3SGQI

Gln 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 10.7
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTQEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Streptogrisin B
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3sgqI00
2QQDA 2NU3I 2B0UC 2SGPI 2KMOA 4SGBI 3SEKC 2N52A 1TIHA 1SGEI 2F3CI 2OVOA 2GKRI 1IY5A 2KMRA 1CT0I 1IW4A 3HH2C 1MT1A 1HDLA 2V53A 1TURA 1CE3A 2WCYA 4GI3C 2N17A 1TBQR 1OVOA 2SGEI 1PJUA 2QQCA 1SGNI 2P6AC 2LEOA 1M8CA 3OVOA 5JHWC 1UVFA 2N71A 2BUSA 1Y1BA 3SGBI 3B4VC 5DAEA 1CT2I 1OYVI 1PPFI 1SGPI 1SGQI 2XRCA 1UUCA 1CGJI 1KMAA 4OVOA 2SGDI 2JYYA 1CSOI 2KMPA 1NUBA 1SGRI 1CT4I 2KMQA 2JXDA 1TGSI 2JZMA 3SGQI 2NU1I 1PCEA 3TJQA 2ERWA 1BUSA 2GKVA 1SGYI 2GKTI 1TBRR 2SGQI 1UVGA 2NU2I 1HJAI 1R0RI 1DS2I 4HGUA 1IY6A 1LR7A 1CHOI 1FYBA 1SGDI 1YU6C 1TUSA 3QTLD 1OMTA 1HPTA 2KCXA 1Y1CA 1Z7KB 2ARPF 1BMOA 2NU4I 1M8BA 1LR8A 2SGFI 1OMUA 1DS3I 1H0ZA 2M5XA 1AN1I 1LR9A 1YTPA 2NU0I 1CGII 1N13A
chains in the Genus database with same CATH superfamily
2QQDA 2NU3I 4L9MA 2B0UC 2RIJA 1P9GA 1KMAA 2DIPA 1VDDA 2RC4A 4FKDA 2SGPI 2JW6A 2KMOA 4SGBI 3MEKA 3SEKC 1PTRA 3VDUA 2DKVA 3UGDA 3UEJA 1U5KA 2N52A 4E1PA 1TIHA 5HQ8A 1SGEI 2F3CI 2OVOA 2GKRI 1IY5A 2KMRA 4UXHA 1CT0I 1MJBA 2JA1A 2WVJA 2V1CC 1IW4A 1XBTA 3HH2C 1MT1A 2WGCA 3E2IA 1HDLA 2CWFA 2W0TA 2V53A 1TURA 2E5RA 1CE3A 1KBFA 1V1IA 2WCYA 4GI3C 2UZ3A 1V1HA 2N17A 5CCMA 1TBQR 1WTJA 1OVOA 2SGEI 1PJUA 2QQCA 2YQPA 3OXGA 1SGNI 3BJIA 3VDPA 2L7XA 2P6AC 4UXJA 1FARA 2LEOA 2ODDA 1M8CA 1X74A 3OVOA 3UEYA 1UVFA 2N71A 1WKXA 5JHWC 2BUSA 1ULNA 1HEVA 2CJSC 5HI7A 1FY7A 2ORVA 4WP4A 1Y1BA 1XX6A 2QQ0A 3SGBI 3TO9A 1FAQA 2L8EA 2Y0MA 3B4VC 5DAEA 1CT2I 2VRWB 1OYVI 1PPFI 1SGPI 1SGQI 2XRCA 2N1AB 3PDNA 1S20A 3UGLA 4A24A 1UUCA 1KBEA 1CGJI 1W4RA 3OXLA 9WGAA 4OVOA 2PQ8A 3R5AA 2V1CA 3E59A 2UVOA 3VE5A 4AMLA 4B6DA 1UHAA 2E73A 2SGDI 2ELIA 2JYYA 1TBOA 1CSOI 2KMPA 1ULMA 2OD1A 3D00A 4UXIA 1NUBA 1SGRI 3OXFA 1CT4I 3GOXA 2KMQA 2ORWA 2J9RA 5EX0A 1NXUA 1TOTA 5E3RA 5FUXA 2JXDA 1TGSI 1MJAA 2JZMA 1PTQA 2K9HA 2YUUA 5EX3A 3SGQI 1WGTA 5J8FA 2NU1I 5J8CA 1RFHA 2ROWA 3KY9A 1PCEA 3OL0A 4E1RA 3R5CA 1ULKA 3TO7A 3TJQA 2ERWA 3CXLA 5E3QA 2GVIA 5FUWA 1BUSA 3FC3A 2GIVA 1TBNA 1R79A 2GKVA 1SGYI 2B8TA 2GKTI 5FUYA 1TBRR 2SGQI 1UVGA 2NU2I 1K7VA 1HJAI 1R0RI 1DS2I 2CWHA 4DNCA 3FSYA 4HGUA 1IY6A 7WGAA 4JCVE 1LR7A 1CHOI 4MPIA 3TOAA 1FYBA 2X52A 1SGDI 1YU6C 3TOBA 3UGIA 1K7UA 2QQEA 1W3SA 1Q9BA 1TUSA 3QTLD 3TO6A 1MJ9A 1OMTA 1HPTA 1WGCA 2LUYA 3UOEA 2KCXA 2J87A 1Y1CA 3R5BA 2OZUA 3QAHA 2QPOA 5CCLA 1Y8FA 1Z7KB 2ARPF 2DB6A 1K7TA 2ENNA 5FUVA 3FSXA 1BMOA 2NU4I 2FNFX 3RU0A 1M8BA 2X3TA 1LR8A 2SGFI 1OMUA 1Z2IA 2LB7A 3UFFA 1DS3I 1H0ZA 2M5XA 1AN1I 1LR9A 1P9ZA 1X4SA 3R5DA 1YTPA 2ENZA 1CGII 2NU0I 3QWPA 2A20A 2CWGA 1N13A 5E3PA 1XA6A 2OU2A
chains in the Genus database with same CATH topology
2QQDA 2NU3I 4L9MA 2B0UC 2DIPA 1VDDA 4FKDA 2SGPI 2JW6A 2KMOA 4SGBI 3MEKA 3SEKC 1PTRA 3VDUA 3UGDA 3UEJA 1U5KA 2N52A 4E1PA 1TIHA 5HQ8A 1SGEI 2F3CI 2OVOA 2GKRI 1IY5A 2KMRA 4UXHA 1CT0I 2JA1A 2WVJA 2V1CC 1IW4A 1XBTA 3HH2C 1MT1A 3E2IA 1HDLA 2W0TA 2V53A 1TURA 2E5RA 1CE3A 1KBFA 1V1IA 2WCYA 4GI3C 2UZ3A 1V1HA 2N17A 5CCMA 1TBQR 1OVOA 2SGEI 1PJUA 2QQCA 2YQPA 3OXGA 1SGNI 3BJIA 3VDPA 2L7XA 2P6AC 4UXJA 1FARA 2LEOA 2ODDA 1M8CA 1X74A 3OVOA 3UEYA 1UVFA 2N71A 5JHWC 2BUSA 2CJSC 5HI7A 2ORVA 1Y1BA 1XX6A 2QQ0A 3SGBI 1FAQA 2L8EA 3B4VC 5DAEA 1CT2I 2VRWB 1OYVI 1PPFI 1SGPI 1SGQI 2XRCA 2N1AB 3PDNA 3UGLA 4A24A 1UUCA 1KBEA 1CGJI 1W4RA 3OXLA 1KMAA 4OVOA 3VE5A 2V1CA 3E59A 4B6DA 2E73A 2SGDI 2ELIA 2JYYA 1TBOA 1CSOI 2KMPA 2OD1A 3D00A 4UXIA 1NUBA 1SGRI 3OXFA 1CT4I 3GOXA 2KMQA 2ORWA 2J9RA 5EX0A 1TOTA 5FUXA 2JXDA 1TGSI 2JZMA 2K9HA 1PTQA 2YUUA 5EX3A 3SGQI 2NU1I 1RFHA 2ROWA 3KY9A 1PCEA 3OL0A 4E1RA 3TJQA 2ERWA 3CXLA 5FUWA 2GVIA 1BUSA 3FC3A 1TBNA 1R79A 2GKVA 1SGYI 2B8TA 2GKTI 5FUYA 1TBRR 2SGQI 1UVGA 2NU2I 1HJAI 1R0RI 1DS2I 4HGUA 1IY6A 4JCVE 1LR7A 1CHOI 1FYBA 1SGDI 1YU6C 3UGIA 2QQEA 1W3SA 1TUSA 3QTLD 1OMTA 1HPTA 2LUYA 2KCXA 2J87A 1Y1CA 2QPOA 5CCLA 1Y8FA 1Z7KB 2ARPF 2DB6A 2ENNA 5FUVA 1BMOA 2NU4I 2FNFX 3RU0A 1M8BA 1LR8A 2SGFI 1OMUA 3UFFA 1DS3I 1H0ZA 2M5XA 1AN1I 1LR9A 1X4SA 1YTPA 2ENZA 1CGII 2NU0I 3QWPA 2A20A 1N13A 1XA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQD A;  2NU3 I;  2B0U C;  2SGP I;  2KMO A;  4SGB I;  3SEK C;  2N52 A;  1TIH A;  1SGE I;  2F3C I;  2OVO A;  2GKR I;  1IY5 A;  2KMR A;  1CT0 I;  1IW4 A;  3HH2 C;  1MT1 A;  1HDL A;  2V53 A;  1TUR A;  1CE3 A;  2WCY A;  4GI3 C;  2N17 A;  1TBQ R;  1OVO A;  2SGE I;  1PJU A;  2QQC A;  1SGN I;  2P6A C;  2LEO A;  1M8C A;  3OVO A;  5JHW C;  1UVF A;  2N71 A;  2BUS A;  1Y1B A;  3SGB I;  3B4V C;  5DAE A;  1CT2 I;  1OYV I;  1PPF I;  1SGP I;  1SGQ I;  2XRC A;  1UUC A;  1CGJ I;  1KMA A;  4OVO A;  2SGD I;  2JYY A;  1CSO I;  2KMP A;  1NUB A;  1SGR I;  1CT4 I;  2KMQ A;  2JXD A;  1TGS I;  2JZM A;  3SGQ I;  2NU1 I;  1PCE A;  3TJQ A;  2ERW A;  1BUS A;  2GKV A;  1SGY I;  2GKT I;  1TBR R;  2SGQ I;  1UVG A;  2NU2 I;  1HJA I;  1R0R I;  1DS2 I;  4HGU A;  1IY6 A;  1LR7 A;  1CHO I;  1FYB A;  1SGD I;  1YU6 C;  1TUS A;  3QTL D;  1OMT A;  1HPT A;  2KCX A;  1Y1C A;  1Z7K B;  2ARP F;  1BMO A;  2NU4 I;  1M8B A;  1LR8 A;  2SGF I;  1OMU A;  1DS3 I;  1H0Z A;  2M5X A;  1AN1 I;  1LR9 A;  1YTP A;  2NU0 I;  1CGI I;  1N13 A; 
#chains in the Genus database with same CATH topology
 2QQD A;  2NU3 I;  4L9M A;  2B0U C;  2RIJ A;  1P9G A;  1KMA A;  2DIP A;  1VDD A;  2RC4 A;  4FKD A;  2SGP I;  2JW6 A;  2KMO A;  4SGB I;  3MEK A;  3SEK C;  1PTR A;  3VDU A;  2DKV A;  3UGD A;  3UEJ A;  1U5K A;  2N52 A;  4E1P A;  1TIH A;  5HQ8 A;  1SGE I;  2F3C I;  2OVO A;  2GKR I;  1IY5 A;  2KMR A;  4UXH A;  1CT0 I;  1MJB A;  2JA1 A;  2WVJ A;  2V1C C;  1IW4 A;  1XBT A;  3HH2 C;  1MT1 A;  2WGC A;  3E2I A;  1HDL A;  2CWF A;  2W0T A;  2V53 A;  1TUR A;  2E5R A;  1CE3 A;  1KBF A;  1V1I A;  2WCY A;  4GI3 C;  2UZ3 A;  1V1H A;  2N17 A;  5CCM A;  1TBQ R;  1WTJ A;  1OVO A;  2SGE I;  1PJU A;  2QQC A;  2YQP A;  3OXG A;  1SGN I;  3BJI A;  3VDP A;  2L7X A;  2P6A C;  4UXJ A;  1FAR A;  2LEO A;  2ODD A;  1M8C A;  1X74 A;  3OVO A;  3UEY A;  1UVF A;  2N71 A;  1WKX A;  5JHW C;  2BUS A;  1ULN A;  1HEV A;  2CJS C;  5HI7 A;  1FY7 A;  2ORV A;  4WP4 A;  1Y1B A;  1XX6 A;  2QQ0 A;  3SGB I;  3TO9 A;  1FAQ A;  2L8E A;  2Y0M A;  3B4V C;  5DAE A;  1CT2 I;  2VRW B;  1OYV I;  1PPF I;  1SGP I;  1SGQ I;  2XRC A;  2N1A B;  3PDN A;  1S20 A;  3UGL A;  4A24 A;  1UUC A;  1KBE A;  1CGJ I;  1W4R A;  3OXL A;  9WGA A;  4OVO A;  2PQ8 A;  3R5A A;  2V1C A;  3E59 A;  2UVO A;  3VE5 A;  4AML A;  4B6D A;  1UHA A;  2E73 A;  2SGD I;  2ELI A;  2JYY A;  1TBO A;  1CSO I;  2KMP A;  1ULM A;  2OD1 A;  3D00 A;  4UXI A;  1NUB A;  1SGR I;  3OXF A;  1CT4 I;  3GOX A;  2KMQ A;  2ORW A;  2J9R A;  5EX0 A;  1NXU A;  1TOT A;  5E3R A;  5FUX A;  2JXD A;  1TGS I;  1MJA A;  2JZM A;  1PTQ A;  2K9H A;  2YUU A;  5EX3 A;  3SGQ I;  1WGT A;  5J8F A;  2NU1 I;  5J8C A;  1RFH A;  2ROW A;  3KY9 A;  1PCE A;  3OL0 A;  4E1R A;  3R5C A;  1ULK A;  3TO7 A;  3TJQ A;  2ERW A;  3CXL A;  5E3Q A;  2GVI A;  5FUW A;  1BUS A;  3FC3 A;  2GIV A;  1TBN A;  1R79 A;  2GKV A;  1SGY I;  2B8T A;  2GKT I;  5FUY A;  1TBR R;  2SGQ I;  1UVG A;  2NU2 I;  1K7V A;  1HJA I;  1R0R I;  1DS2 I;  2CWH A;  4DNC A;  3FSY A;  4HGU A;  1IY6 A;  7WGA A;  4JCV E;  1LR7 A;  1CHO I;  4MPI A;  3TOA A;  1FYB A;  2X52 A;  1SGD I;  1YU6 C;  3TOB A;  3UGI A;  1K7U A;  2QQE A;  1W3S A;  1Q9B A;  1TUS A;  3QTL D;  3TO6 A;  1MJ9 A;  1OMT A;  1HPT A;  1WGC A;  2LUY A;  3UOE A;  2KCX A;  2J87 A;  1Y1C A;  3R5B A;  2OZU A;  3QAH A;  2QPO A;  5CCL A;  1Y8F A;  1Z7K B;  2ARP F;  2DB6 A;  1K7T A;  2ENN A;  5FUV A;  3FSX A;  1BMO A;  2NU4 I;  2FNF X;  3RU0 A;  1M8B A;  2X3T A;  1LR8 A;  2SGF I;  1OMU A;  1Z2I A;  2LB7 A;  3UFF A;  1DS3 I;  1H0Z A;  2M5X A;  1AN1 I;  1LR9 A;  1P9Z A;  1X4S A;  3R5D A;  1YTP A;  2ENZ A;  1CGI I;  2NU0 I;  3QWP A;  2A20 A;  2CWG A;  1N13 A;  5E3P A;  1XA6 A;  2OU2 A; 
#chains in the Genus database with same CATH homology
 2QQD A;  2NU3 I;  4L9M A;  2B0U C;  2DIP A;  1VDD A;  4FKD A;  2SGP I;  2JW6 A;  2KMO A;  4SGB I;  3MEK A;  3SEK C;  1PTR A;  3VDU A;  3UGD A;  3UEJ A;  1U5K A;  2N52 A;  4E1P A;  1TIH A;  5HQ8 A;  1SGE I;  2F3C I;  2OVO A;  2GKR I;  1IY5 A;  2KMR A;  4UXH A;  1CT0 I;  2JA1 A;  2WVJ A;  2V1C C;  1IW4 A;  1XBT A;  3HH2 C;  1MT1 A;  3E2I A;  1HDL A;  2W0T A;  2V53 A;  1TUR A;  2E5R A;  1CE3 A;  1KBF A;  1V1I A;  2WCY A;  4GI3 C;  2UZ3 A;  1V1H A;  2N17 A;  5CCM A;  1TBQ R;  1OVO A;  2SGE I;  1PJU A;  2QQC A;  2YQP A;  3OXG A;  1SGN I;  3BJI A;  3VDP A;  2L7X A;  2P6A C;  4UXJ A;  1FAR A;  2LEO A;  2ODD A;  1M8C A;  1X74 A;  3OVO A;  3UEY A;  1UVF A;  2N71 A;  5JHW C;  2BUS A;  2CJS C;  5HI7 A;  2ORV A;  1Y1B A;  1XX6 A;  2QQ0 A;  3SGB I;  1FAQ A;  2L8E A;  3B4V C;  5DAE A;  1CT2 I;  2VRW B;  1OYV I;  1PPF I;  1SGP I;  1SGQ I;  2XRC A;  2N1A B;  3PDN A;  3UGL A;  4A24 A;  1UUC A;  1KBE A;  1CGJ I;  1W4R A;  3OXL A;  1KMA A;  4OVO A;  3VE5 A;  2V1C A;  3E59 A;  4B6D A;  2E73 A;  2SGD I;  2ELI A;  2JYY A;  1TBO A;  1CSO I;  2KMP A;  2OD1 A;  3D00 A;  4UXI A;  1NUB A;  1SGR I;  3OXF A;  1CT4 I;  3GOX A;  2KMQ A;  2ORW A;  2J9R A;  5EX0 A;  1TOT A;  5FUX A;  2JXD A;  1TGS I;  2JZM A;  2K9H A;  1PTQ A;  2YUU A;  5EX3 A;  3SGQ I;  2NU1 I;  1RFH A;  2ROW A;  3KY9 A;  1PCE A;  3OL0 A;  4E1R A;  3TJQ A;  2ERW A;  3CXL A;  5FUW A;  2GVI A;  1BUS A;  3FC3 A;  1TBN A;  1R79 A;  2GKV A;  1SGY I;  2B8T A;  2GKT I;  5FUY A;  1TBR R;  2SGQ I;  1UVG A;  2NU2 I;  1HJA I;  1R0R I;  1DS2 I;  4HGU A;  1IY6 A;  4JCV E;  1LR7 A;  1CHO I;  1FYB A;  1SGD I;  1YU6 C;  3UGI A;  2QQE A;  1W3S A;  1TUS A;  3QTL D;  1OMT A;  1HPT A;  2LUY A;  2KCX A;  2J87 A;  1Y1C A;  2QPO A;  5CCL A;  1Y8F A;  1Z7K B;  2ARP F;  2DB6 A;  2ENN A;  5FUV A;  1BMO A;  2NU4 I;  2FNF X;  3RU0 A;  1M8B A;  1LR8 A;  2SGF I;  1OMU A;  3UFF A;  1DS3 I;  1H0Z A;  2M5X A;  1AN1 I;  1LR9 A;  1X4S A;  1YTP A;  2ENZ A;  1CGI I;  2NU0 I;  3QWP A;  2A20 A;  1N13 A;  1XA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...