3SGQI

Gln 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 10.7
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
b'VDCSEYPKPACTQEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3sgqI00
2KMQA 2V53A 1CHOI 4SGBI 1M8BA 2ARPF 1PCEA 1HJAI 1YU6C 1BUSA 2JYYA 1OVOA 2SGDI 1DS3I 2JXDA 1UVFA 1NUBA 4HGUA 3SGQI 1SGRI 5DAEA 1DS2I 1PPFI 2OVOA 3QTLD 1IY6A 2P6AC 2NU0I 1TGSI 1TUSA 2XRCA 1SGDI 2KMRA 3SGBI 1UUCA 1TIHA 1HDLA 2N52A 1R0RI 1IW4A 1CT0I 1LR8A 1AN1I 4GI3C 2QQCA 1IY5A 1CGII 5JHWC 1BMOA 2QQDA 2B0UC 1N13A 3B4VC 1M8CA 1TBRR 2F3CI 1SGEI 1Y1CA 2JZMA 1YTPA 2NU4I 1TBQR 1CT4I 1SGNI 1HPTA 1PJUA 1OMUA 1SGQI 2GKTI 2WCYA 1SGYI 3HH2C 1LR9A 2BUSA 2GKRI 2KCXA 1Y1BA 1MT1A 2SGFI 3TJQA 1KMAA 1CSOI 1LR7A 1Z7KB 1CGJI 2LEOA 2KMOA 2N17A 1CT2I 2GKVA 2ERWA 2N71A 2NU2I 3OVOA 1FYBA 2M5XA 1OYVI 1TURA 2SGPI 1SGPI 2KMPA 2NU3I 2NU1I 1UVGA 2SGEI 3SEKC 1H0ZA 2SGQI 1CE3A 4OVOA 1OMTA
chains in the Genus database with same CATH superfamily
2KMQA 3FSXA 2V53A 1CHOI 4SGBI 2L8EA 2PQ8A 5E3PA 1M8BA 2ARPF 3UOEA 1PCEA 1KBEA 1HJAI 1YU6C 2GIVA 1BUSA 2JA1A 2JYYA 3R5AA 4E1PA 1OVOA 1WGTA 2OD1A 2SGDI 1DS3I 5HQ8A 2JXDA 2YUUA 1UVFA 2FNFX 3RU0A 1NUBA 4HGUA 5EX0A 3SGQI 1SGRI 5DAEA 1DS2I 2DKVA 2ORVA 1PPFI 2OVOA 3QTLD 2Y0MA 4FKDA 1IY6A 2P6AC 2NU0I 1TGSI 1TUSA 1ULNA 2WGCA 2XRCA 1SGDI 4A24A 2KMRA 4DNCA 5J8CA 2DB6A 1FY7A 2ODDA 1ULMA 3SGBI 1K7UA 1UUCA 2V1CC 1TIHA 3TOBA 1HDLA 2W0TA 1MJBA 2N52A 2GVIA 2V1CA 1R0RI 1WTJA 5FUXA 1IW4A 1CT0I 1X74A 1LR8A 2X3TA 4UXHA 1AN1I 3FSYA 4GI3C 2QQCA 2RIJA 3R5BA 1CGII 3R5CA 2UZ3A 3TO7A 3UEJA 5JHWC 1IY5A 2CWHA 2E73A 1BMOA 2LB7A 1Y8FA 1Q9BA 5CCMA 2DIPA 2QQDA 2QQ0A 2B0UC 3UEYA 1N13A 2CJSC 3B4VC 1M8CA 1TBRR 2ENZA 2F3CI 2N1AB 2ELIA 2UVOA 1TBNA 1WKXA 1XA6A 2CWFA 3OL0A 4L9MA 1SGEI 1PTQA 1Y1CA 5J8FA 1FARA 3TOAA 1WGCA 2JZMA 4UXIA 3TO9A 1RFHA 1YTPA 2NU4I 5EX3A 1TBQR 2ROWA 1CT4I 1SGNI 1HPTA 1PJUA 1OMUA 1SGQI 2GKTI 2VRWB 1SGYI 2ORWA 2WCYA 2J9RA 3HH2C 2CWGA 3QAHA 1LR9A 1XX6A 2BUSA 1K7TA 1PTRA 2OZUA 3FC3A 5FUWA 3UFFA 2GKRI 2KCXA 5E3QA 1Y1BA 2ENNA 1MT1A 3UGLA 3VDUA 2B8TA 2SGFI 5HI7A 3TJQA 5CCLA 1R79A 3OXFA 1MJ9A 1V1IA 4JCVE 4B6DA 2K9HA 3D00A 9WGAA 2WVJA 3E59A 5FUYA 1KBFA 1P9GA 1KMAA 3BJIA 1CSOI 1FAQA 1LR7A 3KY9A 1VDDA 1Z7KB 4AMLA 7WGAA 1CGJI 2LEOA 2KMOA 2N17A 1CT2I 2GKVA 1XBTA 1X4SA 3R5DA 1NXUA 2ERWA 2N71A 2NU2I 2LUYA 3OVOA 4MPIA 2E5RA 1ULKA 3VE5A 3TO6A 3GOXA 1HEVA 3CXLA 1FYBA 3OXLA 2M5XA 1UHAA 1OYVI 1TURA 2QQEA 1S20A 2SGPI 3QWPA 2YQPA 4E1RA 1SGPI 2A20A 3UGIA 2X52A 2RC4A 2KMPA 1K7VA 1MJAA 1V1HA 4WP4A 2J87A 2L7XA 2NU1I 2NU3I 1UVGA 1W4RA 1TOTA 2SGEI 3E2IA 3OXGA 5FUVA 3SEKC 3UGDA 2JW6A 1H0ZA 2QPOA 2SGQI 3MEKA 1CE3A 5E3RA 1TBOA 1U5KA 3VDPA 4OVOA 1W3SA 1Z2IA 4UXJA 3PDNA 1P9ZA 2OU2A 1OMTA
chains in the Genus database with same CATH topology
2KMQA 2V53A 1CHOI 4SGBI 2L8EA 1M8BA 2ARPF 1PCEA 1KBEA 1HJAI 1YU6C 1BUSA 2JA1A 2JYYA 4E1PA 1OVOA 2OD1A 2SGDI 5HQ8A 1DS3I 2JXDA 2YUUA 1UVFA 2FNFX 3RU0A 1NUBA 4HGUA 5EX0A 3SGQI 1SGRI 5DAEA 1DS2I 2ORVA 1PPFI 2OVOA 3QTLD 4FKDA 1IY6A 2P6AC 2NU0I 1TGSI 1TUSA 2XRCA 1SGDI 4A24A 2KMRA 2DB6A 2ODDA 3SGBI 1UUCA 2V1CC 1TIHA 1HDLA 2W0TA 2N52A 2GVIA 2V1CA 1R0RI 5FUXA 1IW4A 1CT0I 1X74A 1LR8A 4UXHA 1AN1I 4GI3C 2QQCA 1IY5A 1CGII 2UZ3A 3UEJA 5JHWC 2E73A 1BMOA 1Y8FA 5CCMA 2DIPA 2QQDA 2QQ0A 2B0UC 3UEYA 1N13A 2CJSC 3B4VC 1M8CA 1TBRR 2ENZA 2F3CI 2N1AB 2ELIA 1TBNA 1XA6A 3OL0A 4L9MA 1SGEI 1PTQA 1Y1CA 1FARA 2JZMA 4UXIA 1RFHA 1YTPA 2NU4I 5EX3A 1TBQR 2ROWA 1CT4I 1SGNI 1HPTA 1PJUA 1OMUA 1SGQI 2GKTI 2VRWB 1SGYI 2ORWA 2WCYA 2J9RA 3HH2C 1LR9A 1XX6A 2BUSA 1PTRA 3FC3A 5FUWA 3UFFA 2GKRI 2KCXA 3UGLA 1Y1BA 2ENNA 1MT1A 3VDUA 2B8TA 2SGFI 5HI7A 3TJQA 5CCLA 1R79A 3OXFA 1V1IA 4JCVE 4B6DA 2K9HA 3D00A 2WVJA 3E59A 5FUYA 1KBFA 1KMAA 3BJIA 1CSOI 1FAQA 1LR7A 3KY9A 1VDDA 1Z7KB 1CGJI 2LEOA 2KMOA 2N17A 1CT2I 2GKVA 1XBTA 1X4SA 2ERWA 2N71A 2NU2I 2LUYA 3OVOA 3GOXA 2E5RA 3VE5A 3CXLA 1FYBA 3OXLA 2M5XA 1OYVI 1TURA 2QQEA 2SGPI 3QWPA 2YQPA 4E1RA 1SGPI 2A20A 3UGIA 2KMPA 1V1HA 2J87A 2L7XA 2NU1I 2NU3I 1UVGA 1W4RA 1TOTA 2SGEI 3E2IA 3OXGA 5FUVA 3SEKC 3UGDA 2JW6A 1H0ZA 2QPOA 2SGQI 3MEKA 1CE3A 1TBOA 1U5KA 3VDPA 4OVOA 1W3SA 4UXJA 3PDNA 1OMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMQ A;  2V53 A;  1CHO I;  4SGB I;  1M8B A;  2ARP F;  1PCE A;  1HJA I;  1YU6 C;  1BUS A;  2JYY A;  1OVO A;  2SGD I;  1DS3 I;  2JXD A;  1UVF A;  1NUB A;  4HGU A;  3SGQ I;  1SGR I;  5DAE A;  1DS2 I;  1PPF I;  2OVO A;  3QTL D;  1IY6 A;  2P6A C;  2NU0 I;  1TGS I;  1TUS A;  2XRC A;  1SGD I;  2KMR A;  3SGB I;  1UUC A;  1TIH A;  1HDL A;  2N52 A;  1R0R I;  1IW4 A;  1CT0 I;  1LR8 A;  1AN1 I;  4GI3 C;  2QQC A;  1IY5 A;  1CGI I;  5JHW C;  1BMO A;  2QQD A;  2B0U C;  1N13 A;  3B4V C;  1M8C A;  1TBR R;  2F3C I;  1SGE I;  1Y1C A;  2JZM A;  1YTP A;  2NU4 I;  1TBQ R;  1CT4 I;  1SGN I;  1HPT A;  1PJU A;  1OMU A;  1SGQ I;  2GKT I;  2WCY A;  1SGY I;  3HH2 C;  1LR9 A;  2BUS A;  2GKR I;  2KCX A;  1Y1B A;  1MT1 A;  2SGF I;  3TJQ A;  1KMA A;  1CSO I;  1LR7 A;  1Z7K B;  1CGJ I;  2LEO A;  2KMO A;  2N17 A;  1CT2 I;  2GKV A;  2ERW A;  2N71 A;  2NU2 I;  3OVO A;  1FYB A;  2M5X A;  1OYV I;  1TUR A;  2SGP I;  1SGP I;  2KMP A;  2NU3 I;  2NU1 I;  1UVG A;  2SGE I;  3SEK C;  1H0Z A;  2SGQ I;  1CE3 A;  4OVO A;  1OMT A; 
#chains in the Genus database with same CATH topology
 2KMQ A;  3FSX A;  2V53 A;  1CHO I;  4SGB I;  2L8E A;  2PQ8 A;  5E3P A;  1M8B A;  2ARP F;  3UOE A;  1PCE A;  1KBE A;  1HJA I;  1YU6 C;  2GIV A;  1BUS A;  2JA1 A;  2JYY A;  3R5A A;  4E1P A;  1OVO A;  1WGT A;  2OD1 A;  2SGD I;  1DS3 I;  5HQ8 A;  2JXD A;  2YUU A;  1UVF A;  2FNF X;  3RU0 A;  1NUB A;  4HGU A;  5EX0 A;  3SGQ I;  1SGR I;  5DAE A;  1DS2 I;  2DKV A;  2ORV A;  1PPF I;  2OVO A;  3QTL D;  2Y0M A;  4FKD A;  1IY6 A;  2P6A C;  2NU0 I;  1TGS I;  1TUS A;  1ULN A;  2WGC A;  2XRC A;  1SGD I;  4A24 A;  2KMR A;  4DNC A;  5J8C A;  2DB6 A;  1FY7 A;  2ODD A;  1ULM A;  3SGB I;  1K7U A;  1UUC A;  2V1C C;  1TIH A;  3TOB A;  1HDL A;  2W0T A;  1MJB A;  2N52 A;  2GVI A;  2V1C A;  1R0R I;  1WTJ A;  5FUX A;  1IW4 A;  1CT0 I;  1X74 A;  1LR8 A;  2X3T A;  4UXH A;  1AN1 I;  3FSY A;  4GI3 C;  2QQC A;  2RIJ A;  3R5B A;  1CGI I;  3R5C A;  2UZ3 A;  3TO7 A;  3UEJ A;  5JHW C;  1IY5 A;  2CWH A;  2E73 A;  1BMO A;  2LB7 A;  1Y8F A;  1Q9B A;  5CCM A;  2DIP A;  2QQD A;  2QQ0 A;  2B0U C;  3UEY A;  1N13 A;  2CJS C;  3B4V C;  1M8C A;  1TBR R;  2ENZ A;  2F3C I;  2N1A B;  2ELI A;  2UVO A;  1TBN A;  1WKX A;  1XA6 A;  2CWF A;  3OL0 A;  4L9M A;  1SGE I;  1PTQ A;  1Y1C A;  5J8F A;  1FAR A;  3TOA A;  1WGC A;  2JZM A;  4UXI A;  3TO9 A;  1RFH A;  1YTP A;  2NU4 I;  5EX3 A;  1TBQ R;  2ROW A;  1CT4 I;  1SGN I;  1HPT A;  1PJU A;  1OMU A;  1SGQ I;  2GKT I;  2VRW B;  1SGY I;  2ORW A;  2WCY A;  2J9R A;  3HH2 C;  2CWG A;  3QAH A;  1LR9 A;  1XX6 A;  2BUS A;  1K7T A;  1PTR A;  2OZU A;  3FC3 A;  5FUW A;  3UFF A;  2GKR I;  2KCX A;  5E3Q A;  1Y1B A;  2ENN A;  1MT1 A;  3UGL A;  3VDU A;  2B8T A;  2SGF I;  5HI7 A;  3TJQ A;  5CCL A;  1R79 A;  3OXF A;  1MJ9 A;  1V1I A;  4JCV E;  4B6D A;  2K9H A;  3D00 A;  9WGA A;  2WVJ A;  3E59 A;  5FUY A;  1KBF A;  1P9G A;  1KMA A;  3BJI A;  1CSO I;  1FAQ A;  1LR7 A;  3KY9 A;  1VDD A;  1Z7K B;  4AML A;  7WGA A;  1CGJ I;  2LEO A;  2KMO A;  2N17 A;  1CT2 I;  2GKV A;  1XBT A;  1X4S A;  3R5D A;  1NXU A;  2ERW A;  2N71 A;  2NU2 I;  2LUY A;  3OVO A;  4MPI A;  2E5R A;  1ULK A;  3VE5 A;  3TO6 A;  3GOX A;  1HEV A;  3CXL A;  1FYB A;  3OXL A;  2M5X A;  1UHA A;  1OYV I;  1TUR A;  2QQE A;  1S20 A;  2SGP I;  3QWP A;  2YQP A;  4E1R A;  1SGP I;  2A20 A;  3UGI A;  2X52 A;  2RC4 A;  2KMP A;  1K7V A;  1MJA A;  1V1H A;  4WP4 A;  2J87 A;  2L7X A;  2NU1 I;  2NU3 I;  1UVG A;  1W4R A;  1TOT A;  2SGE I;  3E2I A;  3OXG A;  5FUV A;  3SEK C;  3UGD A;  2JW6 A;  1H0Z A;  2QPO A;  2SGQ I;  3MEK A;  1CE3 A;  5E3R A;  1TBO A;  1U5K A;  3VDP A;  4OVO A;  1W3S A;  1Z2I A;  4UXJ A;  3PDN A;  1P9Z A;  2OU2 A;  1OMT A; 
#chains in the Genus database with same CATH homology
 2KMQ A;  2V53 A;  1CHO I;  4SGB I;  2L8E A;  1M8B A;  2ARP F;  1PCE A;  1KBE A;  1HJA I;  1YU6 C;  1BUS A;  2JA1 A;  2JYY A;  4E1P A;  1OVO A;  2OD1 A;  2SGD I;  5HQ8 A;  1DS3 I;  2JXD A;  2YUU A;  1UVF A;  2FNF X;  3RU0 A;  1NUB A;  4HGU A;  5EX0 A;  3SGQ I;  1SGR I;  5DAE A;  1DS2 I;  2ORV A;  1PPF I;  2OVO A;  3QTL D;  4FKD A;  1IY6 A;  2P6A C;  2NU0 I;  1TGS I;  1TUS A;  2XRC A;  1SGD I;  4A24 A;  2KMR A;  2DB6 A;  2ODD A;  3SGB I;  1UUC A;  2V1C C;  1TIH A;  1HDL A;  2W0T A;  2N52 A;  2GVI A;  2V1C A;  1R0R I;  5FUX A;  1IW4 A;  1CT0 I;  1X74 A;  1LR8 A;  4UXH A;  1AN1 I;  4GI3 C;  2QQC A;  1IY5 A;  1CGI I;  2UZ3 A;  3UEJ A;  5JHW C;  2E73 A;  1BMO A;  1Y8F A;  5CCM A;  2DIP A;  2QQD A;  2QQ0 A;  2B0U C;  3UEY A;  1N13 A;  2CJS C;  3B4V C;  1M8C A;  1TBR R;  2ENZ A;  2F3C I;  2N1A B;  2ELI A;  1TBN A;  1XA6 A;  3OL0 A;  4L9M A;  1SGE I;  1PTQ A;  1Y1C A;  1FAR A;  2JZM A;  4UXI A;  1RFH A;  1YTP A;  2NU4 I;  5EX3 A;  1TBQ R;  2ROW A;  1CT4 I;  1SGN I;  1HPT A;  1PJU A;  1OMU A;  1SGQ I;  2GKT I;  2VRW B;  1SGY I;  2ORW A;  2WCY A;  2J9R A;  3HH2 C;  1LR9 A;  1XX6 A;  2BUS A;  1PTR A;  3FC3 A;  5FUW A;  3UFF A;  2GKR I;  2KCX A;  3UGL A;  1Y1B A;  2ENN A;  1MT1 A;  3VDU A;  2B8T A;  2SGF I;  5HI7 A;  3TJQ A;  5CCL A;  1R79 A;  3OXF A;  1V1I A;  4JCV E;  4B6D A;  2K9H A;  3D00 A;  2WVJ A;  3E59 A;  5FUY A;  1KBF A;  1KMA A;  3BJI A;  1CSO I;  1FAQ A;  1LR7 A;  3KY9 A;  1VDD A;  1Z7K B;  1CGJ I;  2LEO A;  2KMO A;  2N17 A;  1CT2 I;  2GKV A;  1XBT A;  1X4S A;  2ERW A;  2N71 A;  2NU2 I;  2LUY A;  3OVO A;  3GOX A;  2E5R A;  3VE5 A;  3CXL A;  1FYB A;  3OXL A;  2M5X A;  1OYV I;  1TUR A;  2QQE A;  2SGP I;  3QWP A;  2YQP A;  4E1R A;  1SGP I;  2A20 A;  3UGI A;  2KMP A;  1V1H A;  2J87 A;  2L7X A;  2NU1 I;  2NU3 I;  1UVG A;  1W4R A;  1TOT A;  2SGE I;  3E2I A;  3OXG A;  5FUV A;  3SEK C;  3UGD A;  2JW6 A;  1H0Z A;  2QPO A;  2SGQ I;  3MEK A;  1CE3 A;  1TBO A;  1U5K A;  3VDP A;  4OVO A;  1W3S A;  4UXJ A;  3PDN A;  1OMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...