH 2MCPL 3I6GB 1M7IA 4V1DE 1BWWA 2GFBB 2Y36H 3B3IA 2JB6B 2CUIA 1Z9LA 4TSCH 3HA0A 3JXAA 5LBSH 4UUJB 4OGXH 3CFKB 4PPTA 4PRNB 2IADA 4U7MA 1BVLA 1NCTA 4GLRI 1YEGH 1RJYA 2OCFD 2E7CA 3JTSB 3V79C 4HWBL 2KDGA 2IH1B 3N06B 2XY1A 4JQIL 2P8PA 2MKLC 5HGHA 5E6IB 3IF1A 1IC4H 3T1FA 3N1QC 1UJ3A 1OAZL 2GTWB 4WUUB 4M1CC 4GQ9L 2GY5A 3QFDA 5GS1B 3TO4D 4S1QL 4X8XA 3ZHLA 2CH8A 2XT1B 4GRMB 3NCBB 4EI6A 3P4OA 4WO4B 2B8OT 1G9MC 2DDQL 3TNNB 5E8PA 5I1DA 5IJKC 4LSUH 3BZDA 2AJZA 5E8NB 4YC2C 2H9GB 1TJIL 5D1XC 4UT7L 4P5KB 4PRIB 3KPNB 2X42A 4R7DB 5JXAH 4ERSH 1TITA 1N3NB 5T1DH 4OUUA 3QT2A 3RKDC 3BP5B 3OR7A 1EBPA 4RNRA 2GIYA 4X8JB 4TSAL 4YK4B 1RAMA 4QF1B 1QFHA 4HCRH 2JIXD 4BFIA 4JFXA 1EJ6A 3S36X 4MAYD 2EXWD 4ODTH 1DQQB 3TJEH 2HT3C 4OF5A 1RK1B 5HI4C 1NCWL 1UEYA 1A21A 3FKUS 2PW2A 1RUAH 1FGNH 1MHEA 1PEWA 1KF9B 1VSCA 3IU3B 2AEPL 3EYSH 3O9WB 4H5SB 2DIBA 2H3NB 4JO2L 4OKDA 3OG4B 1I1RA 1JP5A 3LDBC 5F89B 4DGIL 4WW2F 2VLRE 2X4QB 2DJ4A 3QQ3B 5EUOB 4BZ2H 1B0RA 1HKLL 3ZDYE 1EJOH 1GIGL 2PTTA 3PGFH 1FO0B 3TO4A 3BDBA 5F6IC 2BZDA 4AT6A 1UM5H 2DB8A 4QXGL 4HMCA 3W0WD 2CRIA 4K55A 4YIQA 4P9HC 3IU4L 4EDWH 1TVBB 1X4XA 3BEVA 3FCTA 4LSRL 1MFCL 3LMJH 4JFPB 3F7RA 3PWJA 3EO1B 4JRXB 4JKKA 2YD4A 4NQCB 4DW2L 4H1LG 5FDWA 5L2KE 5HBBA 1KCRL 1L7IL 4DZBB 4E5XA 1OCWH 2A6KA 2VLJE 3H9SE 4Z7OF 4WV1B 4NJ9L 4M8QA 4DUXA 4OLWH 3KLAB 5HGDA 4OM0L 1KNOA 4KJWD 4AG4H 2ZUWA 5KSUB 4MAYA 4QCIA 3ELAT 1R6VA 4M6AA 4OAWA 4KTEL 4PJ7A 4JGJA 5IB1B 1UVQB 4HT1H 5H94A 3CXDL 4UI2A 3SE4A 1F97A 5CD5D 3UPRA 1H3VA 3SKOB 5CD3A 1T80A 1LGVA 3MRHA 4P2OB 1XIWB 5TE6H 1OAYH 3M07A 3TYGH 2DQFB 2W65A 1CZ8H 4XH2A 5E2UL 3C8KA 4LPWA 3SGEI 5HVHC 2ERJC 4LAJH 4QGTA 4HH9B 2E27L 4PV9A 1T1WA 2F53E 5FK9A 1S5IH 2FIKB 4Q0XL 4R4FL 4N8VB 5CSZA 1KTLB 3W0WA 2BOBB 3MR9A 1FYTD 3SDDB 3QCUL 1NMBL 4N1EA 1VACA 1LO2H 4ORZC 3VFOA 4WU7A 1SVCP 5BJTA 3KLHD 3BWAA 4HWEL 1BF2A 1QR4A 2VZTA 4Z0BH 3EIFA 1D5ZB 5TF0A 1RSFA 5INCB 4HF5L 3U82B 4RFNB 5KVEH 3D5OF 1T6WA 3BQUD 4F7TA 4M1GH 3RPIA 3VFUB 3BSZH 2BNQB 3UZQA 1T83A 4FNLL 4D9QD 1FZMA 3OZ9L 4PR5B 4UV7H 3DVNA 5HHOB 1NAKL 2FRGP 5SV3A 1FL3B 2Q8AL 1FYHB 2UVEA 4M9OA 3D3VB 3ARFD 4S11A 2MSPA 3KS0J 4J12A 1X4YA 2YK1H 3BP6B 1T22B 1OF2A 3VXUE 1IAIM 4L3CA 3QUML 5LGKA 4LSVH 4EUPH 1BLNA 1ZLVK 3UJIH 3O6FC 1FL6B 1KSRA 4HGWB 1MFDL 2EIBA 2CKBA 3CLEH 1HSBA 4NQED 3GMMB 3LHPL 4R96B 3FT4A 4HEPG 3ESVF 2GI7A 5IVXE 1FGVH 2CK0H 4O51A 2F54B 5GJTL 4OQTH 3MREB 3ARPA 4YAQB 4M7KL 1TCMA 4LDLB 1ULVA 4XRCB 1T6VN 4WFEE 4AEHL 5TDPA 5D72L 5JLZA 1FYTA 1NJ9A 1WAAE 1M7IB 3QEGL 1JE6A 1UZ8B 1N5YL 3ZKMC 3B3IB 5C70A 3CC5A 3U79A 1EAJA 1OW0A 3BD5A 2JTDA 1TJHH 4XP4L 3BQUA 5C0BD 1IAIH 1BVLB 2D7TL 2VIRA 1IAKA 1RJYB 5D71H 4X5WA 2UWEE 4Z7VE 1GGBH 3RP1A 5FUOL 3ARFA 1CT8A 4LDEB 4JM4H 1MRFL 2BY3A 2YC1B 1RUPH 2P8PB 2PUQT 1CL7I 3VGGA 4LIQE 2ZUXA 5HGHB 3GRWA 1SY6H 1C5BL 1CLYL 3T1FB 1UJ3B 1WTGT 4YHPB 4U1KA 3OKDA 2A83A 2CUMA 3CFBA 3QFDB 4X7SL 3MRIB 4R7NB 1Z9SA 4EI6B 5TE7L 3P4OB 3W82A 3V7AG 4ZTPL 5E8PB 5K9QI 3EO0A 3VWJD 2MFNA 2DLFH 2KQMA 1TCRA 2F8XC 3WFEH 2GCYB 4ODWA 5DUML 2R4SH 5I75B 4EZMA 5D7SL 4U1IA 5J6HA 1H5BA 3D18B 4OUUB 1FG9C 3RWCB 5HDOA 2DYPD 3OR7B 4YDKL 5L6YH 3QPXL 3BGAA 4RNRB 3GSWA 2EE2A 3VFTA 4D0BA 1U3HD 3PUCA 1MLBA 4GS7C 1ONQA 3MLRH 4BFIB 2MCPH 4YXKH 1X5XA 4O2EB 5C0BA 1OTUC 4PJBE 5BRZD 4TNWK 2PW2B 2XWBA 1MHEB 4L8CA 4ZPVA 4Z7QF 4G43A 4APQC 3EW3B 2JCCE 1E4KA 5CEZE 4X4MA 1B0RB 5EWIL 1Y0LA 4TQEL 4HWBH 5HYJD 3H0TB 2JJVA 5EU4A 3TO4B 4JQIH 3MRCA 1KBGL 4AT6B 5I18L 1BQHA 5C0AE 5C0NC 1QUNA 1OAZH 2MHAA 2PNDA 5ESVA 4GQ9H 3VWJA 3C6LC 4YIQB 4LLDA 1BJ8A 4S1QH 5GGRA 4KH2A 5EO0A 3BEVB 3FCTB 4M02A 4FXGA 3L3IA 3GUTB 2NZIA 3MO1A 3D9AH 1TJIH 4UT7H 1VEMA 2R2BA 2DKUA 2DYPA 4E5XB 1JWUA 4D0CA 1G84A 2A6KB 3RWGB 4M7ZC 4NC1C 4M8QB 2R29L 4KK6C 5HGDB 1HXYA 1U3HA 1KNOB 1EDQA 1BREA 2HFFA 3BOVA 4QCIB 3VGAB 5DRNA 3BPLB 1WLHA 4OAWB 4PJ7B 1QOKA 4TSAH 5BRZA 3WDIA 5DZOA 3PHOB 3TBSA 4X80L 1DLFH 5CD3B 3M8OL 3MRHB 2OLDA 1S78C 1TNNA 1BEYL 1NCWH 4ZUVA 4XH2B 4U6XA 4RMWA 1UXWA 1UGNA 3C8KB 1ZE3C 2CKNA 2AEPH 4PJGA 3VG9C 2BNRD 5HYJA 4PV9B 5E7BA 1T1WB 5FK9B 4DGIH 3PL6D 1HKFA 3STBA 2X4TB 4HMEA 1FH5L 5CSZB 5AWNL 1HKLH 4E41E 3AY4A 1GIGH 1MREL 1N59A 4Q9CA 4NRZA 3MR9B 4M62L 1CDUA 3VFOB 1VACB 5FEBA 5BJTB 1U8OB 4IRJC 3BWUC 3HZKA 3BWAB 4QXGH 5LAXB 1LILA 4F37F 5JW5A 4OBRA 2E3VA 3IU4H 4F7TB 3RPIB 2YSSA 4LSRH 1MFCH 3RY4A 2YD8A 3GZKA 1F11A 3DVNB 4KKBC 4DW2H 3I9GL 3O3EA 4AEFA 5AUMA 1XH3A 1KCRH 1L7IH 1YMHA 1KLGA 2FR4A 4WI9A 2CR3A 3K2UL 2VERN 4O4YL 1P84J 4NJ9H 2PCPA 1CGTA 1OF2B 4X7TA 2WK2A 3FO9A 4L3CB 4OM0H 4QHKI 4R4NC 1BLNB 1F6AA 4LSTL 4MJID 3ARVA 2X5PA 2CKBB 4KTEH 1HSBB 4QHUA 1OOAA 4NC2B 2CGRL 5GZOD 3FT4B 3CXDH 3QPQD 5AAWA 1BFTA 1BPVA 5DI8A 4WTWA 3LV3B 2P42B 2BNRA 4RGOL 5D7KD 1QHPA 2JJSA 3PL6A 2DF3A 1BIIB 4MA3A 4HSQA 1V3LA 4S1SL 3W9DA 2PXYD 3Q3GB 5TDPB 4ENEC 2E27H 5JLZB 1FYTB 1NJ9B 3F65A 4F80A 4R4FH 4F57L 4Y2DC 1BZQK 4GT7A 4WUKL 3QO0A 3CC5B 4GG8A 2MMXA 2YZ1A 4FFZL 3RNKB 1J1PL 4E0RA 3REWA 3QCUH 1NMBH 3CDCA 1EO7A 4PGBA 2D0FA 3TO2B 4HWEH 2VIRB 3BRFA 3N0PB 1IAKB 2E6QA 4MDJA 4O5LL 4X5WB 1S7QB 3C5JA 4HF5H 4FQHA 4HUUA 2XWJA 3ARFB 2ICCA 3CJJA 4FNLH 2R9HC 1UH3A 1J1OL 3OZ9H 1JN6B 2AKRA 2P24A 1NAKH 2Q8AH 3QG7L 1UKQA 5C0IA 2X4UA 4U1KB 3OKDB 2A83B 3MYZA 3CFBB 4MJIA 1XGRA 5DF0A 5E5MA 4HKBB 4OI7A 5J3HC 4XNXL 3QUMH 5HHNB 1WQVT 3KYOA 1G7IB 1PAMA 4X7FC 1MFDH 1TCRB 1P1ZB 3LHPH 4ODWB 4K3HA 32C2A 2Y6SC 4OIBA 4L4VB 5J6HB 5GJTH 2NXYD 2D0GA 2ADFL 5DC4B 1YN6A 4JVUA 3ILPA 4XNZB 3GSWB 2YPLD 3MRPB 3VFTB 1J12A 2AVGA 2VABA 4D0BB 1PZ5A 4AEHH 2WIMA 3TZVA 4E42A 1MLBB 5JIIA 2PYEA 5D72H 1S7UA 3QEGH 4LGRB 4B0MM 1N5YH 3KLSA 4LHUG 3IJYA 2XWBB 5JOFA 1JYXA 4L8CB 1G7LA 3P30L 5KVDL 1KTDA 5CKAA 4XP4H 4G43B 2X40A 2D7TH 3BN9C 5HYSA 1F5WA 3OAUL 5F3HA 4HJGA 3RWEA 1G9NC 1Y0LB 2DWEA 5FUOH 1IM9A 2AJSL 1F42A 5EU4B 2GYSA 1MRFH 3AU1A 1RIVL 4JPWL 5LQBL 1UT9A 5F97E 1BQHB 2MQCA 1C5BH 1CLYH 4MCZA 2MHAB 3VWJB 3LCYA 4JQXC 4I3RH 4OCLC 4U6VL 2XACC 4X7SH 4LLDB 4PLNC 2BSED 2FB4L 1FZKB 2W0KA 5GGRB 5HHQA 2PR4L 5TE7H 5EO0B 1HEZA 4FXGB 3L3IB 4ZTPH 3IVKA 3I2CL 1FO0L 2GTZA 2R2BB 1JWUB 1ZK9A 4H0GA 4D0CB 5D7SH 2YPLA 3MC0A 1U8IA 3KPOA 4QOKD 1LE9A 1HXYB 1U3HB 1Y18A 4WI3A 4WTXA 5HYFA 4YDJA 4YDKH 2HFFB 3LN4A 5L0QB 5IROC 3QPXH 4JJ5A 4X9BA 5B3JE 2BCKA 5DYOA 4HPOL 3D25A 5BRZB 5A2JH 5GSVA 2HT4C 5D1ZD 1UCBL 5DWUL 4D9RE 3TBSB 1NGZA 1V7NL 5EA0L 5ENWB 1W8OA 1XF3A 2PO6D 3MV7E 4A6YA 4X6FA 2VDNL 3NIGF 4ZUVB 4U6XB 4PTTA 5DFVC 3QFJD 3UZEA 1UXWB 4HLZH 4JFOA 2HWZL 5HYJB 2NY2C 4PJ8C 4BFGA 3RHWF 4U33A 4CL7A 1IQWL 5EWIH 4JDTL 4DJMA 4TQEH 1N59B 4NRZB 4NHUA 3ARBD 4K3DL 3N9GL 4OGAC 1KBGH 4YPGA 3RWDA 4OFDA 5I18H 5GGTA 3QIWD 3HZKB 4HWZA 1HZHL 1JL8A 5JW5B 2FJHA 3GM0A 1WUNT 5BV7C 3WO4C 2A9ML 5IVXF 2YSSB 3T2NL 3TC9A 2GJ6B 5DJZA 4KUZL 3RZCC 1F11B 1J8HD 5E2VL 2IH3A 5AUMB 5E94A 1XH3B 1YMHB 1KLGB 2FEEL 4KGJA 2FR4B 5DXWA 4QTHA 3NVQA 5T3XL 4LVEA 5LXGL 4P4RA 5SX5H 1UACL 2R29H 2PCPB 5GRVK 3GHBL 5D1ZA 2YPVL 4X7TB 3FO9B 5I8EB 4RBPK 5K9KA 1DBJL 3K0WA 5DJ0A 1ZHLA 4KQ4L 2PO6A 4ZQKB 5L8JB 1FZJA 3JWDL 3KPRB 1YEFL 2GEEA 4QHUB 2WP3O 5JOPD 1ZHNA 1X9QA 1Q9KA 2Y07L 4H0IA 4N1HB 3QFJA 2CDGB 4OTXL 3QZWG 5DI8B 2DLTA 3M8OH 4S1DC 5IMOA 2BNRB 4N9OB 2GSGA 1UXSA 1BEYH 1EHXA 1HSAA 3PL6B 2FEDD 1LK3L 4MA3B 1M1SA 3W9DB 3AMKA 4GW1B 1VCAA 4P5MB 3ARBA 3L6FA 5KG9A 1FH5H 3QIWA 4RMTA 3QO0B 4GG8B 4RGMB 5AWNH 1JTTA 1NBZA 3T4AB 2XG4A 2D03H 4E0RB 2W0FB 3REWB 3V6OE 5FKPA 4PGBB 1YPZF 1S7TA 4WTZA 2DQJL 4XWOD 1J8HA 4MDJB 4MCYA 5CJBA 3C5JB 4NO0D 3J8F7 3IYLW 1B3JA 4HUUB 3OPZL 4KU1A 2VR9A 2XWJB 2XKUA 4Y19D 3BGFC 2AKRB 3QWQB 3DRTA 5B39G 3I9GH 2P24B 1NUDA 1SYSA 3H42H 4J3XA 5MEQA 4LLMA 3LPFA 4Y4FD 5C0IB 2X4UB 4H25A 1CDGA 3K2UH 1WT5A 1OARH 1XGRB 4MJIB 4O4YH 3V4VL 4X9IA 4F2MA 3ZO0A 3FAWA 4ZO6A 1PKQE 2IEPA 4Y7MA 2BVEA 5E5MB 4GUPA 1CBVL 3V7AE 3KYOB 4LSTH 4GG6A 1LQSR 3EZ8A 1RJCA 1EO8L 1JGLL 2W92A 1AHWC 2CGRH 1PX3A 5M7QA 32C2B 5BS0B 4L3AA 1RZJC 3P9WB 1UB5A 3O2VL 4CN6A 4RGOH 3VXRA 1YN6B 3F58L 3HC0B 4EUPG 4I18A 1XF5A 3ILPB 4NYLB 3VXMD 2X89A 2VABB 4S1SH 1PZ5B 3OB8A 3QIUD 1XZ0B 3TZVB 4E42B 3ES6A 2PYEB 5EBGA 1S7UB 4U1GB 4F57H 4XX1G 4F8QA 4WUKH 3PDOA 3IJYB 5JOFB 4HDIA 4FFZH 4GKNA 5FM4A 4NO0A 4KFZC 1J1PH 4JG1L 4YWGL 1TZIA 1N0LA 3ARDC 4Y19A 5DT1L 1CFQB 4WNQA 3ZT5A 1TPXB 1EHAA 4JFED 5F3HB 4O5LH 3IDNA 4HJGB 3RWEB 5I8KL 4Y4FA 2DWEB 1IM9B 2PF6A 3K3QA 3NFSL 3E6HA 3OJVC 1J1OH 4HMDA 4AENA 4I1NB 1JIBA 1RV6X 3PWPD 3QG7H 4MCZB 3T3PE 3WS3A 4OFKA 5HHQB 2YKLL 4XNXH 1HEZB 3IVKB 1UYWL 4NUGL 2HKFL 2UYLA 4UBDC 5BXFB 1U8LA 5IHBA 3PNWA 4YGAB 2GTZB 4X4ZA 4JE4B 1VDGA 4QXWA 3BH9A 3VXMA 1C7TA 5C9JB 1U8IB 4RFEA 3KPOB 1E4XL 3VGDA 5D2NE 1LE9B 1VB9A 1Y18B 3QIUA 3T77A 2VNCA 2LTQC 3U4BL 2Z8WC 4YDJB 2ADFH 3LN4B 1N0XL 2C26A 4JJ5B 4K8RL 9CGTA 2APTA 4WFHD 2BCKB 1WFTA 4X5XA 5DYOB 4ZOBA 4ZODA 5GSVB 2NY5C 4MD5A 4HG4J 1LE5A 2GQHA 2XQBL 5TQ2L 3AM8A 1XF3B 1MUJA 2WW8A 4A6YB 4X6FB 1QZ1A 2RBLA 4PTTB 4JFEA 2ZNWA 3P30H 5KVDH 2VLMD 4JFOB 3P0YL 4YHNA 3RDTD 4PTUA 5EB9A 1T21A 1KB5A 4TSBL 2HJFB 3ZTNL 2ZKHL 2WLZA 1JGVL 3OAUH 5J89A 1DQJA 4FOMA 4Q9QL 3OJ2C 1GVIA 4LSDA 3KPQB 2AJSH 3FB8A 1ZV5A 3QUYC 4JPKL 4JO4L 1ZLVH 3DXAE 1G6RA 1VERA 5HHME 1RIVH 4JPWH 4YPGB 3K80A 3RWDB 3V0VA 4DUWA 5A40E 5LQBH 5DSCA 3SGDH 4A2MA 3ZTJH 3ULSA 5C0EA 3OJMB 4HWZB 1ZLUK 2FJHB 4U6VH 3SGJA 5GGSY 3KDMA 2FB4H 2W9EL 2QJDA 2PR4H 4ONHA 4D3CL 3REVB 5DJZB 4XP1L 3I2CH 3L3JA 2ED8A 4N0UE 1FO0H 2IH3B 4JHAL 2B2XL 5E94B 2E7BA 3MACL 1OAKL 5K9OB 4OLEA 4GRLC 2DN7A 4P4RB 4RRPG 5J11B 4KAQL 4NSKA 3DJ9A 3O6KL 5D1ZB 4PY8I 1YJDC 3S35X 5C0DA 4AEIL 5K9KB 4LCCA 4LK4A 5DJ0B 1ZHLB 5DHVA 3HUJA 2HRPL 3D39D 2PO6B 3DMMC 4HPOH 5DMIH 2F5AL 1FZJB 1ZHNB 4QRRD 1UCBH 1Q9KB 3H3KA 5DWUH 4UB0L 1V7NH 5EA0H 3JV5A 2P5EE 1TQCB 5IMOB 4LQFL 2GSGB 1UXSB 1KG0A 1YMME 4PJFA 2VDNH 3RFZC 4QHNA 3BPNC 3KPSD 4UAOC 3RUGA 2J4WL 3LRGA 5AYUL 2HWZH 2WANA 1A22B 4XPGL 4PJDA 3L6FB 1OGAE 4OUOA 4CN4A 5KG9B 2WWMC 1IQWH 3QIWB 3SGKA 4JDTH 1NBZB 5IBTL 2ZWLT 5HVGB 1HN1A 1NCAL 3QUZA 4FS0A 3N9GH 4K3DH 4ALAL 5FKPB 3WDHA 2XYCA 1S7TB 1F4AA 4JB9L 3W5MA 1T1ZB 1AGEA 3R4DA 4OLUL 1ZS8A 1J8HB 1HZHH 4MCYB 5CUSL 1QSFB 4IMKC 3RJQB 3BKJL 2A9MH 4LL9A 1CFVL 4F58L 4IHOA 4KUZH 3ALXA 4F8TA 4DFHA 3DRTB 5D7IA 2K9UA 3L7FA 5E2VH 1SYSB 5MEQB 1I7ZB 4LLMB 4H26B 5C8JB 4H25B 1WFUA 4K3JL 5T3XH 3MOAL 5LXGH 3HNSL 1EEYB 3OGCA 4CMHC 4F2MB 3G9AB 2Y1VA 6FABL 1UACH 5F7EL 3ZKQD 3GHBH 4KROD 3AROA 2YPVH 4GUPB 3TH3T 3IGAA 5B38A 4JFFE 4XPAL 3LQAL 1DBJH 1F2XK 3ARGC 3FO0L 3F7QA 3T0EE 1EAPA 4KQ4H 4GG6B 4MDIA 5L88L 2QSCL 3JWDH 1YEFH 1M4KA 5TJWK 4ODHL 3NTCL 5FYLL 3KPSA 3MV11 1BM3L 4OTXH 4LARL 3DYPA 1UB5B 4CU8A 3VXRB 4I18B 3P9LA 1XF5B 3BESR 1LK3H 4WJ5A 5CZXC 2IBBA 4UOW1 4ELMF 5F9OL 3ES6B 3X11A 3QJFA 1GC1L 2ZUQC 5BVJA 2EDXA 2DQCL 3V6OC 3Q5TA 3SPVA 2QADC 3PDOB 3EYQC 4G8FA 5ICZB 3X3GL 4GKNB 1MIML 2CIKA 3UAJC 4NO0B 1DP0A 3EUUA 3N50A 1WTLA 4L4TD 1TZIB 3QO1A 1AGCB 4LVOC 4Z7WA 1JPTH 5MI0B 5KTEL 3VH8G 4UV4L 4FN0A 2DQJH 4WNQB 1CGYA 3P73A 5FYKL 5IVOA 2R39A 5GRVL 3D6GA 5GS2H 2R0ZL 3OPZH 4NM8L 4NRYA 3MRQB 2NX5D 3GI9L 4NOFA 3E6HB 4I9WD 3LB6C 3NH7L 2ZOKA 4AENB 1B4JL 3O0RL 3FB5B 5E4EC 4W4OC 3V4VH 1ZA6A 1WSST 5D8JL 5CP3A 1UH2A 4K94L 1HWHB 1KIPA 1ND0A 2JJTC 2UYLB 1EO5A 1U8LB 5CINL 3QNYA 3PNWB 3KJ4B 3EYUL 1EO8H 4P2YA 1JGLH 3MLYL 3BH9B 1E6JL 4BQ9A 4O02L 3VXMB 4RFEB 2HMID 5I30L 3O2VH 4JQVC 1OP3K 3F58H 2JKXA 4B53A 4X5XB 2XZAL 5EULV 3VI4E 2DWDA 5DVLA 1C5DA 1PD6A 3KPTA 4MS8C 1F13A 4MD5B 3E0GA 4B50A 2X9WA 1LE5B 1QFWM 4L4TA 4JLRA 1FP5A 3LEVL 1MUJB 1A4JA 3FB7A 4ZDHA 4D94A 5D96C 4JFEB 1FPTL 4BQBA 1S9VB 3L5WA 4PJAF 4YHNB 4JG1H 5DLML 2Y4SA 2OR9L 4PTUB 4YWGH 3EYOA 4KRNA 1IQDA 2NX5A 1T21B 2VMFA 4WI6A 1KB5B 4I4WA 5DT1H 2B7DT 4LLWA 4C56A 1DQJB 4QRTA 2E9BA 5I8KH 3FB8B 1A0QL 3HC4L 1WBZA 2VISA 1YNTA 4EN3D 3V0VB 3QH3B 5CIPA 3NZHL 5DSCB 3QWRD 3ULSB 5C0EB 1JYWA 4GRWH 4G8EA 1RULL 1E6OL 4ONHB 1KB9K 2YKLH 3VE0A 3TJHC 1UYWH 4FFVD 3L3JB 2HKFH 4NUGH 4OZFH 5EOCL 4N8CL 3S88L 5D2NC 1KJ2L 4PGCB 3RJDA 3MLXH 2VQ1A 6CGTA 2VN7A 5JO5A 5E6IC 5KW9L 1DQML 1IGCL 1I9RL 4NSKB 3CFJA 1E4XH 4X6DF 5J6GA 5HPOA 3OMZA 4MXVE 3U4BH 5C0DB 5EN2B 1EGJA 4LCCB 4K2UL 1N0XH 3BPCA 4K8RH 3HUJB 2VQUA 4WO4C 4Q97A 2IPUK 3BIAX 1U42A 4MJ6A 4Q6IA 5JW4Q 4OFYD 5TQ2H 2DQEL 4PJFB 1KG0B 4QHNB 5ACMA 4PG2A 3FN0L 2FX7L 3RUGB 3P0YH 4ZTOH 3QUXA 4OV6F 4HUMB 4TSBH 3ZTNH 2ZG1A 4NDMA 4EDXA 4PJDB 1JGVH 4PJEE 5IBLC 4EN3A 4Y4KC 1HNGA 1QACA 4TVPE 3QWRA 4Q9QH 4DVRL 1YY9C 1HYSD 4JO4H 4JPKH 1U8JA 3QUZB 2UY7A 4HLZG 5EDXA 1J05A 1QNZL 4WI7A 1AGEB 3DX7A 1I9JL 1WFNA 1ZS8B 4PBVC 3IXAB 4I0CC 2IFGA 5FIEA 2W9EH 4PP2A 4C59B 1AGDA 4W6WB 4YUEL 4WFFD 4D3CH 4PRBA 4XP1H 1XR8A 5D7IB 2ADJB 3L7FB 2MQ0A 2BRQA 2B2XH 3MACH 1OAKH 2P48B 4OLZL 5D7JA 4QHMA 3OAYK 1AGFA 4Z7UB 1OD9A 3OGCB 3GMLA 2H2PD 1XMWA 1CFNB 3O6KH 3BYYA 1F3RB 1I1CA 3IGAB 5B38B 1NDGA 2B1HL 4AEIH 4JFDE 2Q86B 2P5WA 4G9DA 4OFYA 3CZFA 4LCYA 1EAPB 2HRPH 4MDIB 2F5AH 5KS9F 3NGBC 5FYLD 3WFHA 4NFBA 2XN9D 3KPSB 1MJUL 3NZ8B 4UB0H 3VXSA 3KYAA 3MUHL 1DLHA 4PJCE 2YD5A 4LQFH 1IGTA 3P9LB 3PXHA 2ZCHL 4WHCA 1Y6MR 2J4WH 5AYUH 5JPMB 5CSGA 5FOBA 3X11B 2H8PB 3QJFB 4XPGH 2VJXA 4LAQL 4X9HA 3ZKNC 3MXVH 1D6VL 5BVJB 1BD2E 3SPVB 4J3VA 3UPAA 3T3PF 4G8FB 2ZUYA 3FMGL 5IBTH 3AB0B 3MFFA 1NCAH 3SE8L 4ZSOB 1MQ8A 3UTPE 4ALAH 1FFOA 3GSNA 4PJIA 5K59E 3QO1B 1XF1A 4JB9H 4Z7WB 1S5HA 3HFML 5HI4D 4PV8A 4IOFC 4FP8L 3KXFE 4OLUH 2BHYA 4NCC1 5FYKD 5CUSH 3BKJH 1GL4B 2B1AL 2XY2A 1QPXA 2XRAL 4F58H 2P46B 3WFCL 4UQ3B 3ZLQC 1WIOA 4B7LA 1NBQA 4KROB 2ZOKB 1L0QA 1JI1A 3UJTL 3B9VA 5IW1A 4K3JH 3MOAH 4MAUL 1MELA 1EERB 3HNSH 3MRMA 6FABH 2EH8L 1ZA6B 5F7EH 2BSRA 3ZDXE 2XN9A 1ADQA 4XPAH 1KIPB 3LQAH 1ND0B 2ESVD 4Y16B 3U7AA 3FO0H 3GJEA 5L88H 2QSCH 3QR2A 4L1HA 1QFOA 4ODHH 4MNQE 3NTCH 2EIDA 4ZFZB 4X0KA 1BM3H 4P2RD 4LARH 2X10A 3GMQB 4MHHI 5HPMA 4LFHD 3KYNA 3Q2CA 1CE6A 3SJVA 4WU5A 4KWUA 2DWDB 3BUYA 1C5DB 2IAND 2AQ2A 1UH4A 5I76A 5F9OH 3O4LE 2YRZA 3NA9L 1GC1H 1GZPA 4L4TB 5EPMA 4JLRB 4BZ1L 2QHLA 2DQCH 1XGUA 5DC9B 1A4JB 3FB7B 4ZDHB 4B41A 2F8VA 3X3GH 3OL2A 4G6JL 4NCDA 4F7EA 2X4SB 3WEXA 1MIMH 2X7LA 4ZOCA 1FLRL 3L5WB 2NY1B 3EYOB 2BNUB 1IQDB 2RJMA 2NX5B 4MNHA 1T66C 5KTEH 4UV4H 4I4WB 4IRSB 4LLWB 3RTQD 4C56B 3ALPA 5FYKH 4QRTB 5EUOF 2R0ZH 3G6JE 4NM8H 3EDDA 4F3FA 4RBPH 3GI9H 3LKNA 4CDHA 3DVGA 1WBZB 2VISB 1YNTB 3R1GL 4JG0L 3NH7H 1A7QL 5CIPB 1B4JH 1CXLA 1HHHA 2ESVA 1L9NA 1XCQA 2VZ3A 5DUBA 4N0CC 5EBMA 4WGVB 5D8JH 3VA2C 3VE0B 1HCVA 4K94H 4IJ3B 3OKOA 4N9GA 1LEIA 1S9WA 4P2RA 5CINH 3BIBX 2OZ4A 3EYUH 2DLHA 3SKMA 3MLYH 2VQ1B 5JO5B 1E6JH 1IE5A 2IANA 5J6GB 3IFOA 5I30H 5FAAA 5MERB 4R0LA 2V5YA 3BPCB 1G7PA 4XVJL 2OXHA 2XZAH 4X6CA 3QDGE 4YDLB 5ISZE 1LEGA 5GZNC 2A74A 4MJ6B 4Q6IB 5J1TC 1H3XA 4W70A 3LEVH 3QEHA 3NFPA 5I75C 3CGTA 2EYSB 4NQVA 5KN5A 5F44A 3RTQA 1FPTH 1WGOA 5HYEA 4XBPB 2WNGA 1CGVA 2OR9H 3QUXB 1FQ9C 3IETA 4U0RC 5E8EA 1NLDL 4JKWA 4EDXB 4KRPB 2FD6L 3C60D 3PV6A 2I5YH 4NDMB 4EN3B 1NBYA 3VWKD 1A6AA 1NGXA 1X5YA 3S37L 2XKSA 1A0QH 2YRPA 5DO2D 5I1CL 3HC4H 2HH0L 3L5JA 1U8JB 4DQOL 3TIEA 1MCWM 3NZHH 1J05B 3ZKMD 5C07B 2A6JA 3DX7B 5DD5H 5IOPA 3S8WA 1SBSL 5CJXA 1JGDB 4PUBL 1RULH 1E6OH 4PP2B 2EE9A 4WW2B 1AGDB 1KPUA 4PRBB 1XR8B 3RY5A 5EOCH 5JDJA 4N8CH 3S88H 3HKFA 1KJ2H 1EUUA 1YY8A 2HLAA 3TO4C 5D7JB 4QHMB 3RIAF 3ZTJG 2R8SL 1AGFB 3GMLB 5KW9H 1DQMH 1K8IB 4ODXA 4BH8A 1I9RH 5ECJE 3UYPA 4PD4J 2G2RA 1NDGB 1N2RA 3O6FA 2P5WB 4K2UH 1UQSA 1DN2A 3CZFB 3FQXA 4LCYB 4P5TD 4C57C 4WHYH 4YH6A 2P4AB 1BOYA 2VDML 3DETD 3QHTC 4XP6L 1KTRL 3VMOA 2EXYD 3WFHB 2DL2A 2VB5A 3VXSB 1OQXA 1DLHB 3BXNB 2DQEH 1IC1A 5SWSD 1IGTB 3C60A 2K1MA 3HHRB 2BHUA 1QYGL 3FN0H 2FX7H 1S7VA 1JF1B 4MAYC 3ULVL 5FOBB 4URTB 3SE4C 2GK0A 4I2XB 4V1DD 1ES0A 4DVRH 1JZ2A 5IVZA 3MFFB 1R3IL 1FFOB 3GSNB 5F93C 3VJ6A 1OTUD 1QNZH 1AC0A 1P4LA 1I9JH 2NXZD 3QDAA 3ZYZA 2ZSWB 2EDJA 4KZEL 1QFUL 4YUEH 2FZ3A 1A7BA 3A6CL 3F7PC 3V5HA 2O5YL 3MUZ1 3W39A 1KELL 3QDMA 4OLZH 4LIQL 4M6OL 5IW1B 3VI4F 1JZ6A 3K46A 4P5TA 5HGBA 3MRMB 2BK8A 2BSRB 1NMAL 5FGSA 4N8VG 2XN9B 2B1HH 3SO3C 4TTGA 5ALCL 4YC2B 3GJEB 4K7FA 5SWSA 1AD9A 2YXFA 1MJUH 4KJWC 4X0KB 4BK5A 1DQLL 1B90A 3FRPG 3I84A 3ME0A 1L0YA 3UPCA 5HPMB 4Y5YC 3KYNB 3TESA 3NCCB 3QB7C 1CE6B 3DX8A 3SJVB 2ZCHH 4WU5B 3QAZC 3BUYB 3MSPA 1MCLA 4V1DA 4KK6D 3LSOA 5I76B 1LDPL 3DRQA 3GBLA 4NNYA 5HJ3A 1GZPB 5EPMB 4MQXD 3H3PL 2CUHA 3LKQB 4LAQH 3TA3D 1D6VH 1ZLUH 2J12B 5IT2L 3FMGH 3BMVA 3G5YA 3WEXB 3SE8H 4JZJC 3TPKA 5F88A 4NO3A 3HC3L 4XZUA 1CL7L 3HFMH 4APQA 3LDBB 4FP8H 1I1AD 4H20L 5FDYA 2VLRD 1HH9A 5CEZL 4QRQA 2B1AH 4F3FB 2XRAH 3LKNB 3KLHC 3DVGB 3WFCH 1AY1L 5F6IB 4U31A 4M4PA 3UJTH 1AIFA 1HHHB 1J0ZA 1VADA 3BQUC 1XCQB 5IHLB 2R2EA 1E0OB 2HAZA 2VKXA 3WIHL 2EH8H 3C6LA 5DUBB 5EBMB 1VFOA 4PB0L 4N9GB 3OKOB 5GGVL 1LEIB 1S9WB 4BSVA 1CD0A 5L2KD 3FQWA 2IANB 2VLJD 3O3BA 3H9SD 3IFOB 4KKBD 5FOJA 5IESL 4HKXA 4IM8A 1T1YA 1VPOL 3NN8A 3T0AA 5I16A 3TA3A 3CVIL 1G7PB 1ZHBA 4X6CB 3C5SA 3AREC 5E9DE 4PJ7F 3MODL 1LEGB 2A74B 2V17L 1F6FB 3NA9H 3G08B 3HZYA 5KANG 4BZ1H 3QEHB 3NFPB 5F7DA 3WCYA 3ULUE 3GSRA 2M8XA 4GLRH 4NQVB 1H5BC 5KN5B 3LRHA 1I1AA 4G6JH 4KUCD 1DSFL 4I8DA 2EDNA 1FLRH 4U6HA 2VLRA 3OR6A 4QRPB 1KN2L 1L0XA 3EZJB 4HS8L 4HUKB 5E8EB 3PV6B 2F53D 2R0LL 1CI5A 5ANME 1X5AA 1KV3A 1HH6A 2X4NA 1NBYB 1NGXB 1P6AB 2H2SD 2CRMA 5BVPL 3QDJE 4ENED 4G9FE 1JPSL 3R1GH 1SEQL 4JG0H 3TIEB 3TNMB 1A7QH 4Y2DD 2QSTA 4L3EE 1NANH 5EZOL 5FA3A 5IOPB 2P49B 4PLOB 1KEML 3C6SA 1N4XL 4JGUA 1FG2A 5HYQA 1I3GL 1KPUB 4ZS7L 5IK3A 2VLJA 3P4LA 3H9SA 1YY8B 1C1EL 3NCJL 3D48R 1BX2A 4ODXB 4BH8B 1A7OL 4U1JA 5CBEA 3VWJC 1AXTL 5DMGC 5IFJA 3VXUD 2BVOA 5F21B 1N2RB 4AY0A 3O6FB 1SJEA 3FQXB 4XVJH 2YD2A 4OZFG 2YD1A 4GXVL 1R5WB 4QRSA 3GNMH 4JREB 2Q3AA 3F6LA 3CH8A 1W72L 4Z9KB 4JZNA 3X13A 1IEBA 1VEPA 4PGZA 1A4KA 1U3HC 2F53A 1T7WA 3PHSA 3MJ9A 2NY4D 1FSKC 3VXPA 4P2QB 3VMPA 4WFED 5I8CB 2HJKA 4W81A 5DHXB 1NLDH 2YPKA 2FD6H 3TT1H 4Y2DA 3MV9B 5EH1A 1ES0B 3KNBA 3BISA 1SQ2N 4Y1AE 4ONGL 5F7YC 5IVZB 3RX8A 1KYOJ 4NIKB 4LOUC 4DQOH 4PLJD 1K8DA 3VJ6B 5I1LA 3ROOB 1P4LB 4FQCL 1RY7B 1YYLL 4YHZH 1SBSH 4PUBH 2ATPA 3GMOA 1YN7B 4TUJA 1DBBL 3OX8A 3Q0HA 3UBXI 4P3CL 3V5HB 5SX4H 1FVCB 1YYML 1WZKA 2I26N 3QDMB 4RA0C 3VXUA 3ZZ1A 2R8SH 3U1SL 3PDDA 3RIFK 4GJTB 3VMNA 2COQA 1D5XA 5IVXA 5C86A 2VDMH 4XP6H 1RU9L 3OKEA 5SWSB 5I1GL 1AD9B 3SGEH 1FRGL 3BFOA 1UM4L 2O61B 3PABA 5I15L 4DUVA 4BZYA 1MH5A 3DX8B 1ZT1A 1QYGH 4RWYL 4LEXL 2CO6B 1NFDE 4V1DB 4UNVA 3ULVH 3LSOB 4LGSB 1MI5A 4FTVE 1KOAA 3DRQB 3GGWB 3DV4A 3V8OA 2QHRL 3QCVL 4GS7B 4NNYB 3WBDA 4P49A 2NLJB 4ZO7A 5LGHL 1OAQL 4XWGL 5EOCJ 2HT4D 5IF0A 1A3LL 4H8WL 2MKWA 2JJSC 2ZNXA 5F88B 2UWEA 1AP2A 3TBVA 4Z7VA 4NO3B 5T5NF 1KULA 4XZUB 4APQB 1N5AA 3NCMA 5DFVD 3QBTB 5CEZD 4KZEH 1HH9B 1QFUH 4QRQB 3GBML 3E3QC 3A6CH 2O5YH 4KTDL 1KELH 5DRXA 4Y4HD 4LIQH 4X9FA 4M6OH 5C0AD 1ZMYA 3FQTA 1VADB 4HK3J 2R2EB 4JQXA 5GQBA 1SJHA 3C6LB 4P23C 2VRAA 1NMAH 1GHFL 5D6DA 1PLGL 4BSVB 3MLUL 4WDIA 5ALCH 5JNYA 2VITA 2OI9C 3R0MA 3OHXA 3VFNB 2JELL 4M7ZB 5DFWH 3RZCD 3O3BB 4S10A 1DQLH 3VXTA 2AJXL 4HKXB 1T1YB 3CCHA 5I16B 3BDYL 3THML 5IROA 1ZHBB 5GZOC 2AEQL 3QPQC 5I2IA 3C5SB 1U8PA 2V2XA 5IP4A 4PJBA 1JNLH 3GMNA 1LDPH 2BFVL 2B20A 3HZYB 3BZEA 2GAZB 5E70A 5F7DB 5IUSA 5T3ZL 3BT2L 4G7YL 3X12A 4KY1L 1I1AB 1JMXA 1RZ8A 1YQ2A 2JCCA 2PXYC 3EFFA 5GHWL 4U6HB 3OR6B 4PJGF 1BP3B 4WWID 5EIQA 3VG9B 4ONOA 2XWTA 3HC3H 3U6RA 1CL7H 3V5DA 2SEBB 4PP1C 2C1PA 2PW1A 1T7YA 3IXTA 3QXAA 4PJ8A 4PRIE 4F7PA 1QBBA 3OAYH 4H20H 4G7VL 4KZDL 1AC6A 1HH6B 4HFUL 3MLZL 2X4NB 2D9QB 1QBAA 4Y4HA 5E1AA 1UWXH 5CEZH 3ZDZE 2AEIT 4FMFA 4E41D 4MLIA 2OL3A 4CGTA 1AY1H 1VFBA 1MHPL 1U95A 4IRJB 5FA3B 4DK6A 1OT2A 4YGVA 3WIHH 4K9EL 5HYQB 1FG2B 4PB0H 2XQYK 2DQDL 1JK8A 5GGVH 1HXMB 4M4RA 3DOSA 5F1IA 5IK3B 3RZCA 2VLJB 3H9SB 3MRGA 2EDBA 4JDZA 4G8IA 1BX2B 3ZSSA 1ZANL 4U1JB 1CIDA 5IESH 5IFJB 5TH2A 1X5IA 2BVOB 4JCLA 1VPOH 3CVIH 3RA7L 3C8DA 3MUJA 5EG6C 3UP1A 5CGMA 3MODH 3MROA 4QRSB 3WIFA 2V17H 2NXYC 1S9XA 3OF6D 4JZNB 5F72S 1RUML 4WY7L 1A4KB 2F53B 3WLBA 1ROWA 1DSFH 3HE6D 1GAFL 4JRXE 4NQCE 3VXPB 3UCRA 4RGNE 4E41A 1KN2H 3LS5L 2HJKB 4HS8H 1W2KT 2YPKB 2R0LH 5C2BL 4GW5A 4BQCA 4Y2DB 4KRLB 1P4IL 4P46D 3U36A 2AJUL 1QEWA 4HC1A 5BVPH 1FNHA 4KXZI 1XGQA 3RU8L 1JPSH 3RVUC 2YUZA 3IAQA 3RVXD 1SEQH 2LFGA 5I1LB 2DQGL 5EZOH 3QA3A 3U9PL 5JMRA 1KEMH 1N4XH 1I3GH 2ATPB 3GMOB 5C3LD 1FFNA 2UZYB 5D1QD 1IJ9A 2AK1L 3OX8B 2FSEA 4ZS7H 3TCLA 3EO9L 5DZNA 5EU5A 1KPRA 2ICWA 1C1EH 3NCJH 5CP7A 4N90E 3KLDA 4JN1L 1A7OH 3DSFL 1PKOA 1AXTH 4BK4A 3W11D 2ZUUA 1MCDA 1D5XB 3RX7A 5IVXB 1P84K 3VFRA 5J1AA 4F9PA 2PTVA 3MRDA 3OF6A 4GXVH 3BPOC 5DK0A 2XA8L 3OKEB 2V7HA 1AHWA 3MCKA 3UTTA 1TLKA 3HE6A 5T3XE 2NY4B 4LVHC 3V52L 1W72H 4U4BA 4UBDD 2Z35A 1MH5B 3UYOD 1ZT1B 2Q1EA 1K9TA 2OJEA 5FO7A 2XICA 4L29A 3GMPA 4WHYG 3SN6N 5HHOE 8CGTA 1MI5B 1RHHA 2J6EL 2WP3T 3NAAL 3DV4B 4KKCD 1CIUA 1UG9A 3AAZA 3D3VE 5FYJE 2NMSA 4OLVL 1TQCC 3WKNA 4ONGH 1HHGA 5I71B 1JNNL 1G7MA 2W1NA 4CW1A 3MJGX 4Z7VB 2EDRA 3TBVB 4S2SA 3ZE1E 4DOHB 4FQCH 1NEZB 1YYLH 2K7QA 4GKZA 4JZOA 2R23A 1W0VA 3ARBC 2F54E 4EIGB 4CU7A 5ADPL 1UZ6E 1IZKA 1DBBH 5F7KC 5FM5O 4P3CH 4OF0A 5HHVL 1YYMH 1H8NA 5DRXB 1J86A 4LGPB 1GGUA 1LHZA 3FQTB 1M7DA 5IHUL 1SJHB 3U1SH 4RAUA 1CU4L 4YPJA 1E27A 4LVNC 1MLCA 3BDXA 3LKOA 1CGXA 5JNYB 2VITB 1RU9H 2D31A 5L2JA 5I1GH 3QQ4A 3MRRB 1A3RL 1NKRA 3AS1A 4M9PA 3GSQA 3MFGB 1FRGH 1UM4H 3VXTB 1WT5C 2ZOLB 5I15H 4P9HL 2EKJA 1NSNL 3CCHB 2EEAA 3MV8E 5I2IB 4GRLD 1U8PB 4RWYH 4KRMB 1VFUA 4LLAA 4PJBB 3F12A 2FIRT 3P40A 5TDNA 2QHRH 3QCVH 4D9RD 4P99A 3BZEB 2WBJD 5LGHH 3GSXA 5T3ZD 1OAQH 4XWGH 5HGGS 3HRPA 3MV7D 5H2BA 3X12B 1Z5LA 2HVKB 1RZ8B 2JCCB 1A3LH 2QQNL 1QFWI 3V0AC 1J87A 4H8WH 1PY9A 4PJ5B 2VYRE 4ZXBC 2XWTB 3V5DB 3U6RB 4EQ3A 2C1PB 2PW1B 3QXAB 4PJ8B 3B9AA 4O00A 2UUDK 4J3OC 4PJHE 3SBWC 4WEMB 3S6CA 3STZA 4Y4HB 5E1AB 2RAMA 4OGYH 4Z76A 3MRBA 3GBMH 3K4ZA 2OL3B 3WFDL 4I0PC 4XWOC 3DX9A 1VFBB 1U95B 4KTDH 5HI3D 4LCIL 4LLQA 2UZIL 2EDLA 4YGVB 5GGSA 5FECA 4H1LA 5BV7B 3QEQE 3WO4B 3WHXA 1GHFH 2VLLA 4V2CB 1JK8B 1PLGH 1ZXQA 3A6BL 4Y4FC 3RZCB 3MLUH 1QSVA 3QUKA 4Y5VA 3MRGB 4JDZB 4BKLA 2Q3ZA 2IBZY 4G8IB 4GRLA 3FTGA 1KB9J 2APWA 4LPCA 2QLVB 3I3EA 4JKMA 3TBWB 1T5XA 2AJXH 3MRNA 5TH2B 4WCYL 3BDYH 3THMH 3AVEA 2WBJA 2AEQH 3OXRA 5DJCA 1LD9A 3DMMA 4KK9D 3MROB 3WIFB 2Q7NA 2BFVH 4QO1A 3DIFA 1OWRM 2VL5A 3ARQA 3T1WA 1S9XB 2A9NL 1J8KA 2NCMA 5T3ZH 2A0LD 2QR0A 3BT2H 4G7YH 3SKUD 4KY1H 3QIUC 3WLBB 5GHWH 1CGSL 2NTFA 2WAHA 1JHLL 2VDRH 1SJVA 4E41B 5GIRA 4XMPL 2GITA 4Q9BA 1ZGLA 3PQYA 3TBYA 4GW5B 4CKVX 4G7VH 4KZDH 4Z5RA 4HFUH 5BCAA 3U36B 1QEWB 2IQAA 1F45A 4BSWA 5EC2A 1XGQB 3GI8L 5JDSA 1MHPH 2AERT 2ARJQ 3QA3B 3IFPA 4K9EH 3IDJA 1OVZA 2CRZA 1DQDL 1U41A 1FFNB 2DQDH 2FSEB 3A6OA 5E4IA 3BGFB 1OWWA 5EU5B 1KPRB 2ICWB 1AXSA 5CP7B 4C83A 3WS6C 5HHXL 5EFIA 4RA3A 1ZANH 2LV4A 4TVSa 1SJXA 2IG2L 3GJFA 3U46A 2A77L 3MA7B 3VRLE 1U92A 3RA7H 2OXGA 3ARGA 5J1AB 3QDHA 4DGYL 3MRDB 5C0CB 4FQJL 2H6PA 4N0RA 1Q1JL 5DK0B 3GIZL 1X5FA 2V7HB 1AHWB 3MCKB 3UTTB 2AV1B 3HE6B 4FA8A 1FNSH 3ARTA 3JVGA 4RGNC 1RUMH 4WY7H 5EU6A 1Q9LA 4ZS6C 2OJEB 5FO7B 1J5OL 5DQ9B 5C0GB 1GAFH 3GMPB 4LCCC 5D5ME 2ITCA 2R0WL 2FBOJ 3LS5H 5LVEA 2VH5L 3AGVA 3AAZB 3Q6FA 4KK5D 5C2BH 4YFEA 3L3HB 1P4IH 4MD4A 3V6OA 1KFAL 3RDTC 2AJUH 1PX4A 4MS8D 3IDMA 1HHGB 2ARJA 3RU8H 1IGFL 1G7MB 1A6TA 1JGUL 3VFGL 4CW1B 4NQXA 4S2SB 1HINL 3PWUA 3ZE2F 3WE6A 3ARDB 3V6ZA 2DQGH 1INEL 1BZ9B 5J06A 2YBRA 4GKZB 3U9PH 3GSVB 4JZOB 2R23B 5EOTA 4RAHA 1W0VB 2VZSA 1A1NA 3ARYA 2AK1H 4JRWA 3VFVB 2HFGL 3EO9H 1E28B 1ODAA 3B8YA 4GOSA 1M7DB 1A9EA 4XAWL 3LY6A 4HKJA 1K4CA 4RAUB 3VRJA 1V3KA 1E27B 3DSFH 1MLCB 3X14A 1YEGL 4NQTA 3LKOB 2VDKL 2X09A 1UFUA 3G5XA 4YDVA 3HAEH 3O4OC 2D31B 5L2JB 2D3VA 3O2DL 2XA8H 2E7LC 5IFAL 3QQ4B 2AJ3A 1HWGB 3GSQB 1HE7A 3V52H 2W07A 5SWZE 4WI4A 3JWDC 2LTQB 3EYVA 5B4MD 1PDKA 2O26U 1A6UL 4JQVA 1RZKL 1NAMA 3RNQB 1WIPA 3IS1X 3ZDZF 3NCEB 1JRHI 1CICC 3F12B 4MA1C 3NAAH 2J6EH 5KS9A 5TDNB 3EDFA 3GSXB 3LPWA 3HE7D 4NT6A 1C16A 1A6ZB 3LKSB 4OLVH 5H2BB 5BW7C 3VRIA 1JNNH 4RZCA 1NGWA 4G42A 4P0DA 1U0QA 1I85C 3KPMA 1I3VA 3EGSA 4AM0A 1GZQA 2GT9A 2HA1A 4ELMB 4LPVA 4HCRL 3GKWL 3HPLA 3STZB 4L4VE 5ADPH 4Z76B 1BVZA 5DA0B 2A73A 2W38A 2WIIB 1REIA 3DXAD 3DX9B 5HHVH 5HHMD 4Y4KD 5JQ6L 2X4RA 4LLQB 5IHUH 1NKOA 5GGSB 5T1LD 5IVNA 2G75A 4H1LB 1CU4H 2VLLB 1HDMA 4KJQD 4W6XB 4LASL 1IGMH 4WVRA 4M5ZL 3K8LA 4C54A 3CMOL 3MTRA 4FABL 1ORSB 2CDFB 5D2NA 2NPLX 2ILLA 4BKLB 2GW5A 1A3RH 4GRLB 3FTGB 4ZUTA 4Y8DC 5I1HL 1T5XB 2DTSA 3MRNB 3BX7C 4P9HH 1NSNH 1UWGL 4EDWL 3ARSA 3OXRB 5DJCB 3HE7A 3DMMB 5AG8A 5JW3L 2EDWA 3VXNB 3DTXB 1U8NA 5IMLB 3MLTB 3MZTA 2N7AA 2VL5B 4QHKJ 2OQJA 2P5ED 2QR0B 3SKNA 1YMMD 4ETQA 4HG4K 2NTFB 2QQNH 3BPNB 4UAOB 1UENA 3QHFL 3RUGF 3MNVA 1MWAA 3OKKA 4MNGE 2ATKA 1MVFA 5GIRB 5DJDA 2GITB 1ZGLB 2LABA 3PQYB 4RMQA 3TBYB 4JFYA 4JM2D 4Y4KA 1MCPL 4Z5RB 2HT2D 1OGAD 2YUVA 5F9JA 4TVPL 2IQAB 2OBGA 2NY6D 5M94B 5EC2B 5JDSB 5T1LA 2P45B 1I3RB 1FCCA 1OAYL 3WFDH 3ZKND 3RZWA 1P7QD 3CPLB 3CXHK 3BEWA 3RRQA 4PJAB 4Q2ZA 4OIAA 4LCIH 4WWKD 1I7UB 2UZIH 4N0UA 2BRRL 4UIKL 3LZFL 4IMLA 3A6BH 3G5VA 4YHIA 4D8PA 2XXCB 1VGKA 1AXSB 4TNWF 4C83B 3F6IA 5EFIB 5K9QG 1P7KB 3SDYL 5AAMA 4CMHB 5J12C 4PRDA 4M7LL 2HN7A 4M61A 3GJFB 1KCKA 3U46B 1MFEL 1ZLSL 1JZ7A 3LQZA 1U92B 4JFFD 3ARGB 4KDTC 3UYRL 2P5EA 3T0ED 2H6PB 2MJWA 4IIQA 2EZ0C 2HMIC 1F4YL 1NLBL 3UEZA 4G8GE 3E6FA 1LP9E 2A9NH 5E03A 1MJ7L 3ECBA 3BP4A 4X6DB 5KSAC 5EU6B 3S5LB 3ZSTA 1Q9LB 4LCWA 5IHZA 1CQKA 4JM2A 1CGSH 4X4XA 1NEUA 3VI3E 2GJ6E 1OGAA 3FN3A 2ITCB 1JHLH 1H3PL 4PYHA 1K5NA 4XMPH 5ETUA 4YDLC 5D70L 3Q6FB 1S7RB 2ZUQB 4Q6IC 1P7QA 4MD4B 4OB5L 2C5DC 4LHUD 1R3KB 4WWKA 3IDMB 1FHGA 4OQTL 2ARJB 3GI8H 1A6TB 2AXGA 2L0DA 2GUOB 3TM6A 5C2UB 3HB3D 3PWUB 3KPRE 3WE6B 4LVOB 1NCCL 4Z7WF 3DYOA 2YBRB 3SCMD 1JGEA 1Q9WB 5I6XC 1JWMA 4B7IA 5I0ZA 1DQDH 3MGAA 2KKQA 4MB3A 5EIVA 4WEBL 1A1NB 4KDWA 1T66D 4QGYA 2CLZB 4Z6AT 2OMNA 3V5KA 3IJSA 1DUZA 4BJLA 5HHXH 2V6HA 1OSZA 1A9EB 2BOCA 4JFFA 1J0JA 4ODUB 5E4EB 1K4CB 3GKZA 3VRJB 3T0EA 2EIEA 1UEMA 1W0WA 2IG2H 1QFPA 5GRYA 3X14B 2A77H 4DEPC 1PG7X 3L5HA 1JPGA 5F8QC 3G5XB 5MENB 4KJPD 4DGYH 2H32A 3IJHA 4FQJH 1Q1JH 3GIZH 2LAAA 2AJ3B 4OZIF 2CJUL 5EU7C 3ORJA 3EYVB 4WI8A 2C3WA 2H32H 1WWAX 2NTSP 1NAMB 4KV5E 2GHWB 1J5OH 5C08E 3UBXB 2R0WH 1I1FA 1MAML 5KS9B 2VH5H 1RUKL 3OSKA 2DTML 2QQQA 1G9EA 1C16B 1JYNA 1KFAH 1QSEA 2YMXL 3VRIB 3BGMA 3SCMA 5GZND 5B38G 1XCTA 2NZ9D 1Z9OA 1IGFH 4RZCB 5EZJB 1JGUH 3VFGH 1NGWB 4G42B 1PBYA 2DM7A 1HINH 2Z8RA 5DJXA 3I6KA 3KPMB 1GZQB 1INEH 2GT9B 3B83A 3E2HC 1HYSC 1MCCA 4JY4A 5IQ9A 3HPLB 2DKMA 2ADGA 5BS0E 4GRWF 1ACYL 4YXKL 1L6ZA 1QR1A 2A73B 2UV3A 2HFGH 2OM5A 1OY3B 4NBZB 3L5XL 2BVPB 2X4RB 2OTUA 4XAWH 4JFQB 2PYEE 2G75B 1A1OB 4HXAL 1HDMB 5I73C 1IM3A 2VDKH 3NABH 1GXEA 5FHBL 1KLFA 5D2NB 1FCGA 3LRSA 3D85D 2H2PC 3O2DH 5IFAH 1CVRA 1BAFL 4ZUTB 3LQAC 1RPQA 3X3FL 1KACB 4LNRA 1QRNE 4OCMC 5IIEA 2WSKA 3NIDF 5C9KA 3IFNL 1A6UH 1RZKH 4FFWD 5E6YA 3HE7B 5IWLA 2X41A 3D9AL 5GS0L 1U8NB 4HZAA 4QWWD 5DA4A 4LPXA 2OQJB 3O3AA 3SKNB 3T4YA 3HMXH 1NFIA 4ETQB 4NFDA 4HCRA 3D0LB 1GC1C 4KHXL 3MNVB 3OKKB 2ATKB 4NKOA 1MAJA 4MMXC 5I17B 5DJDB 4Z95L 4Z7NE 4JFYB 1YC8A 4Y4KB 1MCOL 3NPSC 3GKWH 4LKCA 2F74B 1I1YA 4TVPD 1DLFL 5F9JB 1OSPL 1F8TL 4IDJL 5T1LB 5ADOL 1LNUA 4W4NA 3CSBA 4HBQA 5JQ6H 3BEWB 1K4DA 2W9DL 2YD7A 3SEPA 3VRLF 3ARRA 4Q2ZB 3MMEA 4CVXA 4YHYC 4N0UB 4YHLL 3D85A 1MCJA 4IMLB 1U6AL 4U1SA 5F7LB 3L9RB 1QG3A 5CJQL 4LASH 4YHIB 4M5ZH 3TF7C 1I7TA 1VGKB 3CMOH 4FABH 2DQHL 5E1HB 2ZZUT 5C0FA 4FXKA 2X9YA 4K94C 2ICES 5DD6A 2VZUA 3BD3A 4PRDB 4ZYKA 3TN0C 5I1HH 3S9DB 2D7PA 1UWGH 3LQZB 2PYFA 2PTUA 4JFDD 3QZWA 2P5EB 5EU3B 5JW3H 3NGBB 3BH8A 2X1PA 4XPBL 3WUWG 3D0VB 2P8LA 3IAPA 3BP4B 3I50L 1PY4A 2ADIA 1PSKL 4LCWB 5IHZB 3DHMA 4JM2B 4X4XB 2JIXA 3LKRA 4R0LC 4ZFOA 1EV2E 3HZMA 3QHFH 1TTGA 4PGDA 1LDSA 1OM3L 3MPCA 1K5NB 1XT5A 5K9JL 1TZHB 4U3XA 1MCHA 5SV4A 3S3SA 1MCPH 1P7QB 4CADA 1BD2D 4MD0B 3WLWC 2X6MA 5F8RC 4TVPH 4WWKB 3DURA 5DJAA 5JPNA 4Z78A 2EEDA 3DBXA 5TQ0L 3CVHB 1HILA 2AXGB 3RTQC 3UTPD 4PJIF 4C4KO 3CSYB 4AZ8A 2E9IA 2I9LA 3WHE0 4R2GD 3EJZD 3GSUB 1JGEB 1WWBX 3MLVL 2DBLL 3KXFD 5B39A 2BRRH 4UIKH 3LZFH 3U2SA 4HV8B 2X2YA 3TLRA 2C3HA 3IJSB 4JRYE 1DUZB 1OSZB 4JFFB 3WL9A 3SDYH 4OI8A 3RY6C 5IKCA 2BVYA 4M7LH 4UU9B 5CJXC 1MFEH 1ZLSH 5GSRA 2UY6A 4L8BA 3T8XA 1BQUA 1JPGB 4NJAL 4ZOEA 5D7LE 4POUB 3UYRH 3IJHB 5ICYA 5KSVA 2AK4E 3PGDA 3RX5A 1F4YH 1NLBH 4EUPA 2AJVL 4PRPE 4MNQD 5E99L 2UUDH 4G3YL 1MJ7H 1QSFE 5GGUA 4Y5YA 1RZFL 1X44A 4RISL 4FMKA 4OQ1A 2CK2A 1PQZA 4PREB 1AR2A 5I1AB 1BD2A 5IM7B 1H3PH 5IW6A 4OQTA 1CLZL 1U91A 5JW4N 5D70H 3O4LD 5FCUL 3U0WL 3EYFA 5F6HI 4JREC 4OB5H 3ARED 1QSEB 4D2NA 4HUWA 4ZO9A 2J3SA 4K7PL 5J9PA 1WCBA 2Q76A 3H6JA 1XCTB 2NY3D 4JZJA 5CEYA 1K85A 3C60C 3BMWA 4UDTA 5CKGA 1N64L 5DJXB 3ULVE 3I6KB 1NCCH 1NGQL 3VWKC 4JHWL 2ZCLH 4JY4B 5DO2C 5IQ9B 3HTLX 2ADGB 2Y7QA 1U2CA 3NIFF 4WEBH 2APBA 4LLVA 1YEJL 2EC8A 1QR1B 4WGWB 3VXRE 3LAFA 4DFIA 3BHBA 1CXKA 1SEBA 5DFTA 1JV5A 2OTUB 2EO1A 2IPTL 3DUHA 2IADB 4JY6A 3ZKXB 3IRZA 2WV3A 3UXFA 1SY6A 5CFHA 5T1MA 4MNQA 2DM2A 4KHTL 4OZGF 1I8MA 3LRSB 3WNKA 3WO3B 5ICXA 3DWTA 3HI5L 3NFNA 1IILE 3IF1B 1H8SA 1RZIA 2CJUH 4GKSA 2GSIA 4LNRB 4P5TC 3S37X 3U7WL 5IIEB 4I3RL 3DETC 5JHLL 3KGRA 3O4LA 2EXYC 4MWFA 4NQEA 3SDXF 5J0BA 1G0XA 4X6CF 3AREA 5I1DB 1QBLL 3QDGD 3HAEG 2AJZB 5ISZD 1MAMH 5DMGD 4LSQL 1RUKH 2AQ3A 3SE9L 2DTMH 4NNXA 4PGEA 4OBSA 3SGDI 4PY8J 15C8L 2ZSVA 3T4YB 5FUCE 2YMXH 1NFIB 3ULUL 1YJDL 3FO1A 4KI1A 1NUGA 2ORBL 1JYVA 2O5ZL 4NKOB 1J9CT 4U0RB 3G6JA 5E08L 3B43A 1LEKA 4LF3A 4YHKL 2BERA 4HIXL 4J1UA 4LKCB 4JFXB 2XPGA 1I1YB 3MOBL 4NOBA 1A6PA 1ACYH 4M00A 1P6FA 1LNUB 2NXZC 3K74B 1GPOL 4QLRA 3I6LE 4OF8A 4K71C 1K4DB 2VKWA 3L5XH 3MMEB 2F5BL 4HWBA 4HXAH 3D85B 3CZJA 2YN3A 4LOUD 4U1SB 2YUXA 1FORL 2BP3A 3HS0A 1JZ3A 3MYJA 5KJRL 1OLZA 4PJXE 4J8RA 4RRPA 4NNPL 1I7TB 5FHBH 2PTTB 3FONA 2BDNL 4HKZA 4KPHL 5C0FB 4FXKB 4ODVL 2X4PA 1BAFH 1GOHA 3X3FH 3T2OA 3GDBA 1PJ9A 4LHQB 3IFNH 4GMTL 3BRGC 4HGKC 2PYFB 3MA9L 3QZWB 4AJ0A 4LMQI 3B9KD 1QBML 5C6PB 1X5HA 3PWJB 4YDIL 1B4RA 3I02A 1NMCB 5FDWB 5GS0H 4CN1A 2VDQL 2IMNA 3CLFL 4NRXA 4YFLI 1N6QL 2P8LB 1U93A 3PWVA 5L7XL 2ADIB 1N6UA 4I48A 3GMRA 1AFVL 2JIXB 3LKRB 4ZFOB 4KHXH 3HZMB 4MQXC 1KUMA 4N5ED 4PGDB 4MAYB 3TA3C 5LCVL 4Z95H 5H94B 1A02N 4AIXA 3DI2B 1MCOH 3MGOA 3CIQA 3UPRB 2FEEI 2AABL 5FUZL 1TTUA 1DBKL 1OSPH 2XIDA 3DURB 1F8TH 5DJAB 4IDJH 5ADOH 1FFPA 3DBXB 1HILB 1I1AC 2W65B 3HUJE 5E24E 2W9DH 1B2WL 2I9LB 1A7PL 4LKXA 5JIKA 5B39B 5DJ2A 3C08L 3R0NA 4YHLH 1A6VL 5AZEL 3ZE0E 1U6AH 2BXZA 3U2SB 4PJFE 1IZJA 5CJQH 1A14L 1LO0L 4FG6D 3W0WB 2DQHH 2VDPL 2D03L 4HS6A 4KV5F 3WL9B 4WU7B 3RVWD 1GOGA 3B9KA 5IKCB 3VD3A 3KVQA 3HNTL 4PJDE 3WYRA 4XTRD 1MOEA 4L8BB 3T8XB 3SO3B 1GYAA 5D2LF 5DQDL 4YBLC 4KI5E 1NFKA 3PGCA 1ETZA 4P23D 4JKPL 4PD4K 5A2FA 2VDOL 1FZMB 5KSVB 5J56B 2I60L 1HI6A 2YD9A 3H42L 4XPBH 4L5FL 5FA4A 3WXVL 1R3JA 1I75A 1OARL 5GGUB 4Y5YB 3WJLC 2DL9A 3I50H 1XFPA 4H88L 1PSKH 3QAZB 4FQQA 1NCDL 1BD2B 1L6XA 2APVA 2EDOA 5IW6B 1OM3H 1U91B 4YHOL 5K9JH 3O81A 2V5TA 3EYFB 4Z7UE 3FT2A 4IS6A 4HUWB 4O51B 43C9A 5J9PB 1WCBB 2Q76B 3L3OA 1IEHA 5CEYB 4JZJB 5TQ0H 1KJVA 5AYQA 3EOBA 1QP1A 3QISA 3B5TA 2VC2L 2H2SC 3MLVH 2DBLH 5J4MA 4Y88A 1ZVHA 3MNWA 3UTSE 1AH1A 4LLVB 25C8L 4PP1D 4KJYA 1I8KA 3VDAA 2G5BA 2VL4A 2KBGA 1KJMA 1T89C 1SEBB 1JV5B 2Y5EA 2ID5A 3BQUB 2DM3A 4JY6B 3BKML 4LU5L 1EA9C 1JMZA 4P23A 1JCKA 3S35L 1XGTA 1MHHA 3VXQA 5JA9A 3D2UD 4NQDE 4NJAH 1CT8B 1I8MB 4ZSOE 3UTOA 5ICXB 5HDBE 3QUMA 3NFNB 2AJVH 5K93A 2NR6C 4GKSB 2GSIB 5E99H 1DVFD 4YNYA 4G3YH 3VFSA 1U36A 1RZFH 3PWNA 4RISH 3RL2A 1PVHA 1WV7T 1YEHL 4MWFB 4NQEB 4FQIL 1NH6A 3AREB 5LWYL 4ONFL 3EO0B 2J8UE 5E9DD 4OV5A 1CLZH 2OSLA 2CO7B 5IG7A 5FCUH 4NNXB 3U0WH 5J57B 1KCLA 2XKNA 1DR9A 5F7HA 1F90L 2NY4C 3ULVC 2ZSVB 4U1IB 3ULUD 1H5BB 4K7PH 2NW2A 3FO1B 2PXYA 2DQUL 3KJ6L 3EAKA 4IOSD 4HJJL 1N64H 1BBJA 3CSPA 3ZDYF 1NGQH 2NY5H 4JHWH 3HMWL 4BSJA 4LF3B 4J1UB 1F4XL 1DE4A 1ONQB 2G60L 4PLJC 5C0BB 1YEJH 5I0DA 3QDJD 2XQYG 1J0KA 4G9FD 1IGIL 3B5HA 4KVCL 5I71C 4ZPVB 4KMLB 4ZNCD 1BFOA 4L3ED 1QQDA 2IPTH 1BVKA 5TGBA 3RVUD 3U0TA 5IMMA 2RCSL 3HS0B 2JF1A 2DI7A 4LDOB 4J8RB 4KHTH 4EI5D 1CD1A 1JHKL 3FONB 4HKZB 3MRLA 5A1AA 3MRCB 4RQQA 3HI5H 2X4PB 1IVLA 1YUHA 4OF6A 3G6DL 3CNKA 5ESVB 5E9DA 3U7WH 4C56E 5JHLH 1CDIA 2HTLD 3FFCE 5D6DC 5F96L 1QBLH 1WIUA 1AO7E 3FAXA 2XG5A 2YWZA 3MO1B 3I02B 4KUCF 3LS4L 4LSQH 2EE3A 3RAJL 3SE9H 2DYPB 4NRXB 1EK3A 2EE6A 1NL0L 15C8H 1U93B 3PWVB 5C71A 1NC4D 3U9UA 4I48B 3ULUH 1YJDH 3GMRB 4TTDC 3LH2L 5ANMA 2ORBH 5CZKA 1MCKA 1FSKB 1CR9L 2O5ZH 5DMIL 2APFA 5DRNB 5E08H 1L4IA 5DJ8A 3QDJA 1KCSL 4G9FA 4FQXD 2YXMA 1T04A 3MGOB 4YHKH 4HIXH 2E6PA 3QQNA 2VQTA 3MOBH 5T3ZE 1TIUA 4L3EA 2EC9T 4MZ2A 5A3ID 1M6OA 4J4PD 4Y1AD 1PYWA 1FFPB 1GPOH 2D2OA 3WFBL 3QI9D 3TFKD 4PJGB 2F5BH 4LKXB 4EI5A 1X6NA 5DJ2B 5GISL 4R97B 3QEUA 5JORA 3U30C 4M93B 1H0DA 3AC0A 3O8XC 1FORH 5KJRH 4Y4HC 2Y23A 1JPFA 4NNPH 3QIBD 2K3TA 3CVHL 2PKDA 1ZOXA 2BDNH 4Z18A 4KPHH 4HS6B 2QKIA 4ODVH 5F1KC 5GGVY 2WLYA 3FHQA 1CE1L 4ZAKD 1JF5A 1JFQL 5AEAA 1G6VK 4GMTH 5FYKU 1N7ML 3MA9H 2MPAL 3PGCB 4GXUN 1QBMH 4U6TA 4YDIH 2A6DA 5B3NA 4QOKA 3O3EB 4GAJL 5C07E 2VDQH 3ZKSD 3CLFH 5FA4B 1F58L 2WZPD 3ULVF 3FQUA 1N6QH 3Q6GL 5L7XH 5FB8A 5D9SA 3QSKB 4FQXA 1WAAF 1AFVH 4FQQB 3ZHDA 1F6AB 5E5UB 5LCVH 2EICA 4J4PA 4FTVD 3SDCD 2FJGA 5FYJL 2W91A 3FT2B 3QI9A 2AABH 4IS6B 5FUZH 3QULA 1DBKH 43C9B 2H26A 1AJ7L 5IFHL 4JJHA 2FECI 1KJVB 2P5WE 3QRGL 1MCEA 3EOBB 1DTUA 2UWEF 4Z7VF 5HSFA 1B2WH 1A7PH 4NN5C 5I1IL 4ESKA 5M95B 1KYOK 4LP4A 3C08H 3VXSE 1A6VH 3MNWB 5AZEH 5HDLA 4ZXBD 2VXSL 4Z7OE 3BJ91 1A14H 1LO0H 5F9WC 1I8KB 1EPFA 2G5BB 2FHCA 4ZAKA 1KJMB 3OKMA 2VDPH 1MCIA 4I5BA 4PG9A 5CHNA 2C1OA 2RQ8A 4P23B 1JPTL 4KI5C 3HNTH 1NGYA 4I0PD 5F9DC 3IDXL 4UTAL 1PG7W 4ZOAA 4I2XE 2V5MA 1MHHB 3VXQB 1FIEA 4FQPA 4FQHB 5DQDH 3VCLA 3TP4A 1MF2L 2DMBA 2OI9B 1U8MA 3MBED 4JKPH 1KIRA 2VDOH 2I60H 4XXCA 3QUMB 1LO3L 1I8IA 4L5FH 3WXVH 5DQJA 2ED9A 3VFSB 3PWNB 4FTVA 4H88H 3SOBL 4U2ZA 4YR6A 3LQMA 1NCDH 1BIHA 3QWOA 4PJBF 4OV5B 1WZ1L 5E95B 5E6ZA 4F9PC 2OSLB 4YHOH 5IG7B 5IJVA 4QT5A 2XKNB 1UM6L 3HE6C 4HH8A 3F62A 2NW2B 2JCCF 2PXYB 3ABZA 3EHBD 5DMKA 5FCSH 2D4DA 3C09C 4ZXBA 3CX5J 4UQ2A 4P46C 2VC2H 1BECA 2QL1A 4PRID 1MPAL 1DE4B 4HXBL 2Y5TA 3SBWA 3RVXC 1TNMA 25C8H 4I0PA 3SJVE 4CDGC 1G7LB 3DARA 1BFOB 3ARWA 1KTDB 2GFBA 1CD9B 1QQDB 2V9RA 4RMSA 2JB6A 5CBAA 1BVKB 3BKMH 4LU5H 1H3WM 2DIAA 5D1QC 4R6UA 5TGBB 3MBEA 1EZVX 5FGCE 1IAMA 4HHAA 5KVGL 5HYSB 3S35H 5DD3L 3U7YL 3U0TB 3CFKA 5IMMB 2GY7B 4HFWA 2VR4A 2B0SL 3Q5OA 2LU7A 4J6RL 5J1SC 3JBG7 3MRLB 3AU1B 1Z0NA 3QG6A 4RQQB 1U3ZA 3W11C 3O9WD 3UTQA 3UC0L 1YUHB 2LVCA 1NEZG 5CJ5A 2Q7YA 5E9DB 4D9LL 2KZWA 5DD1L 1YEHH 4FQIH 5A16A 5LWYH 4ONFH 1QFWL 1DANU 3WDJA 1EFQA 2NXYB 3MLXL 2YRLA 1F90H 1P9MC 2YPLB 4FFYL 1J10A 2FL5A 1ZWIA 3RI5K 4PRIA 3KPNA 3ZE0F 2DQUH 4KKCC 3KJ6H 5ANMB 4R7DA 1N3NA 4HJJH 4JRXD 4NQCD 3TIDA 3D25B 4RGND 5DJ8B 3QDJB 3P77A 2ZUTA 4JANA 4KTYA 3HMWH 4ZS6D 4H8WC 1F4XH 2G60H 4NPYA 1NGZB 4L3EB 3BZFA 1PYWB 2F9BT 1IGIH 4KVCH 5AG9A 4KI5F 4ZTOL 1E4WL 1WZMA 4XB8A 3QEUB 4OCWL 1H0DB 1N26A 2RCSH 2YD6A 4UZGA 4L9LC 3CXHJ 1XIWD 3PWPA 1JPFB 3RPKA 4O2CA 1JHKH 1R3LA 4NHUB 2X4QA 4JAMA 3WS6A 4N90D 4QRPE 4OGZA 3G6DH 1FO0A 2M2DA 5CLTA 4TNVK 4MHHG 3I3BA 3U0PA 5TE4L 3N1GC 5F96H 4OCSL 3BPOB 2EIZA 4DCQA 2A6DB 4QOKB 4Y5VC 3SDDD 4MMZC 1V3JA 3LS4H 1A3QA 5TFSL 4Z7QE 3RAJH 4LVHB 5T3XD 4QTHB 1NL0H 4MVBD 4NQCA 5D9SB 1EFXD 1K3ZA 3SQBA 4DZBA 4FQXB 5F7UA 3LH2H 5GRJL 2WBJC 4LPYA 1CR9H 1OPGL 1Z0MA 3ESUF 2AS5M 3KLAA 5HHOD 5FV2A 1G0DA 3VU2A 3LD8C 1KCSH 5FYJD 3D3VD 5KSUA 2FJGB 3QFJB 4H0HB 1V05A 1RHFA 2L7UA 3QULB 1CICD 3RDTA 3EJJX 2DMCA 2H26B 5IB1A 3RGHA 1UVQA 1B6DA 1HSAB 1W8NA 2H1PL 3SKOA 3WFBH 1XIWA 1NUFA 2CKBL 5KAQG 5GISH 1ZVSA 8FABA 3ARBB 1CDCA 3MXVL 4YBQD 2F54D 5TPWL 2E7MA 5HI3C 3S3JA 4K9EC 4ZAKB 3HLAA 4MSWA 3CVHH 3OKMB 4I5BB 5CHNB 4D0DA 4N8VA 4P2QE 3SE3C 1BMGA 2J8UF 1KTLA 3WXWL 1NGYB 2W59A 4LVNB 1CE1H 2R69L 5GRXG 1EMTH 3EBAA 1JFQH 3MV9E 5GS2D 3A67L 1N7MH 3VCLB 3FRPA 2XFXA 2MPAH 3UZVB 1U8MB 4UT9L 1CF8L 1KIRB 1J0HA 2XI9A 3JUYA 1OB1A 1EFXA 2E7LA 4GAJH 1F58H 5DQJB 4PR5A 1KIQA 4HK0A 3D39A 5CCKL 5IV2A 3Q6GH 5HHOA 4KK9C 4FTVB 1DEDA 2D7MA 4MQSB 1FL3A 2R1WA 4QRRA 3D3VA 5ACLA 3MV8D 3QWOB 4KXZH 5B8CA 1CICA 2EDFA 3QDME 1A64A 1CXFA 1EZVY 2A0LC 2HFEA 3RWHA 3GRWL 3LKPA 5IJVB 4QT5B 1TQBB 5FYJH 5BW7A 1KIUA 1TFHA 1AJ7H 5IFHH 3GMMA 1QTYT 1OTTD 3JVGC 3KR3L 4R96A 3TH2T 5DMKB 3QRGH 4NM4L 3KHQA 4ZXBB 1I85A 4UQ2B 5I1IH 1FNAA 5E5RB 2E9WA 2Y5TB 2VXSH 2XZZA 1CQYA 4LLUA 5CILH 1QLEL 3VW3L 1QO3A 2FJFA 4HDIB 4I0PB 2NY7L 1UZ8A 3EDKA 1YECL 4XPFL 3VGBA 5CBAB 2WUBL 4NBYB 3MBEB 3BE1L 4HHAB 4Y19B 4XHJC 3IDXH 3X17A 5BOPA 4UTAH 3QEQD 4KC3B 5IBUB 4HFWB 3IDNB 4Y4FB 1AI1L 4NWTL 1AQDA 1MF2H 4U7SA 4L8SA 4BELD 3B8SA 4OLXH 3QG6B 3UTQB 1JRHL 1LO3H 4P3WA 3GSOA 3MV8A 5I1KL 2V2TA 5B3JF 2Q7YB 2BY1A 3WS3B 2YC1A 1DQTA 3MGTA 5I1JL 3SOBH 4YHPA 3KWWA 5A16B 5DURD 4QXTA 3MRIA 4R7NA 1WZ1H 2R1YA 1A7RL 1UM6H 1WF5A 4Y5XC 1NANI 4OZIA 2FL5B 1ZWIB 2EZ0D 4TYUA 2GCYA 2CMRL 3QIUB 3T77B 4Y89A 4E9LA 5BZDA 4K8RD 3VGFA 1S9KC 4PJHA 4KK5C 3D18A 3TIDB 4F9LC 4TPRL 3RWCA 3P77B 5KSAD 4JANB 1W0YT 3PP3K 5HDQL 1MPAH 4HXBH 3O6LL 4NC1E 4NPYB 4OCNC 3BZFB 2B4CC 3JWOC 1YZZA 1R3HA 1WJ3A 3AS3A 3HRZA 4XVUD 1T1XA 3QEQA 4O2EA 2O93L 4OZHE 1C12A 2C4XA 3HPJA 4GFTB 1HHIA 4FZEL 3UDWC 5KVGH 2I5YL 5DD3H 3U7YH 2YD3A 5A2IH 1X7QA 3PWPB 2B0SH 4J6RH 2FDBP 4O2CB 4NCC2 1R3LB 1Z2KA 1WFOA 1G6RB 3C2SA 4JAMB 2DOCA 1I3UA 4G6FD 4M1DL 3UC0H 4AIOA 5C09E 3RVVD 4S1RL 4OZFA 5DD5L 3H0TA 5J7CC 4D9LH 3KDMB 4PLKC 5DD1H 3MXWL 3U0PB 4ZNEA 5JA8B 4KDTA 4IRZL 2EIZB 1QFWH 4DCQB 3GO1L 4EOWL 5B4MC 3H7LA 4R26L 2AJYH 1Q72L 3WNNA 3GUTA 5FM5M 5DZLA 2VUYA 3RL1A 4XPTL 4HGMA 4RGNB 4FFYH 4YXHL 3S7GA 5KSAA 3HZVA 2DD8L 5I19L 4NBXB 4JFHE 1WWCA 3RWGA 1O7VA 1FFQA 5DHVB 1II4E 3HE7C 3EFDL 4OCYL 5SX4I 2VE6A 1F00I 4KK8D 3RDTB 4DKEL 2J1KA 3N1FC 3PHOA 2FO4A 5FGBC 1XEDA 1E4WH 3VD4A 1ZVSB 2XTLA 1EBAA 8FABB 1IGJA 4OCWH 4YZFE 5GS3A 5E2TL 4ELKA 3K1KC 3HLAB 1VFMA 4MSWB 4R8WL 4D0DB 2X4TA 5DRWA 4KJQC 3LOWA 3MBXL 2XZCL 1J1XL 3IRPX 2X44D 2DLGA 4V2BA 1U8OA 4O2FA 5FV1L 2XFXB 5TE4H 5LAXA 4IHOB 3NIGE 3O4OB 4OCSH 2J5LC 3H2WA 1OB1B 1EFXB 1OLLA 5TFSH 4LHJB 1U3JA 1KIQB 4HK0B 5D5MA 5C7XL 5SWZD 3D39B 4HD9A 5IV2B 5IEKA 3UROR 4XVSL 1UWXK 1XF4A 2R1WB 4QRRB 4MLSA 2B39A 3FFDA 2F15A 1S9YA 5GRJH 4X99A 5B8CB 1CICB 1CFSA 1OPGH 4MA1B 4QTIL 4IIQC 2HFEB 3RWHB 3LKPB 4CVUA 3MCG1 1RUQH 5I9QC 1TXKA 4WFGE 3OG6B 1JZ5A 5DR5L 1IBGL 3H8NA 2H1PH 3R8QA 3O11A 4JM2C 4WJ5B 2HT2C 1JI2A 5KSBE 3LV3A 1G7QA 3ZT6A 3JTTA 1WEJL 3QXVA 5FGRA 3O3UN 2CKBH 2NY6C 3WNMA 5L8LB 1BIIA 3STLA 4L4VD 4ZUSA 2HTKD 2A1WL 5TPWH 4LLUB 3Q3GA 4F33A 3S5LG 1D6EA 1QO3B 2FJFB 3AXLA 4WWKC 5EC1A 2J88L 2CIKB 5DVOA 5KOMC 3P4MA 1MI5E 4CVZA 3RNKA 1J18A 3PHQA 3FB6A 3WXWH 2R69H 4LBEA 3QRFM 3M45A 3P73B 4QNPE 1FZOA 3A67H 1T3FA 2AXFA 3TO2A 4NRYB 1AQDB 2V5RA 4PBXA 5SWZA 4UT9H 1CF8H 1DN0A 4L8SB 1S7QA 4G6KL 3BRDA 4DOHE 3V2AR 4EIZC 3GSOB 2ZUSA 3MV8B 4DN3L 4Z8FL 2V2TB 5FM8A 2KL6A 4NQUA 1JN6A 3MGTB 5CCKH 1U8KA 3T0EC 1OGTA 4QY8A 2N56A 3K81A 3KWWB 4Y0GA 2X05A 4QXTB 5KBNC 3QNYB 3TN0D 2W0LA 2R1YB 4HIJA 4ZD3L 4HKBA