3SGQI

Gln 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 10.7
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTQEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
molecule keywords Streptogrisin B
molecule tags Hydrolase/hydrolase inhibitor
source organism Meleagris gallopavo
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3sgqI00
2KCXA 1R0RI 1CE3A 1IW4A 1Z7KB 3HH2C 1HPTA 1M8CA 2KMRA 3SEKC 2B0UC 2OVOA 2SGDI 3SGQI 2QQCA 1IY6A 1BUSA 2KMPA 2KMQA 2NU2I 2NU1I 1PPFI 1CT0I 1SGPI 1OMTA 3B4VC 4GI3C 1CT4I 1PJUA 2NU0I 5JHWC 1TGSI 1KMAA 1LR9A 1SGRI 1SGEI 2NU4I 2KMOA 1H0ZA 2QQDA 2P6AC 2JZMA 2N71A 1YTPA 2F3CI 1CT2I 1SGDI 2WCYA 1CGJI 3TJQA 4HGUA 2GKVA 1YU6C 2BUSA 1Y1CA 1UVFA 5DAEA 1OVOA 1CHOI 2SGFI 1HJAI 1MT1A 1TUSA 2V53A 2M5XA 2SGQI 1OMUA 1HDLA 1LR8A 2SGPI 1LR7A 1SGNI 2XRCA 2N17A 1DS2I 3QTLD 1SGYI 1UUCA 4SGBI 2ERWA 1FYBA 1N13A 1NUBA 2SGEI 1TBQR 2JXDA 2JYYA 1SGQI 1IY5A 1OYVI 1AN1I 3OVOA 1TURA 1DS3I 1PCEA 1TIHA 2GKTI 2N52A 2ARPF 1TBRR 2GKRI 2LEOA 1CSOI 1M8BA 1BMOA 4OVOA 1CGII 2NU3I 3SGBI 1Y1BA 1UVGA
chains in the Genus database with same CATH superfamily
2KCXA 1PTRA 1MJAA 1R0RI 4A24A 1Z7KB 1IW4A 4JCVE 5E3PA 1CE3A 3HH2C 1PTQA 1HPTA 5J8CA 2WGCA 1K7UA 1M8CA 2OU2A 2KMRA 5CCLA 1Z2IA 3SEKC 2B0UC 1ULKA 3FSYA 1XX6A 2OVOA 5FUVA 3UOEA 2SGDI 1S20A 3SGQI 1U5KA 3KY9A 2QQCA 1IY6A 1BUSA 2KMPA 2KMQA 2NU2I 2NU1I 2ORVA 3OXLA 2ORWA 1PPFI 1CT0I 4FKDA 3UGDA 5HQ8A 1NXUA 2ENNA 7WGAA 2YUUA 3FSXA 1SGPI 1OMTA 2QQ0A 3B4VC 3QAHA 3OL0A 1WTJA 4GI3C 3UFFA 4UXHA 2YQPA 3VDPA 1FY7A 1CT4I 1PJUA 1X4SA 2NU0I 5FUWA 1TGSI 5JHWC 1KMAA 1FARA 2DKVA 2ELIA 2V1CA 3R5AA 3TO9A 2N1AB 1R79A 1KBFA 3UEYA 1LR9A 1MJBA 1TOTA 2DIPA 2PQ8A 1SGRI 2Y0MA 1SGEI 2J87A 1UHAA 2NU4I 2KMOA 2UZ3A 4DNCA 3UGLA 1H0ZA 2QQDA 2GVIA 2B8TA 1TBNA 2V1CC 1V1IA 2P6AC 2JZMA 2N71A 1YTPA 2F3CI 1CT2I 1RFHA 1SGDI 1ULNA 2CJSC 4E1RA 2LB7A 1P9ZA 2JW6A 2WCYA 2ODDA 1CGJI 1V1HA 2A20A 3UEJA 3TJQA 5J8FA 2RIJA 1Q9BA 4HGUA 2RC4A 1XA6A 3R5DA 4AMLA 5EX3A 2GKVA 3D00A 1YU6C 2BUSA 1WGCA 3FC3A 1W4RA 5FUYA 1MJ9A 1Y1CA 1UVFA 5DAEA 1OVOA 1KBEA 1CHOI 3R5BA 2FNFX 2SGFI 4E1PA 2GIVA 2OD1A 3E59A 1HJAI 3OXGA 1MT1A 1TUSA 2K9HA 3UGIA 1VDDA 1WKXA 2DB6A 2V53A 2M5XA 2SGQI 1OMUA 2X3TA 2CWGA 3OXFA 1LR8A 2CWFA 2SGPI 5FUXA 1HDLA 1Y8FA 2ENZA 2CWHA 1WGTA 2E73A 3BJIA 1LR7A 1SGNI 3E2IA 2XRCA 2N17A 1DS2I 3TOAA 3QTLD 3RU0A 1SGYI 4UXIA 1UUCA 2L8EA 4SGBI 2ERWA 1FYBA 2OZUA 1K7VA 3TOBA 2JA1A 2LUYA 1N13A 1NUBA 5EX0A 2QPOA 2W0TA 2E5RA 2SGEI 3TO7A 2L7XA 1TBQR 4UXJA 5E3QA 4B6DA 3GOXA 2JXDA 2WVJA 2JYYA 4L9MA 2X52A 1SGQI 1X74A 1K7TA 1IY5A 2J9RA 1OYVI 2ROWA 1AN1I 3OVOA 5E3RA 2QQEA 3VDUA 1TURA 1DS3I 1PCEA 1ULMA 3MEKA 1TIHA 2VRWB 1P9GA 3CXLA 2GKTI 3PDNA 5CCMA 3QWPA 3TO6A 1FAQA 2N52A 2ARPF 4MPIA 1TBRR 4WP4A 2GKRI 2UVOA 2LEOA 5HI7A 1CSOI 1M8BA 1BMOA 1TBOA 3R5CA 4OVOA 1HEVA 3VE5A 9WGAA 1CGII 2NU3I 3SGBI 1XBTA 1Y1BA 1W3SA 1UVGA
chains in the Genus database with same CATH topology
2KCXA 1PTRA 1R0RI 1CE3A 4A24A 1Z7KB 1IW4A 4JCVE 3HH2C 1PTQA 1HPTA 1M8CA 2KMRA 5CCLA 3SEKC 2B0UC 1XX6A 2OVOA 5FUVA 2SGDI 3SGQI 1U5KA 3KY9A 2QQCA 1IY6A 1BUSA 2KMPA 2KMQA 2NU2I 2NU1I 2ORVA 3OXLA 2ORWA 1PPFI 1CT0I 4FKDA 3UGDA 5HQ8A 2ENNA 2YUUA 1SGPI 1OMTA 2QQ0A 3B4VC 4GI3C 3OL0A 3UFFA 4UXHA 2YQPA 3VDPA 1CT4I 1PJUA 1X4SA 2NU0I 5FUWA 1TGSI 5JHWC 1KMAA 1FARA 2V1CA 2ELIA 2N1AB 1R79A 1KBFA 3UEYA 1LR9A 1TOTA 2DIPA 1SGRI 1SGEI 2J87A 2NU4I 2KMOA 2UZ3A 1H0ZA 3UGLA 2QQDA 2GVIA 2B8TA 1TBNA 2V1CC 1V1IA 2P6AC 2JZMA 2N71A 1YTPA 2F3CI 1CT2I 1RFHA 1SGDI 2CJSC 4E1RA 2JW6A 2WCYA 2ODDA 1CGJI 1V1HA 2A20A 3UEJA 3TJQA 4HGUA 1XA6A 5EX3A 2GKVA 3D00A 1YU6C 2BUSA 3FC3A 1W4RA 5FUYA 1Y1CA 1UVFA 5DAEA 1OVOA 1KBEA 1CHOI 4E1PA 2FNFX 2SGFI 2OD1A 3E59A 1HJAI 3OXGA 1MT1A 1TUSA 2K9HA 3UGIA 1VDDA 2DB6A 2V53A 2M5XA 2SGQI 1OMUA 4B6DA 3OXFA 5FUXA 1LR8A 2SGPI 1HDLA 1Y8FA 2ENZA 2E73A 3BJIA 1LR7A 1SGNI 3E2IA 2XRCA 2N17A 1DS2I 3QTLD 3RU0A 1SGYI 4UXIA 1UUCA 2L8EA 4SGBI 2ERWA 1FYBA 2JA1A 2LUYA 1N13A 1NUBA 5EX0A 2QPOA 2W0TA 2E5RA 2SGEI 2L7XA 1TBQR 4UXJA 3GOXA 2JXDA 2WVJA 2JYYA 4L9MA 1SGQI 1X74A 1IY5A 2J9RA 1OYVI 2ROWA 1AN1I 3OVOA 3VDUA 2QQEA 1TURA 1DS3I 1PCEA 3MEKA 1TIHA 2VRWB 3CXLA 2GKTI 3PDNA 5CCMA 3QWPA 1FAQA 2N52A 2ARPF 1TBRR 2GKRI 2LEOA 5HI7A 1CSOI 1M8BA 1BMOA 1TBOA 4OVOA 3VE5A 1CGII 2NU3I 3SGBI 1XBTA 1Y1BA 1W3SA 1UVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCX A;  1R0R I;  1CE3 A;  1IW4 A;  1Z7K B;  3HH2 C;  1HPT A;  1M8C A;  2KMR A;  3SEK C;  2B0U C;  2OVO A;  2SGD I;  3SGQ I;  2QQC A;  1IY6 A;  1BUS A;  2KMP A;  2KMQ A;  2NU2 I;  2NU1 I;  1PPF I;  1CT0 I;  1SGP I;  1OMT A;  3B4V C;  4GI3 C;  1CT4 I;  1PJU A;  2NU0 I;  5JHW C;  1TGS I;  1KMA A;  1LR9 A;  1SGR I;  1SGE I;  2NU4 I;  2KMO A;  1H0Z A;  2QQD A;  2P6A C;  2JZM A;  2N71 A;  1YTP A;  2F3C I;  1CT2 I;  1SGD I;  2WCY A;  1CGJ I;  3TJQ A;  4HGU A;  2GKV A;  1YU6 C;  2BUS A;  1Y1C A;  1UVF A;  5DAE A;  1OVO A;  1CHO I;  2SGF I;  1HJA I;  1MT1 A;  1TUS A;  2V53 A;  2M5X A;  2SGQ I;  1OMU A;  1HDL A;  1LR8 A;  2SGP I;  1LR7 A;  1SGN I;  2XRC A;  2N17 A;  1DS2 I;  3QTL D;  1SGY I;  1UUC A;  4SGB I;  2ERW A;  1FYB A;  1N13 A;  1NUB A;  2SGE I;  1TBQ R;  2JXD A;  2JYY A;  1SGQ I;  1IY5 A;  1OYV I;  1AN1 I;  3OVO A;  1TUR A;  1DS3 I;  1PCE A;  1TIH A;  2GKT I;  2N52 A;  2ARP F;  1TBR R;  2GKR I;  2LEO A;  1CSO I;  1M8B A;  1BMO A;  4OVO A;  1CGI I;  2NU3 I;  3SGB I;  1Y1B A;  1UVG A; 
#chains in the Genus database with same CATH topology
 2KCX A;  1PTR A;  1MJA A;  1R0R I;  4A24 A;  1Z7K B;  1IW4 A;  4JCV E;  5E3P A;  1CE3 A;  3HH2 C;  1PTQ A;  1HPT A;  5J8C A;  2WGC A;  1K7U A;  1M8C A;  2OU2 A;  2KMR A;  5CCL A;  1Z2I A;  3SEK C;  2B0U C;  1ULK A;  3FSY A;  1XX6 A;  2OVO A;  5FUV A;  3UOE A;  2SGD I;  1S20 A;  3SGQ I;  1U5K A;  3KY9 A;  2QQC A;  1IY6 A;  1BUS A;  2KMP A;  2KMQ A;  2NU2 I;  2NU1 I;  2ORV A;  3OXL A;  2ORW A;  1PPF I;  1CT0 I;  4FKD A;  3UGD A;  5HQ8 A;  1NXU A;  2ENN A;  7WGA A;  2YUU A;  3FSX A;  1SGP I;  1OMT A;  2QQ0 A;  3B4V C;  3QAH A;  3OL0 A;  1WTJ A;  4GI3 C;  3UFF A;  4UXH A;  2YQP A;  3VDP A;  1FY7 A;  1CT4 I;  1PJU A;  1X4S A;  2NU0 I;  5FUW A;  1TGS I;  5JHW C;  1KMA A;  1FAR A;  2DKV A;  2ELI A;  2V1C A;  3R5A A;  3TO9 A;  2N1A B;  1R79 A;  1KBF A;  3UEY A;  1LR9 A;  1MJB A;  1TOT A;  2DIP A;  2PQ8 A;  1SGR I;  2Y0M A;  1SGE I;  2J87 A;  1UHA A;  2NU4 I;  2KMO A;  2UZ3 A;  4DNC A;  3UGL A;  1H0Z A;  2QQD A;  2GVI A;  2B8T A;  1TBN A;  2V1C C;  1V1I A;  2P6A C;  2JZM A;  2N71 A;  1YTP A;  2F3C I;  1CT2 I;  1RFH A;  1SGD I;  1ULN A;  2CJS C;  4E1R A;  2LB7 A;  1P9Z A;  2JW6 A;  2WCY A;  2ODD A;  1CGJ I;  1V1H A;  2A20 A;  3UEJ A;  3TJQ A;  5J8F A;  2RIJ A;  1Q9B A;  4HGU A;  2RC4 A;  1XA6 A;  3R5D A;  4AML A;  5EX3 A;  2GKV A;  3D00 A;  1YU6 C;  2BUS A;  1WGC A;  3FC3 A;  1W4R A;  5FUY A;  1MJ9 A;  1Y1C A;  1UVF A;  5DAE A;  1OVO A;  1KBE A;  1CHO I;  3R5B A;  2FNF X;  2SGF I;  4E1P A;  2GIV A;  2OD1 A;  3E59 A;  1HJA I;  3OXG A;  1MT1 A;  1TUS A;  2K9H A;  3UGI A;  1VDD A;  1WKX A;  2DB6 A;  2V53 A;  2M5X A;  2SGQ I;  1OMU A;  2X3T A;  2CWG A;  3OXF A;  1LR8 A;  2CWF A;  2SGP I;  5FUX A;  1HDL A;  1Y8F A;  2ENZ A;  2CWH A;  1WGT A;  2E73 A;  3BJI A;  1LR7 A;  1SGN I;  3E2I A;  2XRC A;  2N17 A;  1DS2 I;  3TOA A;  3QTL D;  3RU0 A;  1SGY I;  4UXI A;  1UUC A;  2L8E A;  4SGB I;  2ERW A;  1FYB A;  2OZU A;  1K7V A;  3TOB A;  2JA1 A;  2LUY A;  1N13 A;  1NUB A;  5EX0 A;  2QPO A;  2W0T A;  2E5R A;  2SGE I;  3TO7 A;  2L7X A;  1TBQ R;  4UXJ A;  5E3Q A;  4B6D A;  3GOX A;  2JXD A;  2WVJ A;  2JYY A;  4L9M A;  2X52 A;  1SGQ I;  1X74 A;  1K7T A;  1IY5 A;  2J9R A;  1OYV I;  2ROW A;  1AN1 I;  3OVO A;  5E3R A;  2QQE A;  3VDU A;  1TUR A;  1DS3 I;  1PCE A;  1ULM A;  3MEK A;  1TIH A;  2VRW B;  1P9G A;  3CXL A;  2GKT I;  3PDN A;  5CCM A;  3QWP A;  3TO6 A;  1FAQ A;  2N52 A;  2ARP F;  4MPI A;  1TBR R;  4WP4 A;  2GKR I;  2UVO A;  2LEO A;  5HI7 A;  1CSO I;  1M8B A;  1BMO A;  1TBO A;  3R5C A;  4OVO A;  1HEV A;  3VE5 A;  9WGA A;  1CGI I;  2NU3 I;  3SGB I;  1XBT A;  1Y1B A;  1W3S A;  1UVG A; 
#chains in the Genus database with same CATH homology
 2KCX A;  1PTR A;  1R0R I;  1CE3 A;  4A24 A;  1Z7K B;  1IW4 A;  4JCV E;  3HH2 C;  1PTQ A;  1HPT A;  1M8C A;  2KMR A;  5CCL A;  3SEK C;  2B0U C;  1XX6 A;  2OVO A;  5FUV A;  2SGD I;  3SGQ I;  1U5K A;  3KY9 A;  2QQC A;  1IY6 A;  1BUS A;  2KMP A;  2KMQ A;  2NU2 I;  2NU1 I;  2ORV A;  3OXL A;  2ORW A;  1PPF I;  1CT0 I;  4FKD A;  3UGD A;  5HQ8 A;  2ENN A;  2YUU A;  1SGP I;  1OMT A;  2QQ0 A;  3B4V C;  4GI3 C;  3OL0 A;  3UFF A;  4UXH A;  2YQP A;  3VDP A;  1CT4 I;  1PJU A;  1X4S A;  2NU0 I;  5FUW A;  1TGS I;  5JHW C;  1KMA A;  1FAR A;  2V1C A;  2ELI A;  2N1A B;  1R79 A;  1KBF A;  3UEY A;  1LR9 A;  1TOT A;  2DIP A;  1SGR I;  1SGE I;  2J87 A;  2NU4 I;  2KMO A;  2UZ3 A;  1H0Z A;  3UGL A;  2QQD A;  2GVI A;  2B8T A;  1TBN A;  2V1C C;  1V1I A;  2P6A C;  2JZM A;  2N71 A;  1YTP A;  2F3C I;  1CT2 I;  1RFH A;  1SGD I;  2CJS C;  4E1R A;  2JW6 A;  2WCY A;  2ODD A;  1CGJ I;  1V1H A;  2A20 A;  3UEJ A;  3TJQ A;  4HGU A;  1XA6 A;  5EX3 A;  2GKV A;  3D00 A;  1YU6 C;  2BUS A;  3FC3 A;  1W4R A;  5FUY A;  1Y1C A;  1UVF A;  5DAE A;  1OVO A;  1KBE A;  1CHO I;  4E1P A;  2FNF X;  2SGF I;  2OD1 A;  3E59 A;  1HJA I;  3OXG A;  1MT1 A;  1TUS A;  2K9H A;  3UGI A;  1VDD A;  2DB6 A;  2V53 A;  2M5X A;  2SGQ I;  1OMU A;  4B6D A;  3OXF A;  5FUX A;  1LR8 A;  2SGP I;  1HDL A;  1Y8F A;  2ENZ A;  2E73 A;  3BJI A;  1LR7 A;  1SGN I;  3E2I A;  2XRC A;  2N17 A;  1DS2 I;  3QTL D;  3RU0 A;  1SGY I;  4UXI A;  1UUC A;  2L8E A;  4SGB I;  2ERW A;  1FYB A;  2JA1 A;  2LUY A;  1N13 A;  1NUB A;  5EX0 A;  2QPO A;  2W0T A;  2E5R A;  2SGE I;  2L7X A;  1TBQ R;  4UXJ A;  3GOX A;  2JXD A;  2WVJ A;  2JYY A;  4L9M A;  1SGQ I;  1X74 A;  1IY5 A;  2J9R A;  1OYV I;  2ROW A;  1AN1 I;  3OVO A;  3VDU A;  2QQE A;  1TUR A;  1DS3 I;  1PCE A;  3MEK A;  1TIH A;  2VRW B;  3CXL A;  2GKT I;  3PDN A;  5CCM A;  3QWP A;  1FAQ A;  2N52 A;  2ARP F;  1TBR R;  2GKR I;  2LEO A;  5HI7 A;  1CSO I;  1M8B A;  1BMO A;  1TBO A;  4OVO A;  3VE5 A;  1CGI I;  2NU3 I;  3SGB I;  1XBT A;  1Y1B A;  1W3S A;  1UVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...