3SGQI

Gln 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 10.7
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTQEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3sgqI00
1N13A 3SGQI 1SGRI 1KMAA 1UVGA 2NU2I 2KMQA 1PJUA 2KMRA 2QQDA 2JZMA 2GKTI 1HPTA 1DS3I 1BUSA 1CSOI 1UUCA 2N71A 1CT2I 2N52A 1LR9A 2KMPA 1Z7KB 2ERWA 1SGPI 2OVOA 1UVFA 1NUBA 2NU0I 1TIHA 1CT0I 1M8BA 3HH2C 2LEOA 1YTPA 1PPFI 2GKRI 2NU4I 2M5XA 1Y1BA 1OYVI 1CE3A 1HDLA 1Y1CA 1LR7A 1TUSA 1TBQR 3QTLD 2KCXA 2SGFI 1M8CA 2P6AC 2BUSA 1OMTA 1TURA 1TBRR 1SGEI 4HGUA 2QQCA 2SGEI 2XRCA 1AN1I 1R0RI 2V53A 4OVOA 1BMOA 2NU1I 2NU3I 1H0ZA 1IY6A 2WCYA 1HJAI 3B4VC 4SGBI 1LR8A 1PCEA 3SGBI 1DS2I 1SGNI 1YU6C 1SGDI 2N17A 2JXDA 3SEKC 1TGSI 1CHOI 5JHWC 1OVOA 5DAEA 1IW4A 2KMOA 2ARPF 3TJQA 3OVOA 1FYBA 2B0UC 2SGPI 1IY5A 1CGJI 1OMUA 1CGII 1CT4I 1SGYI 2JYYA 1MT1A 2GKVA 2SGDI 2F3CI 4GI3C 1SGQI 2SGQI
chains in the Genus database with same CATH superfamily
2CJSC 1N13A 5HQ8A 3SGQI 1SGRI 2V1CA 1WGCA 1UVGA 1KMAA 2NU2I 3E59A 2UZ3A 1XX6A 1MJBA 2KMQA 2ELIA 1PJUA 4DNCA 3R5CA 3UEYA 3UFFA 2KMRA 1ULNA 2QQDA 2RC4A 2JZMA 4WP4A 5FUWA 3RU0A 4L9MA 2CWGA 3UGLA 2GKTI 2QQEA 1HPTA 1DS3I 2E5RA 2RIJA 1BUSA 1CSOI 1UUCA 2N71A 1CT2I 2N52A 1LR9A 2YQPA 2KMPA 1Z7KB 2ERWA 3UGIA 5EX0A 7WGAA 3R5BA 1SGPI 2OVOA 2OZUA 1UVFA 2DIPA 1NUBA 1Y8FA 3CXLA 2NU0I 5EX3A 1TIHA 1M8BA 1CT0I 3HH2C 3UGDA 2DKVA 4E1PA 2JW6A 2LEOA 1WGTA 1YTPA 2JA1A 1PPFI 4MPIA 2GKRI 2NU4I 2ODDA 2M5XA 2LUYA 3UOEA 5E3QA 1Y1BA 1WKXA 1OYVI 2K9HA 3VDUA 1CE3A 1HDLA 2E73A 5E3PA 2X3TA 1K7VA 1U5KA 4UXIA 1Q9BA 1V1HA 1R79A 4UXJA 4JCVE 3D00A 1Y1CA 5E3RA 1LR7A 1P9ZA 2YUUA 2ENNA 1TOTA 2Y0MA 5J8FA 1FAQA 1PTRA 2LB7A 3BJIA 1TUSA 1V1IA 1TBQR 3QTLD 2KCXA 2L7XA 2SGFI 1XA6A 1M8CA 2P6AC 2QQ0A 1K7UA 2N1AB 2BUSA 2GVIA 3OXGA 1OMTA 5CCLA 3TOAA 1TURA 2UVOA 2CWFA 3R5AA 1TBRR 1SGEI 2WVJA 2X52A 4HGUA 1S20A 2QQCA 2OD1A 1Z2IA 3TO6A 2SGEI 1ULMA 2XRCA 1AN1I 1R0RI 2V53A 3KY9A 4OVOA 1BMOA 2NU1I 1NXUA 2OU2A 2V1CC 2NU3I 3VDPA 5FUVA 2L8EA 2ENZA 2ORVA 3MEKA 3QAHA 1VDDA 3OXLA 1FY7A 1HEVA 5FUXA 1H0ZA 1X4SA 1KBEA 1IY6A 2WCYA 1HJAI 5HI7A 3B4VC 4SGBI 1XBTA 2DB6A 2VRWB 4FKDA 3TOBA 4AMLA 1LR8A 1PCEA 3SGBI 1DS2I 1RFHA 2W0TA 5FUYA 5J8CA 1PTQA 1SGNI 1YU6C 3FSYA 1ULKA 3VE5A 1SGDI 2N17A 2JXDA 2ORWA 3SEKC 3TO7A 2CWHA 1P9GA 1TGSI 1X74A 1CHOI 3TO9A 5CCMA 5JHWC 1KBFA 3E2IA 3GOXA 1MJ9A 2B8TA 3FC3A 1OVOA 2GIVA 3FSXA 3OL0A 5DAEA 1WTJA 1IW4A 2FNFX 1K7TA 2KMOA 2ARPF 4E1RA 3TJQA 2J9RA 3OVOA 3UEJA 1FYBA 2B0UC 2SGPI 4A24A 1IY5A 1CGJI 1OMUA 1CGII 1CT4I 1SGYI 2JYYA 2WGCA 1TBOA 3QWPA 1TBNA 1MT1A 2GKVA 2SGDI 3PDNA 2PQ8A 3R5DA 2F3CI 1W4RA 2A20A 2QPOA 9WGAA 1UHAA 4GI3C 1SGQI 2ROWA 4UXHA 1FARA 3OXFA 1W3SA 2SGQI 2J87A 1MJAA 4B6DA
chains in the Genus database with same CATH topology
2CJSC 1N13A 5HQ8A 3SGQI 1SGRI 2V1CA 1KMAA 1UVGA 2NU2I 3E59A 2UZ3A 1XX6A 2KMQA 2ELIA 1PJUA 3UEYA 3UFFA 2KMRA 2QQDA 5FUWA 2JZMA 3RU0A 4L9MA 3UGLA 2GKTI 2QQEA 1HPTA 1DS3I 2E5RA 1BUSA 1CSOI 1UUCA 2N71A 1CT2I 2N52A 1LR9A 2YQPA 2KMPA 1Z7KB 2ERWA 3UGIA 5EX0A 1SGPI 2OVOA 1UVFA 1NUBA 1Y8FA 3CXLA 2NU0I 5EX3A 1TIHA 1M8BA 1CT0I 3HH2C 3UGDA 4E1PA 2JW6A 2LEOA 1YTPA 2JA1A 1PPFI 2GKRI 2NU4I 2ODDA 2M5XA 2LUYA 1Y1BA 1OYVI 2K9HA 3VDUA 1CE3A 1HDLA 2E73A 4UXIA 1U5KA 1V1HA 1R79A 4UXJA 4JCVE 3D00A 1Y1CA 1LR7A 2YUUA 2ENNA 1TOTA 1FAQA 1PTRA 3BJIA 1TUSA 1V1IA 1TBQR 3QTLD 2KCXA 2L7XA 2SGFI 1XA6A 1M8CA 2P6AC 2QQ0A 2N1AB 2BUSA 2GVIA 3OXGA 1OMTA 5CCLA 1TURA 1TBRR 1SGEI 2WVJA 4HGUA 2QQCA 2OD1A 2SGEI 2XRCA 1AN1I 1R0RI 2V53A 3KY9A 4OVOA 1BMOA 2NU1I 2V1CC 2NU3I 3VDPA 5FUVA 2L8EA 2ENZA 2ORVA 3MEKA 1VDDA 3OXLA 5FUXA 1H0ZA 1X4SA 1KBEA 1IY6A 2WCYA 1HJAI 5HI7A 3B4VC 4SGBI 1XBTA 2DB6A 2VRWB 4FKDA 1LR8A 1PCEA 3SGBI 1DS2I 1RFHA 2W0TA 5FUYA 1PTQA 1SGNI 1YU6C 3VE5A 1SGDI 2N17A 2JXDA 2ORWA 3SEKC 1TGSI 1X74A 1CHOI 5CCMA 5JHWC 1KBFA 3E2IA 3GOXA 2B8TA 3FC3A 1OVOA 3OL0A 5DAEA 1IW4A 2FNFX 2KMOA 2ARPF 4E1RA 3TJQA 2J9RA 3OVOA 3UEJA 1FYBA 2B0UC 2SGPI 4A24A 1IY5A 1CGJI 1OMUA 1CGII 1CT4I 1SGYI 2JYYA 3QWPA 1TBOA 1TBNA 1MT1A 2GKVA 2SGDI 3PDNA 2F3CI 1W4RA 2A20A 2QPOA 4GI3C 1SGQI 2ROWA 4UXHA 1FARA 3OXFA 1W3SA 2SGQI 2J87A 2DIPA 4B6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N13 A;  3SGQ I;  1SGR I;  1KMA A;  1UVG A;  2NU2 I;  2KMQ A;  1PJU A;  2KMR A;  2QQD A;  2JZM A;  2GKT I;  1HPT A;  1DS3 I;  1BUS A;  1CSO I;  1UUC A;  2N71 A;  1CT2 I;  2N52 A;  1LR9 A;  2KMP A;  1Z7K B;  2ERW A;  1SGP I;  2OVO A;  1UVF A;  1NUB A;  2NU0 I;  1TIH A;  1CT0 I;  1M8B A;  3HH2 C;  2LEO A;  1YTP A;  1PPF I;  2GKR I;  2NU4 I;  2M5X A;  1Y1B A;  1OYV I;  1CE3 A;  1HDL A;  1Y1C A;  1LR7 A;  1TUS A;  1TBQ R;  3QTL D;  2KCX A;  2SGF I;  1M8C A;  2P6A C;  2BUS A;  1OMT A;  1TUR A;  1TBR R;  1SGE I;  4HGU A;  2QQC A;  2SGE I;  2XRC A;  1AN1 I;  1R0R I;  2V53 A;  4OVO A;  1BMO A;  2NU1 I;  2NU3 I;  1H0Z A;  1IY6 A;  2WCY A;  1HJA I;  3B4V C;  4SGB I;  1LR8 A;  1PCE A;  3SGB I;  1DS2 I;  1SGN I;  1YU6 C;  1SGD I;  2N17 A;  2JXD A;  3SEK C;  1TGS I;  1CHO I;  5JHW C;  1OVO A;  5DAE A;  1IW4 A;  2KMO A;  2ARP F;  3TJQ A;  3OVO A;  1FYB A;  2B0U C;  2SGP I;  1IY5 A;  1CGJ I;  1OMU A;  1CGI I;  1CT4 I;  1SGY I;  2JYY A;  1MT1 A;  2GKV A;  2SGD I;  2F3C I;  4GI3 C;  1SGQ I;  2SGQ I; 
#chains in the Genus database with same CATH topology
 2CJS C;  1N13 A;  5HQ8 A;  3SGQ I;  1SGR I;  2V1C A;  1WGC A;  1UVG A;  1KMA A;  2NU2 I;  3E59 A;  2UZ3 A;  1XX6 A;  1MJB A;  2KMQ A;  2ELI A;  1PJU A;  4DNC A;  3R5C A;  3UEY A;  3UFF A;  2KMR A;  1ULN A;  2QQD A;  2RC4 A;  2JZM A;  4WP4 A;  5FUW A;  3RU0 A;  4L9M A;  2CWG A;  3UGL A;  2GKT I;  2QQE A;  1HPT A;  1DS3 I;  2E5R A;  2RIJ A;  1BUS A;  1CSO I;  1UUC A;  2N71 A;  1CT2 I;  2N52 A;  1LR9 A;  2YQP A;  2KMP A;  1Z7K B;  2ERW A;  3UGI A;  5EX0 A;  7WGA A;  3R5B A;  1SGP I;  2OVO A;  2OZU A;  1UVF A;  2DIP A;  1NUB A;  1Y8F A;  3CXL A;  2NU0 I;  5EX3 A;  1TIH A;  1M8B A;  1CT0 I;  3HH2 C;  3UGD A;  2DKV A;  4E1P A;  2JW6 A;  2LEO A;  1WGT A;  1YTP A;  2JA1 A;  1PPF I;  4MPI A;  2GKR I;  2NU4 I;  2ODD A;  2M5X A;  2LUY A;  3UOE A;  5E3Q A;  1Y1B A;  1WKX A;  1OYV I;  2K9H A;  3VDU A;  1CE3 A;  1HDL A;  2E73 A;  5E3P A;  2X3T A;  1K7V A;  1U5K A;  4UXI A;  1Q9B A;  1V1H A;  1R79 A;  4UXJ A;  4JCV E;  3D00 A;  1Y1C A;  5E3R A;  1LR7 A;  1P9Z A;  2YUU A;  2ENN A;  1TOT A;  2Y0M A;  5J8F A;  1FAQ A;  1PTR A;  2LB7 A;  3BJI A;  1TUS A;  1V1I A;  1TBQ R;  3QTL D;  2KCX A;  2L7X A;  2SGF I;  1XA6 A;  1M8C A;  2P6A C;  2QQ0 A;  1K7U A;  2N1A B;  2BUS A;  2GVI A;  3OXG A;  1OMT A;  5CCL A;  3TOA A;  1TUR A;  2UVO A;  2CWF A;  3R5A A;  1TBR R;  1SGE I;  2WVJ A;  2X52 A;  4HGU A;  1S20 A;  2QQC A;  2OD1 A;  1Z2I A;  3TO6 A;  2SGE I;  1ULM A;  2XRC A;  1AN1 I;  1R0R I;  2V53 A;  3KY9 A;  4OVO A;  1BMO A;  2NU1 I;  1NXU A;  2OU2 A;  2V1C C;  2NU3 I;  3VDP A;  5FUV A;  2L8E A;  2ENZ A;  2ORV A;  3MEK A;  3QAH A;  1VDD A;  3OXL A;  1FY7 A;  1HEV A;  5FUX A;  1H0Z A;  1X4S A;  1KBE A;  1IY6 A;  2WCY A;  1HJA I;  5HI7 A;  3B4V C;  4SGB I;  1XBT A;  2DB6 A;  2VRW B;  4FKD A;  3TOB A;  4AML A;  1LR8 A;  1PCE A;  3SGB I;  1DS2 I;  1RFH A;  2W0T A;  5FUY A;  5J8C A;  1PTQ A;  1SGN I;  1YU6 C;  3FSY A;  1ULK A;  3VE5 A;  1SGD I;  2N17 A;  2JXD A;  2ORW A;  3SEK C;  3TO7 A;  2CWH A;  1P9G A;  1TGS I;  1X74 A;  1CHO I;  3TO9 A;  5CCM A;  5JHW C;  1KBF A;  3E2I A;  3GOX A;  1MJ9 A;  2B8T A;  3FC3 A;  1OVO A;  2GIV A;  3FSX A;  3OL0 A;  5DAE A;  1WTJ A;  1IW4 A;  2FNF X;  1K7T A;  2KMO A;  2ARP F;  4E1R A;  3TJQ A;  2J9R A;  3OVO A;  3UEJ A;  1FYB A;  2B0U C;  2SGP I;  4A24 A;  1IY5 A;  1CGJ I;  1OMU A;  1CGI I;  1CT4 I;  1SGY I;  2JYY A;  2WGC A;  1TBO A;  3QWP A;  1TBN A;  1MT1 A;  2GKV A;  2SGD I;  3PDN A;  2PQ8 A;  3R5D A;  2F3C I;  1W4R A;  2A20 A;  2QPO A;  9WGA A;  1UHA A;  4GI3 C;  1SGQ I;  2ROW A;  4UXH A;  1FAR A;  3OXF A;  1W3S A;  2SGQ I;  2J87 A;  1MJA A;  4B6D A; 
#chains in the Genus database with same CATH homology
 2CJS C;  1N13 A;  5HQ8 A;  3SGQ I;  1SGR I;  2V1C A;  1KMA A;  1UVG A;  2NU2 I;  3E59 A;  2UZ3 A;  1XX6 A;  2KMQ A;  2ELI A;  1PJU A;  3UEY A;  3UFF A;  2KMR A;  2QQD A;  5FUW A;  2JZM A;  3RU0 A;  4L9M A;  3UGL A;  2GKT I;  2QQE A;  1HPT A;  1DS3 I;  2E5R A;  1BUS A;  1CSO I;  1UUC A;  2N71 A;  1CT2 I;  2N52 A;  1LR9 A;  2YQP A;  2KMP A;  1Z7K B;  2ERW A;  3UGI A;  5EX0 A;  1SGP I;  2OVO A;  1UVF A;  1NUB A;  1Y8F A;  3CXL A;  2NU0 I;  5EX3 A;  1TIH A;  1M8B A;  1CT0 I;  3HH2 C;  3UGD A;  4E1P A;  2JW6 A;  2LEO A;  1YTP A;  2JA1 A;  1PPF I;  2GKR I;  2NU4 I;  2ODD A;  2M5X A;  2LUY A;  1Y1B A;  1OYV I;  2K9H A;  3VDU A;  1CE3 A;  1HDL A;  2E73 A;  4UXI A;  1U5K A;  1V1H A;  1R79 A;  4UXJ A;  4JCV E;  3D00 A;  1Y1C A;  1LR7 A;  2YUU A;  2ENN A;  1TOT A;  1FAQ A;  1PTR A;  3BJI A;  1TUS A;  1V1I A;  1TBQ R;  3QTL D;  2KCX A;  2L7X A;  2SGF I;  1XA6 A;  1M8C A;  2P6A C;  2QQ0 A;  2N1A B;  2BUS A;  2GVI A;  3OXG A;  1OMT A;  5CCL A;  1TUR A;  1TBR R;  1SGE I;  2WVJ A;  4HGU A;  2QQC A;  2OD1 A;  2SGE I;  2XRC A;  1AN1 I;  1R0R I;  2V53 A;  3KY9 A;  4OVO A;  1BMO A;  2NU1 I;  2V1C C;  2NU3 I;  3VDP A;  5FUV A;  2L8E A;  2ENZ A;  2ORV A;  3MEK A;  1VDD A;  3OXL A;  5FUX A;  1H0Z A;  1X4S A;  1KBE A;  1IY6 A;  2WCY A;  1HJA I;  5HI7 A;  3B4V C;  4SGB I;  1XBT A;  2DB6 A;  2VRW B;  4FKD A;  1LR8 A;  1PCE A;  3SGB I;  1DS2 I;  1RFH A;  2W0T A;  5FUY A;  1PTQ A;  1SGN I;  1YU6 C;  3VE5 A;  1SGD I;  2N17 A;  2JXD A;  2ORW A;  3SEK C;  1TGS I;  1X74 A;  1CHO I;  5CCM A;  5JHW C;  1KBF A;  3E2I A;  3GOX A;  2B8T A;  3FC3 A;  1OVO A;  3OL0 A;  5DAE A;  1IW4 A;  2FNF X;  2KMO A;  2ARP F;  4E1R A;  3TJQ A;  2J9R A;  3OVO A;  3UEJ A;  1FYB A;  2B0U C;  2SGP I;  4A24 A;  1IY5 A;  1CGJ I;  1OMU A;  1CGI I;  1CT4 I;  1SGY I;  2JYY A;  3QWP A;  1TBO A;  1TBN A;  1MT1 A;  2GKV A;  2SGD I;  3PDN A;  2F3C I;  1W4R A;  2A20 A;  2QPO A;  4GI3 C;  1SGQ I;  2ROW A;  4UXH A;  1FAR A;  3OXF A;  1W3S A;  2SGQ I;  2J87 A;  2DIP A;  4B6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...