3SH8A

Crystal structure of fluorophore-labeled beta-lactamase penp in complex with cephaloridine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
257
structure length
253
Chain Sequence
b'KDDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFCPENPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Increased structural flexibility at the active site of a fluorophore-conjugated beta-lactamase distinctively impacts its binding toward diverse cephalosporin antibiotics
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase/antibiotic
total genus 84
structure length 253
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3sh8A00
1K6SA 1BUEA 2XDMA 2WKEA 5CTNA 5GLAA 1PWDA 3G2ZA 1NJ4A 1XA1A 3ZGAB 3HLFA 1BSGA 1TDGA 2EFUA 2Y2NA 4MBFA 5HAQA 3MKEA 4WM9A 4B4ZA 3SH7A 4OP8A 3VP4A 2ZJ9A 3RJUA 2XFSA 4LV3A 4GOGA 3UDFA 4E3NA 4ZDXA 5EOEA 2GDNA 5A92A 1L0FA 3ZG0A 3G35A 2BG1A 3VSKA 3ZG7B 4MEZA 1LL9A 3IF6B 1Z6FA 5F82A 2XF3A 5FA7A 1ES3A 2ZQDA 5IHVA 1KGGA 1XA7A 3HBRA 4O7DA 1CEFA 1Q2QA 1E25A 1LLBA 3O87A 4FSFA 2VGJA 2WKHA 3V5MA 5U47A 5CGWA 4Z9QA 1YLJA 4HBUA 1H8ZA 4R1GA 1H8YA 3NDEA 1XGJA 1BULA 2Y2LA 4JF6A 5HX9A 4HESA 5GHZA 3WS4A 5E2HA 1DJBA 3HUMA 3HLEA 2ZLYA 1FOFA 3RXWA 3LY4A 5FQKA 1YMSA 3UDIA 3UO9A 4S2NC 4FH4A 4X55A 5AQBA 2EX6A 3BFCA 3P98A 4WMCD 3ZFZA 2OLVA 1FR1A 3O3VA 5AQ7A 2Y2MA 3OPPA 4OP5A 1FSYA 1W5DA 2J8YA 4WEKA 5FAPA 4K91A 4JKTA 1VM1A 4LCMA 4QJGA 3E2LA 3Q7VA 1K56A 4OKPA 1NRFA 3AGFA 4OOMA 5KZHA 3ZVWA 2WGVA 1XX2A 5CHUA 1MPLA 1KE0A 5TR7A 3VP1A 1K4FA 3IWQA 3MFDA 4MBHA 4QU3A 4BL2A 3BFEA 1ONHA 3EQVA 3MBZA 5FQQA 4OPYA 3BECA 1XXMA 2WAFA 4XUXA 2WGWA 2C6WB 5CRFA 5E2GA 5FI6A 5HAIA 1W7FA 4B88A 4Y0TA 4EQIA 4P85A 4WEJA 1BLPA 4JXWA 4E3KA 3GVBA 4DXBA 3OCNA 2ZD8A 3QNCA 5DF9A 5AQ9A 1YQSA 5GLDA 4N9KA 1KDWA 2HPBA 1YLZA 4PM6A 4S2KA 1K54A 4YINA 4OLDA 1GCEA 2EXBA 4X69A 5GHYA 3IHAA 4M3KA 4KZ8A 4BENA 1ESUA 1MBLA 4DF6A 3NI9A 4N9LA 4OONA 3O86A 3N8SA 2Y2PA 1M6KA 4K0WA 2ZC5B 1SHVA 3G31A 2XD5A 3A3DA 5KSCA 3GSGA 3Q7VB 3VSLA 1BLHA 2WYXA 1EWZA 4P0MA 3ZDJA 4BLMA 4PM8A 2HDUA 3PBNA 3UE3A 3ZG8B 1C3BA 3VOZA 4H8RA 1ZKJA 3N6IA 1HVBA 5JYOA 3OPRA 2WGWB 3G30A 4LV0A 1IYPA 4B4XA 3PBTA 3MZDA 3NIAA 1NXYA 4S2PA 1ES5A 4S2MA 1N4OA 4GN2A 4Y0UA 2ZQ7A 1K55A 3GMWA 4D2OA 3AGEA 5I94A 4OPZA 4ZJ3A 1JWPA 1YMXA 4S2LA 4Y7PA 2R9XA 2JC7A 4R4RA 1TDLA 3UNWA 3JYIA 1VQQA 3IXDA 2HP5A 3V3RA 4CJNA 1FR6A 3A3JA 3M2KA 5L2FA 2UWXA 5E2FA 2A49A 3IWOA 3SH9A 3NCKA 1CK3A 4R4SA 3VP2A 3WS2A 1MXOA 3C4PA 3VFHA 5FQMA 1N9BA 2WUQA 4KZ9A 2E8IA 4NK3A 3V39A 1RGYA 3C4OA 3FV7A 5JYPA 1GHPA 4XUZA 1S0WA 2WK0A 3BEBA 1GA9A 3A3EA 4U0TA 4KZAA 3I7JA 1SDEA 3WS0A 3TSGA 1FCNA 4N1XA 2ZM0A 3NBLA 1TVFA 3MZEA 4BD0A 5M19A 5E43A 1BLSA 3QNBA 4WMCA 3UE0A 4JXSA 2Y59A 1JTDA 3HUNA 3W4OA 3GTCA 4KQQA 2EX8A 3SS3A 3C7UA 1GHMA 4WYYA 4E3JA 3RXXA 1JWZA 4OLGA 1H5XA 4WZ5C 2V2FF 3FKVA 3M6HA 3Q1FA 3PBOA 2G2WA 2ZM8A 1FCMA 3LCEA 5DF7A 4OQ0A 5KMWA 1KE3A 4JF4A 4GB7A 5FSRA 1SDNA 3PAEA 4UAAA 3NY4A 3OCLA 3BFGA 3UPNA 4X6TA 1IYOA 1KVMA 1JWVA 2XR0A 2QZ6A 2FFYA 3HLCA 1IKGA 4EV4A 2FFFB 1U60A 2Y2GA 4HEFA 3ZHHA 2Y4AA 3TOIA 5GLBA 4QY6A 1ESIA 4KQRA 2Q9NA 5HW3A 4OQIA 4GKUA 3ZNTA 1YLPA 3DWKA 5G18A 1K38A 1IYQA 4X53A 3NDGA 4Q8IA 2EX9A 5EECA 3FWLA 4GDNA 4S2NA 3AGDA 3PTEA 1W79A 4QB8A 4DDYA 4F94A 1MWRA 3VMAA 1SCWA 3IF5A 1GHIA 3CZDA 1L0GA 3VP0A 4DE1A 4R3BA 3S4XA 3PAGA 1YLYA 4UA9A 5CHMA 4C3QA 5TGFA 4L0LA 3IT9A 1ERQA 2P9VA 1YM1A 4YFMA 3UN7A 4LCLA 3FKWA 3O88A 2CC1A 3GR2A 1IEMA 5FAQA 4KG5A 4C75A 1DJCA 4R23A 4LV2A 4RA7A 3ZCZA 4UHUA 2HDRA 2J7VA 4BD1A 2WADA 4MNRA 2J9OA 3C5AA 4OQHA 2DRWA 1TEMA 1KGFA 1LHYA 4MBKA 3WRZA 5FI2A 3M6BA 4DRTA 1I2WA 2Y2KA 3D4FA 3ITAA 3ZNYA 5CEBA 5CECA 1LI9A 2JE5A 2OLUA 3Q07A 1M40A 2ZC3B 4R3JA 2I72A 3G4PA 5DVAA 1K57C 3OPLA 2X02A 3GV9A 4IBXA 3HVFA 3W8KA 4RX3A 4GD8A 1QMFA 4QD4A 5FQ9A 1PI4A 4KZ5A 2IWDA 5EVIC 1FSWA 5J8XA 4RX2A 2XEPA 1NYMA 4E6WA 4GZBA 2ZM2A 1K4EA 3ISGA 5FI7A 1CI9A 3HLWA 2EX2A 1NY0A 1K6RA 2Y2QA 4IVKA 1EROA 1WYBA 2ZQAA 1MWSA 3UPPA 3IHBA 2P9VB 2H0YA 3E2KA 1PWGA 3G34A 2JBFA 2VGKA 4JF5A 3HLGA 2QPNA 4QY5A 5M18A 1FQGA 2P74A 4PM9A 2X01A 1CEGA 3N4IA 4DKIA 2XQZA 1PI5A 5DTSA 3IH8A 3SOIA 3HUOA 4JLFA 1LL5A 3OC2A 2Y2OA 4IVIA 1S6RA 1LI0A 1NZUA 1Y54A 1WYCA 1PW8A 1EI5A 2Y2IA 3IF6C 3OZHA 3Q82A 2DCFA 1Q2PA 2Q9MA 1KE4A 3ZG9B 4N1HA 5CTMA 2ZC4B 4ZTKA 3V50A 2V1ZA 5CGSA 4ZBEA 3P09A 1BT5A 4QHCA 2EXAA 5A91A 5CHJA 3DTMA 4PMAA 1J9MA 5M1AA 3BFDA 1HD8A 1PZOA 5HAPA 3MZFA 5EUAA 5HFOA 3BM6A 2QMIA 5DTKA 2WAEA 4EBNA 4DE0A 2WZZA 5AQAA 4KZ4A 1KVLA 4PPRA 5EE8A 1IELA 1KDSA 2XH9A 2Y91A 1XGIA 5DF8A 4OPRA 5EVID 1ES4A 1L2SA 3M2JA 1I5QA 3HL9A 1NYYA 3NC8A 3GQZA 3BRMA 1MY8A 4UA6A 2J9PA 1O07A 1O7EA 3CJMA 4RVAA 4E3IA 4CPKA 3N8LA 2ZQ8A 4K0XA 1MKIA 3LO7A 4BJPA 1MWUA 4U3TA 5F1GA 3ZVTA 4C6YA 2DNSA 3UE1A 1MWTA 4JXVA 3VOYA 1XPBA 1YLTA 3CG5A 4S2IA 1OMEA 2PBYA 1G68A 1XKZA 2C5WB 2HP9A 2WGIA 3BFFA 1ZG6A 4R0QA 3BLMA 2Y2JA 3G2YA 3PBRA 4WZ5A 4OOLA 5A93A 2G2UA 4ZAMA 2ZMAA 4OOYA 4E6XA 4E3OA 3UDXA 4A5RA 1E3UD 4DE2A 1IYSA 3CMZA 4KZBA 3QHYA 4RYEA 4XXRA 2HP6A 5F1FA 3LY3A 4OPQA 3WS1A 4KG6A 3B3XA 1RCJA 1QMEA 2XLNA 1JVJA 1YT4A 4ZJ2A 5KSHA 2IWCA 3FYZA 3S1YA 3N8RA 4JXGA 1BZAA 3HLBA 3DWZA 4GD6A 4EWFA 3HLDA 2IWBA 2ZC7A 4IEDA 4PM5A 1SKFA 2XD1A 4N92A 5HL1A 4U0XA 5CEDA 3MXSA 3SS4A 3MKFA 3WWXA 2HDQA 4KZ3A 1GA0A 5EPHA 5FAOA 2ZQCA 2X71A 4KG2A 2PU4A 2OSUA 3DW0A 3VFFA 3ZG5A 1RGZA 4X56A 4S2JA 1K25A 3S22A 1E4DA 4WBGA 3PBQA 4EBLA 3W4QA 2Y2HA 1W8YA 3MXRA 5EOOA 4OVDA 3Q81A 5CGXA 4BQMA 3UPOA 4KZ6A 1KGEA 3PBSA 5FDHA 4LV1A 2B5RA 4EBPA 4NETA 4X68A 1K54C 4OH0A 5D3OA 5CERA 2Y55A 1ALQA 4WZ4A 5GL9A 2H0TA 1ZC2A 5F83A 1PZPA 4E3LA 4UA7A 5HARA 3A3IA 5EVLA 3EQUA 4LENA 3C7VA 2RCXA 4KQOA 3IQAA 2PU2A 1K57A 2XGNA 1HZOA 3GRJA 3IXBA 2A3UA 2BLSA 4KENB 3TG9A 1ES2A 5FQIA 3A3FA 4GNUA 4ZJ1A 1HTZA 2ZC6B 4S2OA 4WELA 5EVIA 1PIOA 1PYYA 1PWCA 2JCHA 2Z2MB 2ZQ9A 3G32A 4P87A 3HREA 3UY6A 2V20A 1JTGA 1K56D 1AXBA 2H5SA 1BLCA 1ERMA 2RL3A 2XK1A 5E2EA 4E3MA 1NZOA 5GLCA 4GDBA 1YLWA 2R9WA 5FQJA 3IXGA 5GHXA 2EFXA 5CXWA 4HBTA 1K55C 3SH8A 3FZCA 1DJAA 3Q7ZA 3IXHA 3V3SA 3SS5A 1IKIA 4JBFA 2XFTA 1I2SA 1WE4A 1BTLA 3OPHA 3BLSA 4Y0OA 1XP4A 3IF6A 1W8QA 1ZG4A 3ITBA 4JPMA 5FASA 1PW1A 1E3UA 1RP5A 3BYDA 1G6AA 4DDSA 3WRTA 4DE3A 1DY6A 4IBRA 3LEZA 3N7WA 2OV5A 3IWIA 4MLLA 5BOHA 1FCOA 4EUZA 4KZ7A 4FCFA 4BL3A 1CI8A 4FH2A 2WZXA 4P6BA 2HDSA 1L0EA 4ID4A 5A90A 5DTTA 2Z2LB 5TFQA 5FATA 3WS5A 5EVIB 3IH9A 3W4PA 4PM7A 4DXCA 2H10A 2WKIA 1L0DA 4OQGA 4FD8A 3VP3A 1ONGA
chains in the Genus database with same CATH superfamily
5CTNA 1XFQA 1NJ4A 3MF0A 3LR4A 5HAQA 1W63M 4B4ZA 3SH7A 4E3NA 3VP4A 5EOEA 3L7HA 3VSKA 3K3DA 2G7UA 5F82A 3E98A 1Q2QA 1IFQA 3CUEA 5AVEA 1F2KA 3V5MA 2O99A 4HBUA 3NDEA 4JF6A 5GHZA 3PXPA 1FOFA 3RXWA 1V9ZA 2YKFA 3T1RA 2OLVA 1FR1A 1DP6A 4WEKA 5FAPA 1VM1A 2XA7S 3NOPC 1K56A 1NRFA 5EFWA 2WGVA 1XX2A 5TR7A 1MPLA 3LUQA 1K4FA 3BFEA 3MBZA 4OPYA 3BECA 2C6WB 5E2GA 5FI6A 3FG8A 4B88A 4EQIA 4JGRA 4WEJA 3S7PA 2QYBA 1KDWA 2HPBA 1YLZA 2Q0OA 4N9KA 4S2KA 4YINA 5F68A 5GHYA 1VB6A 1ESUA 4UQIM 4G3WA 3T4JA 3RFBA 2V8FA 2XD5A 3A3DA 3MR0A 1YAXA 5FEGA 1EWZA 2OWJA 3HCYA 5TJJA 2HDUA 1OPXA 2PHYA 3N6IA 5JYOA 4LV0A 3IX4A 4S2PA 4Y0UA 4D2OA 4OPZA 2JC7A 4R4RA 1TDLA 3JYIA 2XSSA 4CJNA 1FR6A 2UWXA 5E2FA 3WS2A 3T4OA 5EM0A 1CF0A 1LSVA 4GCZA 2E8IA 1GHPA 4XUZA 1XJ6A 1UGUA 3NBLA 4Q0JA 3MZEA 5M19A 5E43A 4WMCA 4YOFA 3W4OA 4KQQA 5HL6A 3IBJA 4OLGA 1H5XA 4R70A 4WN5A 1FCMA 1H8MA 1KE3A 4UAAA 1IYOA 1JWVA 4EV4A 3EEHA 4P6ZM 3RTYA 2AVXA 2FFFB 1U60A 2Y2GA 5EV0A 5GLBA 4QY6A 4EETB 3MS6A 3B42A 3O5YA 2EX9A 4EESA 3S7OA 4AFIA 3CZDA 1L0GA 3LR0A 3S4XA 3CAXA 5CHMA 3B47A 5TGFA 3PHYA 3T12B 3UB7A 1DJCA 4R23A 5HWTA 2HDRA 2J7VA 4BD1A 3C5AA 2DRWA 4DRTA 1I2WA 1G6OA 3Q07A 1M40A 2ZC3B 2I72A 1K57C 3GV9A 3W8KA 1Y28A 3QP1A 1GSXA 3F1OA 1QMFA 4KZ5A 1NYMA 1K4EA 4IHQA 2EX2A 1NY0A 5HDDA 2VGLM 5HZHA 2JBFA 4D60A 4R6LA 2XQZA 3UB5P 3HUOA 2Y2OA 4IVIA 1Y54A 3IF6C 4K0WA 1PW8A 3Q82A 2Q9MA 1Q2PA 2ZOHA 3ZG9B 5CGSA 3KSFA 4QHCA 4ESPA 1G5UA 3UMDA 5HAPA 3F1OB 3MZFA 3BM6A 4EBNA 3OLOA 2WZZA 5AQAA 4PPRA 1KDSA 2Y91A 1NLYA 1ES4A 1NLZA 2ZMVA 3M2JA 3GQZA 2PDRA 1O7EA 2ZQ8A 4MDZA 1MWUA 5F1GA 4C6YA 3ZVTA 1FIKA 4B93A 2WKRA 4PKYG 2PBYA 1G68A 3BFFA 2WGIA 4KUOA 5IU1A 1H0MA 2ZMAA 4NXEA 4E3OA 3CWFA 1E3UD 4DE2A 1IYSA 2HJEA 3QHYA 2HP6A 5F1FA 1Z09A 3B3XA 4UEYA 4YNRA 3FYZA 3S1YA 3N8RA 4JXGA 3HLBA 3IBRA 1LT0A 4N92A 1S1ZA 4U0XA 5CEDA 3WWXA 2HDQA 1GA0A 1SKOA 3H9WA 4KG2A 2XROA 1RGZA 3GDIA 4S2JA 3D72A 4FOFA 4HI4A 1W8YA 3MXRA 3BY8A 5EOOA 2NUPC 3LR5A 4BQMA 2JKGA 4NETA 4X68A 3MMHA 1ALQA 3TJZC 4ZRRA 3VOLA 4UA7A 3VE3A 4KQOA 1K57A 5DJUA 4HH3A 2A3UA 1SKOB 1ES2A 4GNUA 3EEAA 1PIOA 1PYYA 1PWCA 2JCHA 2FH5A 2W3HA 2Z2MB 3H82A 5F6AA 1K56D 3DAVA 1ERMA 4HH2A 1S4RA 5GLCA 2A2LA 1YLWA 2R9WA 4GDBA 5GHXA 2EFXA 2GX5A 3JVUA 1K55C 3SH8A 2H28A 3V3SA 3SS5A 4XT2A 3T4TA 1TS8A 3IF6A 1ZG4A 2ZL1A 4DDSA 4BWIA 4DE3A 2P7JA 3T4SA 1FCOA 4FCFA 2K2NA 3CHWP 2HDSA 1L0EA 4ID4A 2Z6CA 5FATA 1LSXA 2PBDP 3IH9A 2VV7A 2YKHA 2H10A 1L0DA 3H82B 1K6SA 2XDMA 5GLAA 4I39A 4QWOA 3QP8A 1BSGA 1TDGA 2EFUA 2Y2NA 2VA0A 4XT2B 3MKEA 3TE8A 1D06A 4OP8A 4ZDXA 2ZJ9A 3UDFA 1OT6A 3IX3A 2BG1A 3ZG7B 4MEZA 3IF6B 2ZL1B 2XF3A 5I5LA 1ES3A 5IHVA 5IS1A 1KGGA 3HBRA 5HDCA 1CEFA 4FSFA 5MC7A 3T4KA 5CGWA 2ACGA 4R1GA 1XGJA 2XRNA 5HX9A 4HESA 2ZLYA 4HIAA 2I9VA 3UDIA 4NG2A 1YMSA 4S2NC 2EX6A 4WMCD 3ZFZA 3UB8A 2E8JA 1W5DA 4K91A 4QJGA 4OOMA 4NXFA 2L0WA 3VP1A 5CHUA 2P04A 4MBHA 3MFDA 4JGQA 1XXMA 3KSHA 4YWZA 4XUXA 2WGWA 5CRFA 3U4LP 4P85A 4E3KA 3OCNA 1YQSA 3KX0X 3S7QA 5HSQA 4CLCC 2EXBA 4X69A 3IHAA 4HNBA 3KO6A 4EQ1A 4M3KA 4KZ8A 4DF6A 1MBLA 3FC7A 3O86A 1P9WA 3N8SA 3IS2A 3W2ZA 4O0PA 1G28A 5KSCA 3U2AA 4BMWA 1BLHA 2WYXA 5G4ZA 3P7NA 4P0MA 3ZDJA 4BLMA 3ZG8B 1C3BA 3VOZA 3GECA 4JGPA 4GS9A 3OPRA 4HOIA 1D7EA 2WGWB 3KYQA 3MZDA 1T1AA 1ES5A 4S2MA 5F5YA 4GN2A 3GMWA 1K55A 3PR6A 4H6JA 4ZJ3A 4S2LA 2QKPA 3UNWA 2VEAA 2P08A 1VQQA 2QJ5A 2HP5A 5L2FA 3H7WA 3VP2A 2A49A 3SH9A 3C38A 4DMZA 2A24A 1MXOA 3C4PA 4LLOB 3VFHA 4NXBA 3IS2B 3C2WA 1S0WA 3BEBA 1GA9A 3A3EA 3I7JA 3L9KA 4BD0A 5FDSA 1BLSA 4GS9B 3HUNA 4E04A 1GSVA 2HF6A 3GTCA 2Z6DA 2EX8A 4H6JB 3C7UA 3E4QA 3SS3A 2M7VA 4GLQA 4WYYA 3RXXA 3T50A 4E3JA 1JWZA 4WZ5C 2PAVP 3FKVA 3Q1FA 3LCEA 2KX6A 4HJ4A 5DF7A 3H7WB 2A24B 2L1MA 3OCLA 3T1XA 4X6TA 3JVVA 3HLCA 2FFYA 1IKGA 2Y4AA 3ZQ5A 3LI8A 4KQRA 5HW3A 2JKFA 2JHEA 3DWKA 5G18A 1IYQA 4LRYC 3ICYA 4Q8IA 5EECA 4GDNA 4S2NA 3AGDA 1W79A 4QB8A 1MWRA 3E4PA 1H3QA 3PAGA 1YLYA 4UA9A 2B02A 1ERQA 3GR2A 3SW1A 1DRMA 2KOIA 4C75A 4DJ3A 1X0OA 4LV2A 3ZCZA 3BWLA 4UHUA 3LIBA 2WADA 4OQHA 1TEMA 2VJWA 1KGFA 4CLCA 2Y2KA 2OLUA 4R3JA 3LIDA 3G4PA 3G6OA 4RX3A 4I3JA 4UQIS 5FQ9A 3OBFA 5J8XA 4WLAA 4X1MA 2XEPA 4GZBA 3ISGA 5FI7A 1CI9A 3HLWA 3HJKA 2Y2QA 2FZ0A 3T4QA 2VGKA 2VX8A 4JF5A 2QPNA 4QY5A 2P74A 3N4IA 3QP5A 3SOIA 3IH8A 1S6RA 2EA9A 4CLCB 5CTMA 4ZTKA 2V1ZA 4ZBEA 1BT5A 4PMAA 2B18A 3QP4A 1PZOA 3E4OA 4L9FA 2PR6A 4IUKA 4DE0A 2XH9A 5DF8A 1XGIA 2QJ7A 3BRMA 1MY8A 5J7EA 4K0XA 4BJPA 2B95A 2L4RA 3K2NA 3VOYA 1YLTA 1EW0A 4S2IA 2C5WB 1ZG6A 3G2YA 4WZ5A 4OOLA 4WUJA 5A93A 2G2UA 3S7NA 2JN7A 4EEPA 4E6XA 3UDXA 4A5RA 4RYEA 4HQAA 3LY3A 2PD7A 1JVJA 5AJGA 4P6ZS 1BZAA 3DWZA 2OWHA 1CQAA 2M7UA 4PM5A 5EPHA 5FAOA 3VFFA 2VLGA 3UMEA 1TS6A 4MCWA 2VK3A 4EBLA 2EWWA 3W4QA 3OOVA 3Q81A 3UE6A 3LICA 5J3WA 3UPOA 2V8CA 2W0NA 1KGEA 3PBSA 5FDHA 2B5RA 5HWVA 1W63Q 1PZPA 4E3LA 2V0UA 2M1CA 5EVLA 4LENA 2PU2A 4Y3IA 1F9IA 2XGNA 2VV8A 3GRJA 3IXBA 4KENB 3TG9A 5FQIA 3A3FA 4ZJ1A 2KLIA 4S2OA 3G32A 3QP6A 2DMWA 3DTIA 2H5SA 5E2EA 2RL3A 2XK1A 4M4XA 5CX7A 5L07A 5HPIA 3IXGA 5CXWA 2VGLS 1OJGA 3FZCA 1IKIA 1AWIA 5DFXA 1BTLA 4Y0OA 1XP4A 1OTIA 3ITBA 1PW1A 1RP5A 3R7WA 1G6AA 3V67A 3WRTA 3LIFA 4IBRA 2W3FA 4BBTA 2OV5A 3IWIA 4MLLA 3A0SA 1CI8A 2Z2LB 3CI6A 1OTAA 3W4PA 4PM7A 4DXCA 4OQGA 4FD8A 4UA6A 4ARZA 3TRCA 1BUEA 3P01A 2WKEA 5HWWA 5L10A 3G2ZA 4K08A 1XA1A 3IX8A 4IJGA 1DP8A 4WM9A 3RJUA 2XFSA 4LV3A 4GOGA 5A92A 1Z6FA 3LIEA 2PT7A 5FA7A 3R7WB 1XA7A 3O87A 4PHTA 3KSGA 3C8CA 2K31A 1YLJA 1H8ZA 4DN0A 4EXOA 4ARZB 5EM1A 3LEQA 3WS4A 4BBUA 3HLEA 5J4EA 4G3VA 3LY4A 5FQKA 2ZMFA 1T18A 3UO9A 3D3OA 4FH4A 3O3VA 2Y2MA 3OPPA 1FSYA 2J8YA 5L8MA 4Y13A 4JKTA 4LCMA 3E2LA 3AGFA 5KZHA 4HP9A 2W3EA 5FQQA 5F69A 2WAFA 4Y0TA 1W7FA 1BLPA 5GLDA 3QNCA 5JYPA 5AQ9A 3CLOA 1YKDA 2MJ6A 4OLDA 3A0VA 1ZHHB 3MQQA 4BENA 2HZ5A 3EOIA 3NI9A 1N9NA 2Y8HA 1UWNX 4OONA 2Y2PA 1M6KA 3HJIA 2ZC5B 1SHVA 3G31A 4PM8A 3UE3A 1OJ5A 4B4XA 1IYPA 1N4OA 4Y17A 5I94A 2GJ3A 1JWPA 4Y7PA 3T1SA 1A0KA 1VHMA 3IXDA 3V3RA 3M2KA 1XJ2A 3IWOA 4CLCD 3NCKA 1CK3A 4R4SA 3MJQA 5HPFA 4Q0IA 3NULA 1RGYA 3FV7A 3A0RA 2K7SA 4U0TA 4KZAA 3WS0A 5IT5A 4RQ9A 2J3WA 2ZM0A 1TVFA 2J80A 4ETXA 3QNBA 3UE0A 4JXSA 2Y59A 1JTDA 1OTBA 4MMNA 2LB5A 4Y2FA 3PYPA 4EW7A 3CITA 3PBOA 2G2WA 2ZM8A 4JF4A 1CJFA 1SDNA 2HGVA 3PAEA 1UWPX 3NY4A 1KVMA 2XR0A 4L9EA 2Q9NA 4OQIA 4GKUA 4X53A 5A8BA 4NKPA 4F3LA 5AVFA 1SCWA 1GHIA 4DE1A 4O8GA 4C3QA 5HDSA 1PNEA 4L0LA 3D9YA 2P9VA 1YM1A 5K5BA 3FKWA 3O88A 5FAQA 1IEMA 4RA7A 4Q0HA 4X1LA 3WRZA 5FI2A 5CEBA 3ITAA 3ZNYA 5CECA 1LI9A 2JE5A 4G3KA 1Y4OA 3OPLA 3HVFA 4F3LB 4GD8A 3C30A 1PI4A 5EVIC 1FSWA 4RX2A 4Y5FA 2NUTC 3E0YA 2ZM2A 3KSIA 3VE4A 4IVKA 1EROA 1WYBA 2ZQAA 3IHBA 2P9VB 2H0YA 3E2KA 1PWGA 3DTKA 3G34A 3LGOA 3HLGA 5M18A 4DKIA 3BQAA 5DTSA 1LL5A 1NZUA 2O9AA 4QU3A 1WYCA 5DJTA 2DCFA 5DFYA 2ZC4B 3SZTA 3V50A 1OTDA 2GZAA 3ZYTA 5CHJA 3DTMA 3JPUA 5M1AA 1HD8A 5EUAA 5HFOA 4EUVA 1T1CA 2WAEA 1KVLA 5EE8A 1IELA 1XJ3A 4FTXA 3MQ0A 1I5QA 3HL9A 3NC8A 3NJAA 3R4KA 2J9PA 2BTFP 4E3IA 4CPKA 4U3TA 2DNSA 3NOTC 4ME4A 3UE1A 1MWTA 2PRFA 1OT9A 2W3DA 1N9LA 4JXVA 1IOUA 2D01A 1OMEA 2Y2JA 3PBRA 4LFUA 4ZAMA 3EWKA 4ETZA 1TD5A 2V0WA 3CPTA 4OPQA 4L9GA 3WS1A 4KG6A 1QMEA 2XLNA 2O0YA 4ZJ2A 4EWFA 5DKLA 4LRXC 4II7A 5HL1A 2XA7M 3MXSA 2VKSA 3MKFA 4KZ3A 4MN5A 4CLCE 2BASA 4GHIA 4KQDA 4X56A 1E4DA 2QHKA 1YSPA 1TS0A 4OVDA 2J3TC 5CGXA 4WL9A 4LV1A 4EBPA 3CPTB 1K54C 2ZBBA 5CERA 2Y55A 4I5SA 3BW6A 4WZ4A 2H0TA 5F83A 5HARA 3A3IA 4WF0A 3EQUA 2V1BA 3C7VA 2RCXA 3IQAA 5HD3A 2O9BA 3K3CA 3MSHA 1HTZA 2ZC6B 4WELA 5EVIA 4GHIB 3TW8A 5DKKA 4P87A 2ZQ9A 3DTEA 3UY6A 1BLCA 4E3MA 1NZOA 5FQJA 1N9OA 5EVEA 1DJAA 3IXHA 2OAQ1 5LBRA 1WE4A 3EGXC 3BLSA 1W8QA 4JPMA 5FASA 5FEFA 3LEZA 3N7WA 2R78A 4LPZA 5G4YA 4EERA 5HD5A 5A90A 5TFQA 4Y15A 2ZOIA 5EVIB 3BJNA 2WKIA 3VP3A 1ONGA 1K0KA 1PWDA 1L3LA 3ZGAB 3HLFA 4I3IA 1LSWA 2OAP1 2W1TA 4HJ6A 4MBFA 4B9OA 1S66L 2GDNA 5C5KA 1L0FA 3ZG0A 3G35A 1LL9A 4MN6A 2W3GA 2D02A 2ZQDA 4R38A 4O7DA 2PD8A 1E25A 1LLBA 1JNUA 1MKMA 4PKYA 2VGJA 2WKHA 3FPWA 4IUHA 3LFVA 5U47A 4Z9QA 1H8YA 1BULA 2Y2LA 1YSQA 5E2HA 1DJBA 3HUMA 2GNXA 3VV4A 4X55A 1S1YA 2JKTM 5AQBA 3BFCA 3UB6A 3P98A 5AQ7A 2W1TB 2JKRM 4OP5A 3Q7VA 4OKPA 1D1JA 3ZVWA 1KE0A 3IWQA 2PYPA 3LR3A 3DBAA 4BL2A 1ONHA 3EQVA 1GSWA 1T1BA 5HAIA 2WKPA 1LL8A 4JXWA 4DXBA 3GVBA 2ZD8A 4X25A 5DF9A 4PM6A 1K54A 3F1NA 1GCEA 2HV1A 4N9LA 1J3WA 2Y79A 1SZVA 2PR5A 2CMNA 3GSGA 3Q7VB 1STZA 3VSLA 1XJ4A 4PAUA 3PBNA 4H8RA 1ZKJA 1HVBA 4BBVA 1NWZA 3G30A 3PBTA 3NIAA 1NXYA 1P0ZA 2QWSA 2ZQ7A 1P9RA 1VEUA 3AGEA 1YMXA 2R9XA 3F1NB 3A3JA 3LIAA 3NHQA 5FQMA 1N9BA 2WUQA 4KZ9A 3QP2A 4NK3A 3V39A 3C4OA 2WK0A 1FILA 4NXGA 1HLUP 1SDEA 2W27A 3TSGA 1FCNA 4N1XA 1NRJA 4MN7A 2VZWA 1F5MA 1T19A 5TBMA 4JGOA 4R3AA 1VEUB 1GHMA 3LYXA 2V2FF 3M6HA 4I3AA 4EEUA 4OQ0A 5KMWA 4GB7A 5FSRA 3BFGA 3UPNA 2QZ6A 3LI9A 1OTEA 4EU0A 3ZHHA 4HEFA 3TOIA 1ESIA 3UB9A 3ZNTA 1YLPA 1K38A 3NDGA 1WA9A 5TBMB 3FWLA 3PTEA 4F94A 4DDYA 3VMAA 2V1AA 3F1PA 3IF5A 3ULFA 3VP0A 4HHDA 4R3BA 2V9AA 3NECA 3IT9A 1MC0A 4YFMA 3UN7A 4LCLA 2CC1A 4KG5A 3FPVA 4LGWA 4MNRA 1ACFA 2J9OA 1PRQA 1LHYA 4MBKA 4NEED 3M6BA 3D4FA 2PYRA 5DVAA 2INWA 2X02A 4IBXA 4HJ3A 4QD4A 2IWDA 1S4SA 3F1PB 4E6WA 1K6RA 2IA2A 3RH8B 1MWSA 1KOUA 3UPPA 4O01A 1FQGA 4PM9A 2X01A 4CQHA 1CEGA 1PI5A 4JLFA 1VETA 3OC2A 5FL3A 1LI0A 2Y2IA 3OZHA 1EI5A 1KE4A 4N1HA 3P09A 2EXAA 5A91A 1J9MA 3BFDA 1ZTUA 2QMIA 5DTKA 2O9CA 4KZ4A 4HP4A 4OPRA 5EVID 1L2SA 1NYYA 4GW9A 2VV6A 1DP9A 3CJMA 1O07A 4RVAA 3N8LA 1MKIA 3LO7A 2EWVA 4GJ4A 1VETB 1XPBA 3B33A 3CG5A 1XKZA 2HP9A 4R0QA 3BLMA 5L09A 2KDKA 1TS7A 2HJ9C 4LRZE 4OOYA 3CUEC 2UV0E 3CMZA 3KYEA 4KZBA 1RCJA 1ODVA 1YT4A 5KSHA 2IWCA 1TF1A 4QPRA 4GD6A 3HLDA 2IWBA 2ZC7A 4IEDA 4HY8A 1SKFA 2XD1A 3SS4A 1PFLA 2ZQCA 2X71A 2PU4A 2OSUA 3DW0A 3ZG5A 1K25A 3S22A 4WBGA 3PBQA 2Y2HA 1YPRA 4KZ6A 4OH0A 5D3OA 1S67L 5GL9A 1ZC2A 1XFNA 3NOUC 4DJ2A 3BQ8A 1HZOA 2W1RA 3MQOA 2BLSA 3T1QB 3KYZA 3HREA 5KIZA 2V20A 1JTGA 4KUKA 1AXBA 1P97A 1F98A 4HBTA 1V9YA 2OOLA 3Q7ZA 2J3TD 4I38A 4JBFA 2WKQA 2LB9A 2XFTA 3EGDC 1I2SA 3OPHA 3MFXA 4FUWA 1E3UA 3BYDA 2JKTI 3MXQA 1DY6A 2JKRI 5BOHA 4EUZA 4KZ7A 4Z1WA 4BL3A 4FH2A 2WZXA 4P6BA 1BYWA 3T4LA 5DTTA 1MZUA 3BY9A 3WS5A 4XXRA
chains in the Genus database with same CATH topology
1K6SA 1BUEA 2XDMA 2WKEA 5CTNA 5GLAA 1PWDA 3G2ZA 1NJ4A 1XA1A 3ZGAB 3HLFA 1BSGA 1TDGA 2EFUA 2Y2NA 4MBFA 5HAQA 3MKEA 4WM9A 4B4ZA 3SH7A 4OP8A 3VP4A 2ZJ9A 3RJUA 2XFSA 4LV3A 4GOGA 3UDFA 4E3NA 4ZDXA 5EOEA 2GDNA 5A92A 1L0FA 3ZG0A 3G35A 2BG1A 3VSKA 3ZG7B 4MEZA 1LL9A 3IF6B 1Z6FA 5F82A 2XF3A 5FA7A 1ES3A 2ZQDA 5IHVA 1KGGA 1XA7A 3HBRA 4O7DA 1CEFA 1Q2QA 1E25A 1LLBA 3O87A 4FSFA 2VGJA 2WKHA 3V5MA 5U47A 5CGWA 4Z9QA 1YLJA 4HBUA 1H8ZA 4R1GA 1H8YA 3NDEA 1XGJA 1BULA 2Y2LA 4JF6A 5HX9A 4HESA 5GHZA 3WS4A 5E2HA 1DJBA 3HUMA 3HLEA 2ZLYA 1FOFA 3RXWA 3LY4A 5FQKA 1YMSA 3UDIA 3UO9A 4S2NC 4FH4A 4X55A 5AQBA 2EX6A 3BFCA 3P98A 4WMCD 3ZFZA 2OLVA 1FR1A 3O3VA 5AQ7A 2Y2MA 3OPPA 4OP5A 1FSYA 1W5DA 2J8YA 4WEKA 5FAPA 4K91A 4JKTA 1VM1A 4LCMA 4QJGA 3E2LA 3Q7VA 1K56A 4OKPA 1NRFA 3AGFA 4OOMA 5KZHA 3ZVWA 2WGVA 1XX2A 5CHUA 1MPLA 1KE0A 5TR7A 3VP1A 1K4FA 3IWQA 3MFDA 4MBHA 4QU3A 4BL2A 3BFEA 1ONHA 3EQVA 3MBZA 5FQQA 4OPYA 3BECA 1XXMA 2WAFA 4XUXA 2WGWA 2C6WB 5CRFA 5E2GA 5FI6A 5HAIA 1W7FA 4B88A 4Y0TA 4EQIA 4P85A 4WEJA 1BLPA 4JXWA 4E3KA 3GVBA 4DXBA 3OCNA 2ZD8A 3QNCA 5DF9A 5AQ9A 1YQSA 5GLDA 4N9KA 1KDWA 2HPBA 1YLZA 4PM6A 4S2KA 1K54A 4YINA 4OLDA 1GCEA 2EXBA 4X69A 5GHYA 3IHAA 4M3KA 4KZ8A 4BENA 1ESUA 1MBLA 4DF6A 3NI9A 4N9LA 4OONA 3O86A 3N8SA 2Y2PA 1M6KA 4K0WA 2ZC5B 1SHVA 3G31A 2XD5A 3A3DA 5KSCA 3GSGA 3Q7VB 3VSLA 1BLHA 2WYXA 1EWZA 4P0MA 3ZDJA 4BLMA 4PM8A 2HDUA 3PBNA 3UE3A 3ZG8B 1C3BA 3VOZA 4H8RA 1ZKJA 3N6IA 1HVBA 5JYOA 3OPRA 2WGWB 3G30A 4LV0A 1IYPA 4B4XA 3PBTA 3MZDA 3NIAA 1NXYA 4S2PA 1ES5A 4S2MA 1N4OA 4GN2A 4Y0UA 2ZQ7A 1K55A 3GMWA 4D2OA 3AGEA 5I94A 4OPZA 4ZJ3A 1JWPA 1YMXA 4S2LA 4Y7PA 2R9XA 2JC7A 4R4RA 1TDLA 3UNWA 3JYIA 1VQQA 3IXDA 2HP5A 3V3RA 4CJNA 1FR6A 3A3JA 3M2KA 5L2FA 2UWXA 5E2FA 2A49A 3IWOA 3SH9A 3NCKA 1CK3A 4R4SA 3VP2A 3WS2A 1MXOA 3C4PA 3VFHA 5FQMA 1N9BA 2WUQA 4KZ9A 2E8IA 4NK3A 3V39A 1RGYA 3C4OA 3FV7A 5JYPA 1GHPA 4XUZA 1S0WA 2WK0A 3BEBA 1GA9A 3A3EA 4U0TA 4KZAA 3I7JA 1SDEA 3WS0A 3TSGA 1FCNA 4N1XA 2ZM0A 3NBLA 1TVFA 3MZEA 4BD0A 5M19A 5E43A 1BLSA 3QNBA 4WMCA 3UE0A 4JXSA 2Y59A 1JTDA 3HUNA 3W4OA 3GTCA 4KQQA 2EX8A 3SS3A 3C7UA 1GHMA 4WYYA 4E3JA 3RXXA 1JWZA 4OLGA 1H5XA 4WZ5C 2V2FF 3FKVA 3M6HA 3Q1FA 3PBOA 2G2WA 2ZM8A 1FCMA 3LCEA 5DF7A 4OQ0A 5KMWA 1KE3A 4JF4A 4GB7A 5FSRA 1SDNA 3PAEA 4UAAA 3NY4A 3OCLA 3BFGA 3UPNA 4X6TA 1IYOA 1KVMA 1JWVA 2XR0A 2QZ6A 2FFYA 3HLCA 1IKGA 4EV4A 2FFFB 1U60A 2Y2GA 4HEFA 3ZHHA 2Y4AA 3TOIA 5GLBA 4QY6A 1ESIA 4KQRA 2Q9NA 5HW3A 4OQIA 4GKUA 3ZNTA 1YLPA 3DWKA 5G18A 1K38A 1IYQA 4X53A 3NDGA 4Q8IA 2EX9A 5EECA 3FWLA 4GDNA 4S2NA 3AGDA 3PTEA 1W79A 4QB8A 4DDYA 4F94A 1MWRA 3VMAA 1SCWA 3IF5A 1GHIA 3CZDA 1L0GA 3VP0A 4DE1A 4R3BA 3S4XA 3PAGA 1YLYA 4UA9A 5CHMA 4C3QA 5TGFA 4L0LA 3IT9A 1ERQA 2P9VA 1YM1A 4YFMA 3UN7A 4LCLA 3FKWA 3O88A 2CC1A 3GR2A 1IEMA 5FAQA 4KG5A 4C75A 1DJCA 4R23A 4LV2A 4RA7A 3ZCZA 4UHUA 2HDRA 2J7VA 4BD1A 2WADA 4MNRA 2J9OA 3C5AA 4OQHA 2DRWA 1TEMA 1KGFA 1LHYA 4MBKA 3WRZA 5FI2A 3M6BA 4DRTA 1I2WA 2Y2KA 3D4FA 3ITAA 3ZNYA 5CEBA 5CECA 1LI9A 2JE5A 2OLUA 3Q07A 1M40A 2ZC3B 4R3JA 2I72A 3G4PA 5DVAA 1K57C 3OPLA 2X02A 3GV9A 4IBXA 3HVFA 3W8KA 4RX3A 4GD8A 1QMFA 4QD4A 5FQ9A 1PI4A 4KZ5A 2IWDA 5EVIC 1FSWA 5J8XA 4RX2A 2XEPA 1NYMA 4E6WA 4GZBA 2ZM2A 1K4EA 3ISGA 5FI7A 1CI9A 3HLWA 2EX2A 1NY0A 1K6RA 2Y2QA 4IVKA 1EROA 1WYBA 2ZQAA 1MWSA 3UPPA 3IHBA 2P9VB 2H0YA 3E2KA 1PWGA 3G34A 2JBFA 2VGKA 4JF5A 3HLGA 2QPNA 4QY5A 5M18A 1FQGA 2P74A 4PM9A 2X01A 1CEGA 3N4IA 4DKIA 2XQZA 1PI5A 5DTSA 3IH8A 3SOIA 3HUOA 4JLFA 1LL5A 3OC2A 2Y2OA 4IVIA 1S6RA 1LI0A 1NZUA 1Y54A 1WYCA 1PW8A 1EI5A 2Y2IA 3IF6C 3OZHA 3Q82A 2DCFA 1Q2PA 2Q9MA 1KE4A 3ZG9B 4N1HA 5CTMA 2ZC4B 4ZTKA 3V50A 2V1ZA 5CGSA 4ZBEA 3P09A 1BT5A 4QHCA 2EXAA 5A91A 5CHJA 3DTMA 4PMAA 1J9MA 5M1AA 3BFDA 1HD8A 1PZOA 5HAPA 3MZFA 5EUAA 5HFOA 3BM6A 2QMIA 5DTKA 2WAEA 4EBNA 4DE0A 2WZZA 5AQAA 4KZ4A 1KVLA 4PPRA 5EE8A 1IELA 1KDSA 2XH9A 2Y91A 1XGIA 5DF8A 4OPRA 5EVID 1ES4A 1L2SA 3M2JA 1I5QA 3HL9A 1NYYA 3NC8A 3GQZA 3BRMA 1MY8A 4UA6A 2J9PA 1O07A 1O7EA 3CJMA 4RVAA 4E3IA 4CPKA 3N8LA 2ZQ8A 4K0XA 1MKIA 3LO7A 4BJPA 1MWUA 4U3TA 5F1GA 3ZVTA 4C6YA 2DNSA 3UE1A 1MWTA 4JXVA 3VOYA 1XPBA 1YLTA 3CG5A 4S2IA 1OMEA 2PBYA 1G68A 1XKZA 2C5WB 2HP9A 2WGIA 3BFFA 1ZG6A 4R0QA 3BLMA 2Y2JA 3G2YA 3PBRA 4WZ5A 4OOLA 5A93A 2G2UA 4ZAMA 2ZMAA 4OOYA 4E6XA 4E3OA 3UDXA 4A5RA 1E3UD 4DE2A 1IYSA 3CMZA 4KZBA 3QHYA 4RYEA 4XXRA 2HP6A 5F1FA 3LY3A 4OPQA 3WS1A 4KG6A 3B3XA 1RCJA 1QMEA 2XLNA 1JVJA 1YT4A 4ZJ2A 5KSHA 2IWCA 3FYZA 3S1YA 3N8RA 4JXGA 1BZAA 3HLBA 3DWZA 4GD6A 4EWFA 3HLDA 2IWBA 2ZC7A 4IEDA 4PM5A 1SKFA 2XD1A 4N92A 5HL1A 4U0XA 5CEDA 3MXSA 3SS4A 3MKFA 3WWXA 2HDQA 4KZ3A 1GA0A 5EPHA 5FAOA 2ZQCA 2X71A 4KG2A 2PU4A 2OSUA 3DW0A 3VFFA 3ZG5A 1RGZA 4X56A 4S2JA 1K25A 3S22A 1E4DA 4WBGA 3PBQA 4EBLA 3W4QA 2Y2HA 1W8YA 3MXRA 5EOOA 4OVDA 3Q81A 5CGXA 4BQMA 3UPOA 4KZ6A 1KGEA 3PBSA 5FDHA 4LV1A 2B5RA 4EBPA 4NETA 4X68A 1K54C 4OH0A 5D3OA 5CERA 2Y55A 1ALQA 4WZ4A 5GL9A 2H0TA 1ZC2A 5F83A 1PZPA 4E3LA 4UA7A 5HARA 3A3IA 5EVLA 3EQUA 4LENA 3C7VA 2RCXA 4KQOA 3IQAA 2PU2A 1K57A 2XGNA 1HZOA 3GRJA 3IXBA 2A3UA 2BLSA 4KENB 3TG9A 1ES2A 5FQIA 3A3FA 4GNUA 4ZJ1A 1HTZA 2ZC6B 4S2OA 4WELA 5EVIA 1PIOA 1PYYA 1PWCA 2JCHA 2Z2MB 2ZQ9A 3G32A 4P87A 3HREA 3UY6A 2V20A 1JTGA 1K56D 1AXBA 2H5SA 1BLCA 1ERMA 2RL3A 2XK1A 5E2EA 4E3MA 1NZOA 5GLCA 4GDBA 1YLWA 2R9WA 5FQJA 3IXGA 5GHXA 2EFXA 5CXWA 4HBTA 1K55C 3SH8A 3FZCA 1DJAA 3Q7ZA 3IXHA 3V3SA 3SS5A 1IKIA 4JBFA 2XFTA 1I2SA 1WE4A 1BTLA 3OPHA 3BLSA 4Y0OA 1XP4A 3IF6A 1W8QA 1ZG4A 3ITBA 4JPMA 5FASA 1PW1A 1E3UA 1RP5A 3BYDA 1G6AA 4DDSA 3WRTA 4DE3A 1DY6A 4IBRA 3LEZA 3N7WA 2OV5A 3IWIA 4MLLA 5BOHA 1FCOA 4EUZA 4KZ7A 4FCFA 4BL3A 1CI8A 4FH2A 2WZXA 4P6BA 2HDSA 1L0EA 4ID4A 5A90A 5DTTA 2Z2LB 5TFQA 5FATA 3WS5A 5EVIB 3IH9A 3W4PA 4PM7A 4DXCA 2H10A 2WKIA 1L0DA 4OQGA 4FD8A 3VP3A 1ONGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K6S A;  1BUE A;  2XDM A;  2WKE A;  5CTN A;  5GLA A;  1PWD A;  3G2Z A;  1NJ4 A;  1XA1 A;  3ZGA B;  3HLF A;  1BSG A;  1TDG A;  2EFU A;  2Y2N A;  4MBF A;  5HAQ A;  3MKE A;  4WM9 A;  4B4Z A;  3SH7 A;  4OP8 A;  3VP4 A;  2ZJ9 A;  3RJU A;  2XFS A;  4LV3 A;  4GOG A;  3UDF A;  4E3N A;  4ZDX A;  5EOE A;  2GDN A;  5A92 A;  1L0F A;  3ZG0 A;  3G35 A;  2BG1 A;  3VSK A;  3ZG7 B;  4MEZ A;  1LL9 A;  3IF6 B;  1Z6F A;  5F82 A;  2XF3 A;  5FA7 A;  1ES3 A;  2ZQD A;  5IHV A;  1KGG A;  1XA7 A;  3HBR A;  4O7D A;  1CEF A;  1Q2Q A;  1E25 A;  1LLB A;  3O87 A;  4FSF A;  2VGJ A;  2WKH A;  3V5M A;  5U47 A;  5CGW A;  4Z9Q A;  1YLJ A;  4HBU A;  1H8Z A;  4R1G A;  1H8Y A;  3NDE A;  1XGJ A;  1BUL A;  2Y2L A;  4JF6 A;  5HX9 A;  4HES A;  5GHZ A;  3WS4 A;  5E2H A;  1DJB A;  3HUM A;  3HLE A;  2ZLY A;  1FOF A;  3RXW A;  3LY4 A;  5FQK A;  1YMS A;  3UDI A;  3UO9 A;  4S2N C;  4FH4 A;  4X55 A;  5AQB A;  2EX6 A;  3BFC A;  3P98 A;  4WMC D;  3ZFZ A;  2OLV A;  1FR1 A;  3O3V A;  5AQ7 A;  2Y2M A;  3OPP A;  4OP5 A;  1FSY A;  1W5D A;  2J8Y A;  4WEK A;  5FAP A;  4K91 A;  4JKT A;  1VM1 A;  4LCM A;  4QJG A;  3E2L A;  3Q7V A;  1K56 A;  4OKP A;  1NRF A;  3AGF A;  4OOM A;  5KZH A;  3ZVW A;  2WGV A;  1XX2 A;  5CHU A;  1MPL A;  1KE0 A;  5TR7 A;  3VP1 A;  1K4F A;  3IWQ A;  3MFD A;  4MBH A;  4QU3 A;  4BL2 A;  3BFE A;  1ONH A;  3EQV A;  3MBZ A;  5FQQ A;  4OPY A;  3BEC A;  1XXM A;  2WAF A;  4XUX A;  2WGW A;  2C6W B;  5CRF A;  5E2G A;  5FI6 A;  5HAI A;  1W7F A;  4B88 A;  4Y0T A;  4EQI A;  4P85 A;  4WEJ A;  1BLP A;  4JXW A;  4E3K A;  3GVB A;  4DXB A;  3OCN A;  2ZD8 A;  3QNC A;  5DF9 A;  5AQ9 A;  1YQS A;  5GLD A;  4N9K A;  1KDW A;  2HPB A;  1YLZ A;  4PM6 A;  4S2K A;  1K54 A;  4YIN A;  4OLD A;  1GCE A;  2EXB A;  4X69 A;  5GHY A;  3IHA A;  4M3K A;  4KZ8 A;  4BEN A;  1ESU A;  1MBL A;  4DF6 A;  3NI9 A;  4N9L A;  4OON A;  3O86 A;  3N8S A;  2Y2P A;  1M6K A;  4K0W A;  2ZC5 B;  1SHV A;  3G31 A;  2XD5 A;  3A3D A;  5KSC A;  3GSG A;  3Q7V B;  3VSL A;  1BLH A;  2WYX A;  1EWZ A;  4P0M A;  3ZDJ A;  4BLM A;  4PM8 A;  2HDU A;  3PBN A;  3UE3 A;  3ZG8 B;  1C3B A;  3VOZ A;  4H8R A;  1ZKJ A;  3N6I A;  1HVB A;  5JYO A;  3OPR A;  2WGW B;  3G30 A;  4LV0 A;  1IYP A;  4B4X A;  3PBT A;  3MZD A;  3NIA A;  1NXY A;  4S2P A;  1ES5 A;  4S2M A;  1N4O A;  4GN2 A;  4Y0U A;  2ZQ7 A;  1K55 A;  3GMW A;  4D2O A;  3AGE A;  5I94 A;  4OPZ A;  4ZJ3 A;  1JWP A;  1YMX A;  4S2L A;  4Y7P A;  2R9X A;  2JC7 A;  4R4R A;  1TDL A;  3UNW A;  3JYI A;  1VQQ A;  3IXD A;  2HP5 A;  3V3R A;  4CJN A;  1FR6 A;  3A3J A;  3M2K A;  5L2F A;  2UWX A;  5E2F A;  2A49 A;  3IWO A;  3SH9 A;  3NCK A;  1CK3 A;  4R4S A;  3VP2 A;  3WS2 A;  1MXO A;  3C4P A;  3VFH A;  5FQM A;  1N9B A;  2WUQ A;  4KZ9 A;  2E8I A;  4NK3 A;  3V39 A;  1RGY A;  3C4O A;  3FV7 A;  5JYP A;  1GHP A;  4XUZ A;  1S0W A;  2WK0 A;  3BEB A;  1GA9 A;  3A3E A;  4U0T A;  4KZA A;  3I7J A;  1SDE A;  3WS0 A;  3TSG A;  1FCN A;  4N1X A;  2ZM0 A;  3NBL A;  1TVF A;  3MZE A;  4BD0 A;  5M19 A;  5E43 A;  1BLS A;  3QNB A;  4WMC A;  3UE0 A;  4JXS A;  2Y59 A;  1JTD A;  3HUN A;  3W4O A;  3GTC A;  4KQQ A;  2EX8 A;  3SS3 A;  3C7U A;  1GHM A;  4WYY A;  4E3J A;  3RXX A;  1JWZ A;  4OLG A;  1H5X A;  4WZ5 C;  2V2F F;  3FKV A;  3M6H A;  3Q1F A;  3PBO A;  2G2W A;  2ZM8 A;  1FCM A;  3LCE A;  5DF7 A;  4OQ0 A;  5KMW A;  1KE3 A;  4JF4 A;  4GB7 A;  5FSR A;  1SDN A;  3PAE A;  4UAA A;  3NY4 A;  3OCL A;  3BFG A;  3UPN A;  4X6T A;  1IYO A;  1KVM A;  1JWV A;  2XR0 A;  2QZ6 A;  2FFY A;  3HLC A;  1IKG A;  4EV4 A;  2FFF B;  1U60 A;  2Y2G A;  4HEF A;  3ZHH A;  2Y4A A;  3TOI A;  5GLB A;  4QY6 A;  1ESI A;  4KQR A;  2Q9N A;  5HW3 A;  4OQI A;  4GKU A;  3ZNT A;  1YLP A;  3DWK A;  5G18 A;  1K38 A;  1IYQ A;  4X53 A;  3NDG A;  4Q8I A;  2EX9 A;  5EEC A;  3FWL A;  4GDN A;  4S2N A;  3AGD A;  3PTE A;  1W79 A;  4QB8 A;  4DDY A;  4F94 A;  1MWR A;  3VMA A;  1SCW A;  3IF5 A;  1GHI A;  3CZD A;  1L0G A;  3VP0 A;  4DE1 A;  4R3B A;  3S4X A;  3PAG A;  1YLY A;  4UA9 A;  5CHM A;  4C3Q A;  5TGF A;  4L0L A;  3IT9 A;  1ERQ A;  2P9V A;  1YM1 A;  4YFM A;  3UN7 A;  4LCL A;  3FKW A;  3O88 A;  2CC1 A;  3GR2 A;  1IEM A;  5FAQ A;  4KG5 A;  4C75 A;  1DJC A;  4R23 A;  4LV2 A;  4RA7 A;  3ZCZ A;  4UHU A;  2HDR A;  2J7V A;  4BD1 A;  2WAD A;  4MNR A;  2J9O A;  3C5A A;  4OQH A;  2DRW A;  1TEM A;  1KGF A;  1LHY A;  4MBK A;  3WRZ A;  5FI2 A;  3M6B A;  4DRT A;  1I2W A;  2Y2K A;  3D4F A;  3ITA A;  3ZNY A;  5CEB A;  5CEC A;  1LI9 A;  2JE5 A;  2OLU A;  3Q07 A;  1M40 A;  2ZC3 B;  4R3J A;  2I72 A;  3G4P A;  5DVA A;  1K57 C;  3OPL A;  2X02 A;  3GV9 A;  4IBX A;  3HVF A;  3W8K A;  4RX3 A;  4GD8 A;  1QMF A;  4QD4 A;  5FQ9 A;  1PI4 A;  4KZ5 A;  2IWD A;  5EVI C;  1FSW A;  5J8X A;  4RX2 A;  2XEP A;  1NYM A;  4E6W A;  4GZB A;  2ZM2 A;  1K4E A;  3ISG A;  5FI7 A;  1CI9 A;  3HLW A;  2EX2 A;  1NY0 A;  1K6R A;  2Y2Q A;  4IVK A;  1ERO A;  1WYB A;  2ZQA A;  1MWS A;  3UPP A;  3IHB A;  2P9V B;  2H0Y A;  3E2K A;  1PWG A;  3G34 A;  2JBF A;  2VGK A;  4JF5 A;  3HLG A;  2QPN A;  4QY5 A;  5M18 A;  1FQG A;  2P74 A;  4PM9 A;  2X01 A;  1CEG A;  3N4I A;  4DKI A;  2XQZ A;  1PI5 A;  5DTS A;  3IH8 A;  3SOI A;  3HUO A;  4JLF A;  1LL5 A;  3OC2 A;  2Y2O A;  4IVI A;  1S6R A;  1LI0 A;  1NZU A;  1Y54 A;  1WYC A;  1PW8 A;  1EI5 A;  2Y2I A;  3IF6 C;  3OZH A;  3Q82 A;  2DCF A;  1Q2P A;  2Q9M A;  1KE4 A;  3ZG9 B;  4N1H A;  5CTM A;  2ZC4 B;  4ZTK A;  3V50 A;  2V1Z A;  5CGS A;  4ZBE A;  3P09 A;  1BT5 A;  4QHC A;  2EXA A;  5A91 A;  5CHJ A;  3DTM A;  4PMA A;  1J9M A;  5M1A A;  3BFD A;  1HD8 A;  1PZO A;  5HAP A;  3MZF A;  5EUA A;  5HFO A;  3BM6 A;  2QMI A;  5DTK A;  2WAE A;  4EBN A;  4DE0 A;  2WZZ A;  5AQA A;  4KZ4 A;  1KVL A;  4PPR A;  5EE8 A;  1IEL A;  1KDS A;  2XH9 A;  2Y91 A;  1XGI A;  5DF8 A;  4OPR A;  5EVI D;  1ES4 A;  1L2S A;  3M2J A;  1I5Q A;  3HL9 A;  1NYY A;  3NC8 A;  3GQZ A;  3BRM A;  1MY8 A;  4UA6 A;  2J9P A;  1O07 A;  1O7E A;  3CJM A;  4RVA A;  4E3I A;  4CPK A;  3N8L A;  2ZQ8 A;  4K0X A;  1MKI A;  3LO7 A;  4BJP A;  1MWU A;  4U3T A;  5F1G A;  3ZVT A;  4C6Y A;  2DNS A;  3UE1 A;  1MWT A;  4JXV A;  3VOY A;  1XPB A;  1YLT A;  3CG5 A;  4S2I A;  1OME A;  2PBY A;  1G68 A;  1XKZ A;  2C5W B;  2HP9 A;  2WGI A;  3BFF A;  1ZG6 A;  4R0Q A;  3BLM A;  2Y2J A;  3G2Y A;  3PBR A;  4WZ5 A;  4OOL A;  5A93 A;  2G2U A;  4ZAM A;  2ZMA A;  4OOY A;  4E6X A;  4E3O A;  3UDX A;  4A5R A;  1E3U D;  4DE2 A;  1IYS A;  3CMZ A;  4KZB A;  3QHY A;  4RYE A;  4XXR A;  2HP6 A;  5F1F A;  3LY3 A;  4OPQ A;  3WS1 A;  4KG6 A;  3B3X A;  1RCJ A;  1QME A;  2XLN A;  1JVJ A;  1YT4 A;  4ZJ2 A;  5KSH A;  2IWC A;  3FYZ A;  3S1Y A;  3N8R A;  4JXG A;  1BZA A;  3HLB A;  3DWZ A;  4GD6 A;  4EWF A;  3HLD A;  2IWB A;  2ZC7 A;  4IED A;  4PM5 A;  1SKF A;  2XD1 A;  4N92 A;  5HL1 A;  4U0X A;  5CED A;  3MXS A;  3SS4 A;  3MKF A;  3WWX A;  2HDQ A;  4KZ3 A;  1GA0 A;  5EPH A;  5FAO A;  2ZQC A;  2X71 A;  4KG2 A;  2PU4 A;  2OSU A;  3DW0 A;  3VFF A;  3ZG5 A;  1RGZ A;  4X56 A;  4S2J A;  1K25 A;  3S22 A;  1E4D A;  4WBG A;  3PBQ A;  4EBL A;  3W4Q A;  2Y2H A;  1W8Y A;  3MXR A;  5EOO A;  4OVD A;  3Q81 A;  5CGX A;  4BQM A;  3UPO A;  4KZ6 A;  1KGE A;  3PBS A;  5FDH A;  4LV1 A;  2B5R A;  4EBP A;  4NET A;  4X68 A;  1K54 C;  4OH0 A;  5D3O A;  5CER A;  2Y55 A;  1ALQ A;  4WZ4 A;  5GL9 A;  2H0T A;  1ZC2 A;  5F83 A;  1PZP A;  4E3L A;  4UA7 A;  5HAR A;  3A3I A;  5EVL A;  3EQU A;  4LEN A;  3C7V A;  2RCX A;  4KQO A;  3IQA A;  2PU2 A;  1K57 A;  2XGN A;  1HZO A;  3GRJ A;  3IXB A;  2A3U A;  2BLS A;  4KEN B;  3TG9 A;  1ES2 A;  5FQI A;  3A3F A;  4GNU A;  4ZJ1 A;  1HTZ A;  2ZC6 B;  4S2O A;  4WEL A;  5EVI A;  1PIO A;  1PYY A;  1PWC A;  2JCH A;  2Z2M B;  2ZQ9 A;  3G32 A;  4P87 A;  3HRE A;  3UY6 A;  2V20 A;  1JTG A;  1K56 D;  1AXB A;  2H5S A;  1BLC A;  1ERM A;  2RL3 A;  2XK1 A;  5E2E A;  4E3M A;  1NZO A;  5GLC A;  4GDB A;  1YLW A;  2R9W A;  5FQJ A;  3IXG A;  5GHX A;  2EFX A;  5CXW A;  4HBT A;  1K55 C;  3SH8 A;  3FZC A;  1DJA A;  3Q7Z A;  3IXH A;  3V3S A;  3SS5 A;  1IKI A;  4JBF A;  2XFT A;  1I2S A;  1WE4 A;  1BTL A;  3OPH A;  3BLS A;  4Y0O A;  1XP4 A;  3IF6 A;  1W8Q A;  1ZG4 A;  3ITB A;  4JPM A;  5FAS A;  1PW1 A;  1E3U A;  1RP5 A;  3BYD A;  1G6A A;  4DDS A;  3WRT A;  4DE3 A;  1DY6 A;  4IBR A;  3LEZ A;  3N7W A;  2OV5 A;  3IWI A;  4MLL A;  5BOH A;  1FCO A;  4EUZ A;  4KZ7 A;  4FCF A;  4BL3 A;  1CI8 A;  4FH2 A;  2WZX A;  4P6B A;  2HDS A;  1L0E A;  4ID4 A;  5A90 A;  5DTT A;  2Z2L B;  5TFQ A;  5FAT A;  3WS5 A;  5EVI B;  3IH9 A;  3W4P A;  4PM7 A;  4DXC A;  2H10 A;  2WKI A;  1L0D A;  4OQG A;  4FD8 A;  3VP3 A;  1ONG A; 
#chains in the Genus database with same CATH topology
 5CTN A;  1XFQ A;  1NJ4 A;  3MF0 A;  3LR4 A;  5HAQ A;  1W63 M;  4B4Z A;  3SH7 A;  4E3N A;  3VP4 A;  5EOE A;  3L7H A;  3VSK A;  3K3D A;  2G7U A;  5F82 A;  3E98 A;  1Q2Q A;  1IFQ A;  3CUE A;  5AVE A;  1F2K A;  3V5M A;  2O99 A;  4HBU A;  3NDE A;  4JF6 A;  5GHZ A;  3PXP A;  1FOF A;  3RXW A;  1V9Z A;  2YKF A;  3T1R A;  2OLV A;  1FR1 A;  1DP6 A;  4WEK A;  5FAP A;  1VM1 A;  2XA7 S;  3NOP C;  1K56 A;  1NRF A;  5EFW A;  2WGV A;  1XX2 A;  5TR7 A;  1MPL A;  3LUQ A;  1K4F A;  3BFE A;  3MBZ A;  4OPY A;  3BEC A;  2C6W B;  5E2G A;  5FI6 A;  3FG8 A;  4B88 A;  4EQI A;  4JGR A;  4WEJ A;  3S7P A;  2QYB A;  1KDW A;  2HPB A;  1YLZ A;  2Q0O A;  4N9K A;  4S2K A;  4YIN A;  5F68 A;  5GHY A;  1VB6 A;  1ESU A;  4UQI M;  4G3W A;  3T4J A;  3RFB A;  2V8F A;  2XD5 A;  3A3D A;  3MR0 A;  1YAX A;  5FEG A;  1EWZ A;  2OWJ A;  3HCY A;  5TJJ A;  2HDU A;  1OPX A;  2PHY A;  3N6I A;  5JYO A;  4LV0 A;  3IX4 A;  4S2P A;  4Y0U A;  4D2O A;  4OPZ A;  2JC7 A;  4R4R A;  1TDL A;  3JYI A;  2XSS A;  4CJN A;  1FR6 A;  2UWX A;  5E2F A;  3WS2 A;  3T4O A;  5EM0 A;  1CF0 A;  1LSV A;  4GCZ A;  2E8I A;  1GHP A;  4XUZ A;  1XJ6 A;  1UGU A;  3NBL A;  4Q0J A;  3MZE A;  5M19 A;  5E43 A;  4WMC A;  4YOF A;  3W4O A;  4KQQ A;  5HL6 A;  3IBJ A;  4OLG A;  1H5X A;  4R70 A;  4WN5 A;  1FCM A;  1H8M A;  1KE3 A;  4UAA A;  1IYO A;  1JWV A;  4EV4 A;  3EEH A;  4P6Z M;  3RTY A;  2AVX A;  2FFF B;  1U60 A;  2Y2G A;  5EV0 A;  5GLB A;  4QY6 A;  4EET B;  3MS6 A;  3B42 A;  3O5Y A;  2EX9 A;  4EES A;  3S7O A;  4AFI A;  3CZD A;  1L0G A;  3LR0 A;  3S4X A;  3CAX A;  5CHM A;  3B47 A;  5TGF A;  3PHY A;  3T12 B;  3UB7 A;  1DJC A;  4R23 A;  5HWT A;  2HDR A;  2J7V A;  4BD1 A;  3C5A A;  2DRW A;  4DRT A;  1I2W A;  1G6O A;  3Q07 A;  1M40 A;  2ZC3 B;  2I72 A;  1K57 C;  3GV9 A;  3W8K A;  1Y28 A;  3QP1 A;  1GSX A;  3F1O A;  1QMF A;  4KZ5 A;  1NYM A;  1K4E A;  4IHQ A;  2EX2 A;  1NY0 A;  5HDD A;  2VGL M;  5HZH A;  2JBF A;  4D60 A;  4R6L A;  2XQZ A;  3UB5 P;  3HUO A;  2Y2O A;  4IVI A;  1Y54 A;  3IF6 C;  4K0W A;  1PW8 A;  3Q82 A;  2Q9M A;  1Q2P A;  2ZOH A;  3ZG9 B;  5CGS A;  3KSF A;  4QHC A;  4ESP A;  1G5U A;  3UMD A;  5HAP A;  3F1O B;  3MZF A;  3BM6 A;  4EBN A;  3OLO A;  2WZZ A;  5AQA A;  4PPR A;  1KDS A;  2Y91 A;  1NLY A;  1ES4 A;  1NLZ A;  2ZMV A;  3M2J A;  3GQZ A;  2PDR A;  1O7E A;  2ZQ8 A;  4MDZ A;  1MWU A;  5F1G A;  4C6Y A;  3ZVT A;  1FIK A;  4B93 A;  2WKR A;  4PKY G;  2PBY A;  1G68 A;  3BFF A;  2WGI A;  4KUO A;  5IU1 A;  1H0M A;  2ZMA A;  4NXE A;  4E3O A;  3CWF A;  1E3U D;  4DE2 A;  1IYS A;  2HJE A;  3QHY A;  2HP6 A;  5F1F A;  1Z09 A;  3B3X A;  4UEY A;  4YNR A;  3FYZ A;  3S1Y A;  3N8R A;  4JXG A;  3HLB A;  3IBR A;  1LT0 A;  4N92 A;  1S1Z A;  4U0X A;  5CED A;  3WWX A;  2HDQ A;  1GA0 A;  1SKO A;  3H9W A;  4KG2 A;  2XRO A;  1RGZ A;  3GDI A;  4S2J A;  3D72 A;  4FOF A;  4HI4 A;  1W8Y A;  3MXR A;  3BY8 A;  5EOO A;  2NUP C;  3LR5 A;  4BQM A;  2JKG A;  4NET A;  4X68 A;  3MMH A;  1ALQ A;  3TJZ C;  4ZRR A;  3VOL A;  4UA7 A;  3VE3 A;  4KQO A;  1K57 A;  5DJU A;  4HH3 A;  2A3U A;  1SKO B;  1ES2 A;  4GNU A;  3EEA A;  1PIO A;  1PYY A;  1PWC A;  2JCH A;  2FH5 A;  2W3H A;  2Z2M B;  3H82 A;  5F6A A;  1K56 D;  3DAV A;  1ERM A;  4HH2 A;  1S4R A;  5GLC A;  2A2L A;  1YLW A;  2R9W A;  4GDB A;  5GHX A;  2EFX A;  2GX5 A;  3JVU A;  1K55 C;  3SH8 A;  2H28 A;  3V3S A;  3SS5 A;  4XT2 A;  3T4T A;  1TS8 A;  3IF6 A;  1ZG4 A;  2ZL1 A;  4DDS A;  4BWI A;  4DE3 A;  2P7J A;  3T4S A;  1FCO A;  4FCF A;  2K2N A;  3CHW P;  2HDS A;  1L0E A;  4ID4 A;  2Z6C A;  5FAT A;  1LSX A;  2PBD P;  3IH9 A;  2VV7 A;  2YKH A;  2H10 A;  1L0D A;  3H82 B;  1K6S A;  2XDM A;  5GLA A;  4I39 A;  4QWO A;  3QP8 A;  1BSG A;  1TDG A;  2EFU A;  2Y2N A;  2VA0 A;  4XT2 B;  3MKE A;  3TE8 A;  1D06 A;  4OP8 A;  4ZDX A;  2ZJ9 A;  3UDF A;  1OT6 A;  3IX3 A;  2BG1 A;  3ZG7 B;  4MEZ A;  3IF6 B;  2ZL1 B;  2XF3 A;  5I5L A;  1ES3 A;  5IHV A;  5IS1 A;  1KGG A;  3HBR A;  5HDC A;  1CEF A;  4FSF A;  5MC7 A;  3T4K A;  5CGW A;  2ACG A;  4R1G A;  1XGJ A;  2XRN A;  5HX9 A;  4HES A;  2ZLY A;  4HIA A;  2I9V A;  3UDI A;  4NG2 A;  1YMS A;  4S2N C;  2EX6 A;  4WMC D;  3ZFZ A;  3UB8 A;  2E8J A;  1W5D A;  4K91 A;  4QJG A;  4OOM A;  4NXF A;  2L0W A;  3VP1 A;  5CHU A;  2P04 A;  4MBH A;  3MFD A;  4JGQ A;  1XXM A;  3KSH A;  4YWZ A;  4XUX A;  2WGW A;  5CRF A;  3U4L P;  4P85 A;  4E3K A;  3OCN A;  1YQS A;  3KX0 X;  3S7Q A;  5HSQ A;  4CLC C;  2EXB A;  4X69 A;  3IHA A;  4HNB A;  3KO6 A;  4EQ1 A;  4M3K A;  4KZ8 A;  4DF6 A;  1MBL A;  3FC7 A;  3O86 A;  1P9W A;  3N8S A;  3IS2 A;  3W2Z A;  4O0P A;  1G28 A;  5KSC A;  3U2A A;  4BMW A;  1BLH A;  2WYX A;  5G4Z A;  3P7N A;  4P0M A;  3ZDJ A;  4BLM A;  3ZG8 B;  1C3B A;  3VOZ A;  3GEC A;  4JGP A;  4GS9 A;  3OPR A;  4HOI A;  1D7E A;  2WGW B;  3KYQ A;  3MZD A;  1T1A A;  1ES5 A;  4S2M A;  5F5Y A;  4GN2 A;  3GMW A;  1K55 A;  3PR6 A;  4H6J A;  4ZJ3 A;  4S2L A;  2QKP A;  3UNW A;  2VEA A;  2P08 A;  1VQQ A;  2QJ5 A;  2HP5 A;  5L2F A;  3H7W A;  3VP2 A;  2A49 A;  3SH9 A;  3C38 A;  4DMZ A;  2A24 A;  1MXO A;  3C4P A;  4LLO B;  3VFH A;  4NXB A;  3IS2 B;  3C2W A;  1S0W A;  3BEB A;  1GA9 A;  3A3E A;  3I7J A;  3L9K A;  4BD0 A;  5FDS A;  1BLS A;  4GS9 B;  3HUN A;  4E04 A;  1GSV A;  2HF6 A;  3GTC A;  2Z6D A;  2EX8 A;  4H6J B;  3C7U A;  3E4Q A;  3SS3 A;  2M7V A;  4GLQ A;  4WYY A;  3RXX A;  3T50 A;  4E3J A;  1JWZ A;  4WZ5 C;  2PAV P;  3FKV A;  3Q1F A;  3LCE A;  2KX6 A;  4HJ4 A;  5DF7 A;  3H7W B;  2A24 B;  2L1M A;  3OCL A;  3T1X A;  4X6T A;  3JVV A;  3HLC A;  2FFY A;  1IKG A;  2Y4A A;  3ZQ5 A;  3LI8 A;  4KQR A;  5HW3 A;  2JKF A;  2JHE A;  3DWK A;  5G18 A;  1IYQ A;  4LRY C;  3ICY A;  4Q8I A;  5EEC A;  4GDN A;  4S2N A;  3AGD A;  1W79 A;  4QB8 A;  1MWR A;  3E4P A;  1H3Q A;  3PAG A;  1YLY A;  4UA9 A;  2B02 A;  1ERQ A;  3GR2 A;  3SW1 A;  1DRM A;  2KOI A;  4C75 A;  4DJ3 A;  1X0O A;  4LV2 A;  3ZCZ A;  3BWL A;  4UHU A;  3LIB A;  2WAD A;  4OQH A;  1TEM A;  2VJW A;  1KGF A;  4CLC A;  2Y2K A;  2OLU A;  4R3J A;  3LID A;  3G4P A;  3G6O A;  4RX3 A;  4I3J A;  4UQI S;  5FQ9 A;  3OBF A;  5J8X A;  4WLA A;  4X1M A;  2XEP A;  4GZB A;  3ISG A;  5FI7 A;  1CI9 A;  3HLW A;  3HJK A;  2Y2Q A;  2FZ0 A;  3T4Q A;  2VGK A;  2VX8 A;  4JF5 A;  2QPN A;  4QY5 A;  2P74 A;  3N4I A;  3QP5 A;  3SOI A;  3IH8 A;  1S6R A;  2EA9 A;  4CLC B;  5CTM A;  4ZTK A;  2V1Z A;  4ZBE A;  1BT5 A;  4PMA A;  2B18 A;  3QP4 A;  1PZO A;  3E4O A;  4L9F A;  2PR6 A;  4IUK A;  4DE0 A;  2XH9 A;  5DF8 A;  1XGI A;  2QJ7 A;  3BRM A;  1MY8 A;  5J7E A;  4K0X A;  4BJP A;  2B95 A;  2L4R A;  3K2N A;  3VOY A;  1YLT A;  1EW0 A;  4S2I A;  2C5W B;  1ZG6 A;  3G2Y A;  4WZ5 A;  4OOL A;  4WUJ A;  5A93 A;  2G2U A;  3S7N A;  2JN7 A;  4EEP A;  4E6X A;  3UDX A;  4A5R A;  4RYE A;  4HQA A;  3LY3 A;  2PD7 A;  1JVJ A;  5AJG A;  4P6Z S;  1BZA A;  3DWZ A;  2OWH A;  1CQA A;  2M7U A;  4PM5 A;  5EPH A;  5FAO A;  3VFF A;  2VLG A;  3UME A;  1TS6 A;  4MCW A;  2VK3 A;  4EBL A;  2EWW A;  3W4Q A;  3OOV A;  3Q81 A;  3UE6 A;  3LIC A;  5J3W A;  3UPO A;  2V8C A;  2W0N A;  1KGE A;  3PBS A;  5FDH A;  2B5R A;  5HWV A;  1W63 Q;  1PZP A;  4E3L A;  2V0U A;  2M1C A;  5EVL A;  4LEN A;  2PU2 A;  4Y3I A;  1F9I A;  2XGN A;  2VV8 A;  3GRJ A;  3IXB A;  4KEN B;  3TG9 A;  5FQI A;  3A3F A;  4ZJ1 A;  2KLI A;  4S2O A;  3G32 A;  3QP6 A;  2DMW A;  3DTI A;  2H5S A;  5E2E A;  2RL3 A;  2XK1 A;  4M4X A;  5CX7 A;  5L07 A;  5HPI A;  3IXG A;  5CXW A;  2VGL S;  1OJG A;  3FZC A;  1IKI A;  1AWI A;  5DFX A;  1BTL A;  4Y0O A;  1XP4 A;  1OTI A;  3ITB A;  1PW1 A;  1RP5 A;  3R7W A;  1G6A A;  3V67 A;  3WRT A;  3LIF A;  4IBR A;  2W3F A;  4BBT A;  2OV5 A;  3IWI A;  4MLL A;  3A0S A;  1CI8 A;  2Z2L B;  3CI6 A;  1OTA A;  3W4P A;  4PM7 A;  4DXC A;  4OQG A;  4FD8 A;  4UA6 A;  4ARZ A;  3TRC A;  1BUE A;  3P01 A;  2WKE A;  5HWW A;  5L10 A;  3G2Z A;  4K08 A;  1XA1 A;  3IX8 A;  4IJG A;  1DP8 A;  4WM9 A;  3RJU A;  2XFS A;  4LV3 A;  4GOG A;  5A92 A;  1Z6F A;  3LIE A;  2PT7 A;  5FA7 A;  3R7W B;  1XA7 A;  3O87 A;  4PHT A;  3KSG A;  3C8C A;  2K31 A;  1YLJ A;  1H8Z A;  4DN0 A;  4EXO A;  4ARZ B;  5EM1 A;  3LEQ A;  3WS4 A;  4BBU A;  3HLE A;  5J4E A;  4G3V A;  3LY4 A;  5FQK A;  2ZMF A;  1T18 A;  3UO9 A;  3D3O A;  4FH4 A;  3O3V A;  2Y2M A;  3OPP A;  1FSY A;  2J8Y A;  5L8M A;  4Y13 A;  4JKT A;  4LCM A;  3E2L A;  3AGF A;  5KZH A;  4HP9 A;  2W3E A;  5FQQ A;  5F69 A;  2WAF A;  4Y0T A;  1W7F A;  1BLP A;  5GLD A;  3QNC A;  5JYP A;  5AQ9 A;  3CLO A;  1YKD A;  2MJ6 A;  4OLD A;  3A0V A;  1ZHH B;  3MQQ A;  4BEN A;  2HZ5 A;  3EOI A;  3NI9 A;  1N9N A;  2Y8H A;  1UWN X;  4OON A;  2Y2P A;  1M6K A;  3HJI A;  2ZC5 B;  1SHV A;  3G31 A;  4PM8 A;  3UE3 A;  1OJ5 A;  4B4X A;  1IYP A;  1N4O A;  4Y17 A;  5I94 A;  2GJ3 A;  1JWP A;  4Y7P A;  3T1S A;  1A0K A;  1VHM A;  3IXD A;  3V3R A;  3M2K A;  1XJ2 A;  3IWO A;  4CLC D;  3NCK A;  1CK3 A;  4R4S A;  3MJQ A;  5HPF A;  4Q0I A;  3NUL A;  1RGY A;  3FV7 A;  3A0R A;  2K7S A;  4U0T A;  4KZA A;  3WS0 A;  5IT5 A;  4RQ9 A;  2J3W A;  2ZM0 A;  1TVF A;  2J80 A;  4ETX A;  3QNB A;  3UE0 A;  4JXS A;  2Y59 A;  1JTD A;  1OTB A;  4MMN A;  2LB5 A;  4Y2F A;  3PYP A;  4EW7 A;  3CIT A;  3PBO A;  2G2W A;  2ZM8 A;  4JF4 A;  1CJF A;  1SDN A;  2HGV A;  3PAE A;  1UWP X;  3NY4 A;  1KVM A;  2XR0 A;  4L9E A;  2Q9N A;  4OQI A;  4GKU A;  4X53 A;  5A8B A;  4NKP A;  4F3L A;  5AVF A;  1SCW A;  1GHI A;  4DE1 A;  4O8G A;  4C3Q A;  5HDS A;  1PNE A;  4L0L A;  3D9Y A;  2P9V A;  1YM1 A;  5K5B A;  3FKW A;  3O88 A;  5FAQ A;  1IEM A;  4RA7 A;  4Q0H A;  4X1L A;  3WRZ A;  5FI2 A;  5CEB A;  3ITA A;  3ZNY A;  5CEC A;  1LI9 A;  2JE5 A;  4G3K A;  1Y4O A;  3OPL A;  3HVF A;  4F3L B;  4GD8 A;  3C30 A;  1PI4 A;  5EVI C;  1FSW A;  4RX2 A;  4Y5F A;  2NUT C;  3E0Y A;  2ZM2 A;  3KSI A;  3VE4 A;  4IVK A;  1ERO A;  1WYB A;  2ZQA A;  3IHB A;  2P9V B;  2H0Y A;  3E2K A;  1PWG A;  3DTK A;  3G34 A;  3LGO A;  3HLG A;  5M18 A;  4DKI A;  3BQA A;  5DTS A;  1LL5 A;  1NZU A;  2O9A A;  4QU3 A;  1WYC A;  5DJT A;  2DCF A;  5DFY A;  2ZC4 B;  3SZT A;  3V50 A;  1OTD A;  2GZA A;  3ZYT A;  5CHJ A;  3DTM A;  3JPU A;  5M1A A;  1HD8 A;  5EUA A;  5HFO A;  4EUV A;  1T1C A;  2WAE A;  1KVL A;  5EE8 A;  1IEL A;  1XJ3 A;  4FTX A;  3MQ0 A;  1I5Q A;  3HL9 A;  3NC8 A;  3NJA A;  3R4K A;  2J9P A;  2BTF P;  4E3I A;  4CPK A;  4U3T A;  2DNS A;  3NOT C;  4ME4 A;  3UE1 A;  1MWT A;  2PRF A;  1OT9 A;  2W3D A;  1N9L A;  4JXV A;  1IOU A;  2D01 A;  1OME A;  2Y2J A;  3PBR A;  4LFU A;  4ZAM A;  3EWK A;  4ETZ A;  1TD5 A;  2V0W A;  3CPT A;  4OPQ A;  4L9G A;  3WS1 A;  4KG6 A;  1QME A;  2XLN A;  2O0Y A;  4ZJ2 A;  4EWF A;  5DKL A;  4LRX C;  4II7 A;  5HL1 A;  2XA7 M;  3MXS A;  2VKS A;  3MKF A;  4KZ3 A;  4MN5 A;  4CLC E;  2BAS A;  4GHI A;  4KQD A;  4X56 A;  1E4D A;  2QHK A;  1YSP A;  1TS0 A;  4OVD A;  2J3T C;  5CGX A;  4WL9 A;  4LV1 A;  4EBP A;  3CPT B;  1K54 C;  2ZBB A;  5CER A;  2Y55 A;  4I5S A;  3BW6 A;  4WZ4 A;  2H0T A;  5F83 A;  5HAR A;  3A3I A;  4WF0 A;  3EQU A;  2V1B A;  3C7V A;  2RCX A;  3IQA A;  5HD3 A;  2O9B A;  3K3C A;  3MSH A;  1HTZ A;  2ZC6 B;  4WEL A;  5EVI A;  4GHI B;  3TW8 A;  5DKK A;  4P87 A;  2ZQ9 A;  3DTE A;  3UY6 A;  1BLC A;  4E3M A;  1NZO A;  5FQJ A;  1N9O A;  5EVE A;  1DJA A;  3IXH A;  2OAQ 1;  5LBR A;  1WE4 A;  3EGX C;  3BLS A;  1W8Q A;  4JPM A;  5FAS A;  5FEF A;  3LEZ A;  3N7W A;  2R78 A;  4LPZ A;  5G4Y A;  4EER A;  5HD5 A;  5A90 A;  5TFQ A;  4Y15 A;  2ZOI A;  5EVI B;  3BJN A;  2WKI A;  3VP3 A;  1ONG A;  1K0K A;  1PWD A;  1L3L A;  3ZGA B;  3HLF A;  4I3I A;  1LSW A;  2OAP 1;  2W1T A;  4HJ6 A;  4MBF A;  4B9O A;  1S66 L;  2GDN A;  5C5K A;  1L0F A;  3ZG0 A;  3G35 A;  1LL9 A;  4MN6 A;  2W3G A;  2D02 A;  2ZQD A;  4R38 A;  4O7D A;  2PD8 A;  1E25 A;  1LLB A;  1JNU A;  1MKM A;  4PKY A;  2VGJ A;  2WKH A;  3FPW A;  4IUH A;  3LFV A;  5U47 A;  4Z9Q A;  1H8Y A;  1BUL A;  2Y2L A;  1YSQ A;  5E2H A;  1DJB A;  3HUM A;  2GNX A;  3VV4 A;  4X55 A;  1S1Y A;  2JKT M;  5AQB A;  3BFC A;  3UB6 A;  3P98 A;  5AQ7 A;  2W1T B;  2JKR M;  4OP5 A;  3Q7V A;  4OKP A;  1D1J A;  3ZVW A;  1KE0 A;  3IWQ A;  2PYP A;  3LR3 A;  3DBA A;  4BL2 A;  1ONH A;  3EQV A;  1GSW A;  1T1B A;  5HAI A;  2WKP A;  1LL8 A;  4JXW A;  4DXB A;  3GVB A;  2ZD8 A;  4X25 A;  5DF9 A;  4PM6 A;  1K54 A;  3F1N A;  1GCE A;  2HV1 A;  4N9L A;  1J3W A;  2Y79 A;  1SZV A;  2PR5 A;  2CMN A;  3GSG A;  3Q7V B;  1STZ A;  3VSL A;  1XJ4 A;  4PAU A;  3PBN A;  4H8R A;  1ZKJ A;  1HVB A;  4BBV A;  1NWZ A;  3G30 A;  3PBT A;  3NIA A;  1NXY A;  1P0Z A;  2QWS A;  2ZQ7 A;  1P9R A;  1VEU A;  3AGE A;  1YMX A;  2R9X A;  3F1N B;  3A3J A;  3LIA A;  3NHQ A;  5FQM A;  1N9B A;  2WUQ A;  4KZ9 A;  3QP2 A;  4NK3 A;  3V39 A;  3C4O A;  2WK0 A;  1FIL A;  4NXG A;  1HLU P;  1SDE A;  2W27 A;  3TSG A;  1FCN A;  4N1X A;  1NRJ A;  4MN7 A;  2VZW A;  1F5M A;  1T19 A;  5TBM A;  4JGO A;  4R3A A;  1VEU B;  1GHM A;  3LYX A;  2V2F F;  3M6H A;  4I3A A;  4EEU A;  4OQ0 A;  5KMW A;  4GB7 A;  5FSR A;  3BFG A;  3UPN A;  2QZ6 A;  3LI9 A;  1OTE A;  4EU0 A;  3ZHH A;  4HEF A;  3TOI A;  1ESI A;  3UB9 A;  3ZNT A;  1YLP A;  1K38 A;  3NDG A;  1WA9 A;  5TBM B;  3FWL A;  3PTE A;  4F94 A;  4DDY A;  3VMA A;  2V1A A;  3F1P A;  3IF5 A;  3ULF A;  3VP0 A;  4HHD A;  4R3B A;  2V9A A;  3NEC A;  3IT9 A;  1MC0 A;  4YFM A;  3UN7 A;  4LCL A;  2CC1 A;  4KG5 A;  3FPV A;  4LGW A;  4MNR A;  1ACF A;  2J9O A;  1PRQ A;  1LHY A;  4MBK A;  4NEE D;  3M6B A;  3D4F A;  2PYR A;  5DVA A;  2INW A;  2X02 A;  4IBX A;  4HJ3 A;  4QD4 A;  2IWD A;  1S4S A;  3F1P B;  4E6W A;  1K6R A;  2IA2 A;  3RH8 B;  1MWS A;  1KOU A;  3UPP A;  4O01 A;  1FQG A;  4PM9 A;  2X01 A;  4CQH A;  1CEG A;  1PI5 A;  4JLF A;  1VET A;  3OC2 A;  5FL3 A;  1LI0 A;  2Y2I A;  3OZH A;  1EI5 A;  1KE4 A;  4N1H A;  3P09 A;  2EXA A;  5A91 A;  1J9M A;  3BFD A;  1ZTU A;  2QMI A;  5DTK A;  2O9C A;  4KZ4 A;  4HP4 A;  4OPR A;  5EVI D;  1L2S A;  1NYY A;  4GW9 A;  2VV6 A;  1DP9 A;  3CJM A;  1O07 A;  4RVA A;  3N8L A;  1MKI A;  3LO7 A;  2EWV A;  4GJ4 A;  1VET B;  1XPB A;  3B33 A;  3CG5 A;  1XKZ A;  2HP9 A;  4R0Q A;  3BLM A;  5L09 A;  2KDK A;  1TS7 A;  2HJ9 C;  4LRZ E;  4OOY A;  3CUE C;  2UV0 E;  3CMZ A;  3KYE A;  4KZB A;  1RCJ A;  1ODV A;  1YT4 A;  5KSH A;  2IWC A;  1TF1 A;  4QPR A;  4GD6 A;  3HLD A;  2IWB A;  2ZC7 A;  4IED A;  4HY8 A;  1SKF A;  2XD1 A;  3SS4 A;  1PFL A;  2ZQC A;  2X71 A;  2PU4 A;  2OSU A;  3DW0 A;  3ZG5 A;  1K25 A;  3S22 A;  4WBG A;  3PBQ A;  2Y2H A;  1YPR A;  4KZ6 A;  4OH0 A;  5D3O A;  1S67 L;  5GL9 A;  1ZC2 A;  1XFN A;  3NOU C;  4DJ2 A;  3BQ8 A;  1HZO A;  2W1R A;  3MQO A;  2BLS A;  3T1Q B;  3KYZ A;  3HRE A;  5KIZ A;  2V20 A;  1JTG A;  4KUK A;  1AXB A;  1P97 A;  1F98 A;  4HBT A;  1V9Y A;  2OOL A;  3Q7Z A;  2J3T D;  4I38 A;  4JBF A;  2WKQ A;  2LB9 A;  2XFT A;  3EGD C;  1I2S A;  3OPH A;  3MFX A;  4FUW A;  1E3U A;  3BYD A;  2JKT I;  3MXQ A;  1DY6 A;  2JKR I;  5BOH A;  4EUZ A;  4KZ7 A;  4Z1W A;  4BL3 A;  4FH2 A;  2WZX A;  4P6B A;  1BYW A;  3T4L A;  5DTT A;  1MZU A;  3BY9 A;  3WS5 A;  4XXR A; 
#chains in the Genus database with same CATH homology
 1K6S A;  1BUE A;  2XDM A;  2WKE A;  5CTN A;  5GLA A;  1PWD A;  3G2Z A;  1NJ4 A;  1XA1 A;  3ZGA B;  3HLF A;  1BSG A;  1TDG A;  2EFU A;  2Y2N A;  4MBF A;  5HAQ A;  3MKE A;  4WM9 A;  4B4Z A;  3SH7 A;  4OP8 A;  3VP4 A;  2ZJ9 A;  3RJU A;  2XFS A;  4LV3 A;  4GOG A;  3UDF A;  4E3N A;  4ZDX A;  5EOE A;  2GDN A;  5A92 A;  1L0F A;  3ZG0 A;  3G35 A;  2BG1 A;  3VSK A;  3ZG7 B;  4MEZ A;  1LL9 A;  3IF6 B;  1Z6F A;  5F82 A;  2XF3 A;  5FA7 A;  1ES3 A;  2ZQD A;  5IHV A;  1KGG A;  1XA7 A;  3HBR A;  4O7D A;  1CEF A;  1Q2Q A;  1E25 A;  1LLB A;  3O87 A;  4FSF A;  2VGJ A;  2WKH A;  3V5M A;  5U47 A;  5CGW A;  4Z9Q A;  1YLJ A;  4HBU A;  1H8Z A;  4R1G A;  1H8Y A;  3NDE A;  1XGJ A;  1BUL A;  2Y2L A;  4JF6 A;  5HX9 A;  4HES A;  5GHZ A;  3WS4 A;  5E2H A;  1DJB A;  3HUM A;  3HLE A;  2ZLY A;  1FOF A;  3RXW A;  3LY4 A;  5FQK A;  1YMS A;  3UDI A;  3UO9 A;  4S2N C;  4FH4 A;  4X55 A;  5AQB A;  2EX6 A;  3BFC A;  3P98 A;  4WMC D;  3ZFZ A;  2OLV A;  1FR1 A;  3O3V A;  5AQ7 A;  2Y2M A;  3OPP A;  4OP5 A;  1FSY A;  1W5D A;  2J8Y A;  4WEK A;  5FAP A;  4K91 A;  4JKT A;  1VM1 A;  4LCM A;  4QJG A;  3E2L A;  3Q7V A;  1K56 A;  4OKP A;  1NRF A;  3AGF A;  4OOM A;  5KZH A;  3ZVW A;  2WGV A;  1XX2 A;  5CHU A;  1MPL A;  1KE0 A;  5TR7 A;  3VP1 A;  1K4F A;  3IWQ A;  3MFD A;  4MBH A;  4QU3 A;  4BL2 A;  3BFE A;  1ONH A;  3EQV A;  3MBZ A;  5FQQ A;  4OPY A;  3BEC A;  1XXM A;  2WAF A;  4XUX A;  2WGW A;  2C6W B;  5CRF A;  5E2G A;  5FI6 A;  5HAI A;  1W7F A;  4B88 A;  4Y0T A;  4EQI A;  4P85 A;  4WEJ A;  1BLP A;  4JXW A;  4E3K A;  3GVB A;  4DXB A;  3OCN A;  2ZD8 A;  3QNC A;  5DF9 A;  5AQ9 A;  1YQS A;  5GLD A;  4N9K A;  1KDW A;  2HPB A;  1YLZ A;  4PM6 A;  4S2K A;  1K54 A;  4YIN A;  4OLD A;  1GCE A;  2EXB A;  4X69 A;  5GHY A;  3IHA A;  4M3K A;  4KZ8 A;  4BEN A;  1ESU A;  1MBL A;  4DF6 A;  3NI9 A;  4N9L A;  4OON A;  3O86 A;  3N8S A;  2Y2P A;  1M6K A;  4K0W A;  2ZC5 B;  1SHV A;  3G31 A;  2XD5 A;  3A3D A;  5KSC A;  3GSG A;  3Q7V B;  3VSL A;  1BLH A;  2WYX A;  1EWZ A;  4P0M A;  3ZDJ A;  4BLM A;  4PM8 A;  2HDU A;  3PBN A;  3UE3 A;  3ZG8 B;  1C3B A;  3VOZ A;  4H8R A;  1ZKJ A;  3N6I A;  1HVB A;  5JYO A;  3OPR A;  2WGW B;  3G30 A;  4LV0 A;  1IYP A;  4B4X A;  3PBT A;  3MZD A;  3NIA A;  1NXY A;  4S2P A;  1ES5 A;  4S2M A;  1N4O A;  4GN2 A;  4Y0U A;  2ZQ7 A;  1K55 A;  3GMW A;  4D2O A;  3AGE A;  5I94 A;  4OPZ A;  4ZJ3 A;  1JWP A;  1YMX A;  4S2L A;  4Y7P A;  2R9X A;  2JC7 A;  4R4R A;  1TDL A;  3UNW A;  3JYI A;  1VQQ A;  3IXD A;  2HP5 A;  3V3R A;  4CJN A;  1FR6 A;  3A3J A;  3M2K A;  5L2F A;  2UWX A;  5E2F A;  2A49 A;  3IWO A;  3SH9 A;  3NCK A;  1CK3 A;  4R4S A;  3VP2 A;  3WS2 A;  1MXO A;  3C4P A;  3VFH A;  5FQM A;  1N9B A;  2WUQ A;  4KZ9 A;  2E8I A;  4NK3 A;  3V39 A;  1RGY A;  3C4O A;  3FV7 A;  5JYP A;  1GHP A;  4XUZ A;  1S0W A;  2WK0 A;  3BEB A;  1GA9 A;  3A3E A;  4U0T A;  4KZA A;  3I7J A;  1SDE A;  3WS0 A;  3TSG A;  1FCN A;  4N1X A;  2ZM0 A;  3NBL A;  1TVF A;  3MZE A;  4BD0 A;  5M19 A;  5E43 A;  1BLS A;  3QNB A;  4WMC A;  3UE0 A;  4JXS A;  2Y59 A;  1JTD A;  3HUN A;  3W4O A;  3GTC A;  4KQQ A;  2EX8 A;  3SS3 A;  3C7U A;  1GHM A;  4WYY A;  4E3J A;  3RXX A;  1JWZ A;  4OLG A;  1H5X A;  4WZ5 C;  2V2F F;  3FKV A;  3M6H A;  3Q1F A;  3PBO A;  2G2W A;  2ZM8 A;  1FCM A;  3LCE A;  5DF7 A;  4OQ0 A;  5KMW A;  1KE3 A;  4JF4 A;  4GB7 A;  5FSR A;  1SDN A;  3PAE A;  4UAA A;  3NY4 A;  3OCL A;  3BFG A;  3UPN A;  4X6T A;  1IYO A;  1KVM A;  1JWV A;  2XR0 A;  2QZ6 A;  2FFY A;  3HLC A;  1IKG A;  4EV4 A;  2FFF B;  1U60 A;  2Y2G A;  4HEF A;  3ZHH A;  2Y4A A;  3TOI A;  5GLB A;  4QY6 A;  1ESI A;  4KQR A;  2Q9N A;  5HW3 A;  4OQI A;  4GKU A;  3ZNT A;  1YLP A;  3DWK A;  5G18 A;  1K38 A;  1IYQ A;  4X53 A;  3NDG A;  4Q8I A;  2EX9 A;  5EEC A;  3FWL A;  4GDN A;  4S2N A;  3AGD A;  3PTE A;  1W79 A;  4QB8 A;  4DDY A;  4F94 A;  1MWR A;  3VMA A;  1SCW A;  3IF5 A;  1GHI A;  3CZD A;  1L0G A;  3VP0 A;  4DE1 A;  4R3B A;  3S4X A;  3PAG A;  1YLY A;  4UA9 A;  5CHM A;  4C3Q A;  5TGF A;  4L0L A;  3IT9 A;  1ERQ A;  2P9V A;  1YM1 A;  4YFM A;  3UN7 A;  4LCL A;  3FKW A;  3O88 A;  2CC1 A;  3GR2 A;  1IEM A;  5FAQ A;  4KG5 A;  4C75 A;  1DJC A;  4R23 A;  4LV2 A;  4RA7 A;  3ZCZ A;  4UHU A;  2HDR A;  2J7V A;  4BD1 A;  2WAD A;  4MNR A;  2J9O A;  3C5A A;  4OQH A;  2DRW A;  1TEM A;  1KGF A;  1LHY A;  4MBK A;  3WRZ A;  5FI2 A;  3M6B A;  4DRT A;  1I2W A;  2Y2K A;  3D4F A;  3ITA A;  3ZNY A;  5CEB A;  5CEC A;  1LI9 A;  2JE5 A;  2OLU A;  3Q07 A;  1M40 A;  2ZC3 B;  4R3J A;  2I72 A;  3G4P A;  5DVA A;  1K57 C;  3OPL A;  2X02 A;  3GV9 A;  4IBX A;  3HVF A;  3W8K A;  4RX3 A;  4GD8 A;  1QMF A;  4QD4 A;  5FQ9 A;  1PI4 A;  4KZ5 A;  2IWD A;  5EVI C;  1FSW A;  5J8X A;  4RX2 A;  2XEP A;  1NYM A;  4E6W A;  4GZB A;  2ZM2 A;  1K4E A;  3ISG A;  5FI7 A;  1CI9 A;  3HLW A;  2EX2 A;  1NY0 A;  1K6R A;  2Y2Q A;  4IVK A;  1ERO A;  1WYB A;  2ZQA A;  1MWS A;  3UPP A;  3IHB A;  2P9V B;  2H0Y A;  3E2K A;  1PWG A;  3G34 A;  2JBF A;  2VGK A;  4JF5 A;  3HLG A;  2QPN A;  4QY5 A;  5M18 A;  1FQG A;  2P74 A;  4PM9 A;  2X01 A;  1CEG A;  3N4I A;  4DKI A;  2XQZ A;  1PI5 A;  5DTS A;  3IH8 A;  3SOI A;  3HUO A;  4JLF A;  1LL5 A;  3OC2 A;  2Y2O A;  4IVI A;  1S6R A;  1LI0 A;  1NZU A;  1Y54 A;  1WYC A;  1PW8 A;  1EI5 A;  2Y2I A;  3IF6 C;  3OZH A;  3Q82 A;  2DCF A;  1Q2P A;  2Q9M A;  1KE4 A;  3ZG9 B;  4N1H A;  5CTM A;  2ZC4 B;  4ZTK A;  3V50 A;  2V1Z A;  5CGS A;  4ZBE A;  3P09 A;  1BT5 A;  4QHC A;  2EXA A;  5A91 A;  5CHJ A;  3DTM A;  4PMA A;  1J9M A;  5M1A A;  3BFD A;  1HD8 A;  1PZO A;  5HAP A;  3MZF A;  5EUA A;  5HFO A;  3BM6 A;  2QMI A;  5DTK A;  2WAE A;  4EBN A;  4DE0 A;  2WZZ A;  5AQA A;  4KZ4 A;  1KVL A;  4PPR A;  5EE8 A;  1IEL A;  1KDS A;  2XH9 A;  2Y91 A;  1XGI A;  5DF8 A;  4OPR A;  5EVI D;  1ES4 A;  1L2S A;  3M2J A;  1I5Q A;  3HL9 A;  1NYY A;  3NC8 A;  3GQZ A;  3BRM A;  1MY8 A;  4UA6 A;  2J9P A;  1O07 A;  1O7E A;  3CJM A;  4RVA A;  4E3I A;  4CPK A;  3N8L A;  2ZQ8 A;  4K0X A;  1MKI A;  3LO7 A;  4BJP A;  1MWU A;  4U3T A;  5F1G A;  3ZVT A;  4C6Y A;  2DNS A;  3UE1 A;  1MWT A;  4JXV A;  3VOY A;  1XPB A;  1YLT A;  3CG5 A;  4S2I A;  1OME A;  2PBY A;  1G68 A;  1XKZ A;  2C5W B;  2HP9 A;  2WGI A;  3BFF A;  1ZG6 A;  4R0Q A;  3BLM A;  2Y2J A;  3G2Y A;  3PBR A;  4WZ5 A;  4OOL A;  5A93 A;  2G2U A;  4ZAM A;  2ZMA A;  4OOY A;  4E6X A;  4E3O A;  3UDX A;  4A5R A;  1E3U D;  4DE2 A;  1IYS A;  3CMZ A;  4KZB A;  3QHY A;  4RYE A;  4XXR A;  2HP6 A;  5F1F A;  3LY3 A;  4OPQ A;  3WS1 A;  4KG6 A;  3B3X A;  1RCJ A;  1QME A;  2XLN A;  1JVJ A;  1YT4 A;  4ZJ2 A;  5KSH A;  2IWC A;  3FYZ A;  3S1Y A;  3N8R A;  4JXG A;  1BZA A;  3HLB A;  3DWZ A;  4GD6 A;  4EWF A;  3HLD A;  2IWB A;  2ZC7 A;  4IED A;  4PM5 A;  1SKF A;  2XD1 A;  4N92 A;  5HL1 A;  4U0X A;  5CED A;  3MXS A;  3SS4 A;  3MKF A;  3WWX A;  2HDQ A;  4KZ3 A;  1GA0 A;  5EPH A;  5FAO A;  2ZQC A;  2X71 A;  4KG2 A;  2PU4 A;  2OSU A;  3DW0 A;  3VFF A;  3ZG5 A;  1RGZ A;  4X56 A;  4S2J A;  1K25 A;  3S22 A;  1E4D A;  4WBG A;  3PBQ A;  4EBL A;  3W4Q A;  2Y2H A;  1W8Y A;  3MXR A;  5EOO A;  4OVD A;  3Q81 A;  5CGX A;  4BQM A;  3UPO A;  4KZ6 A;  1KGE A;  3PBS A;  5FDH A;  4LV1 A;  2B5R A;  4EBP A;  4NET A;  4X68 A;  1K54 C;  4OH0 A;  5D3O A;  5CER A;  2Y55 A;  1ALQ A;  4WZ4 A;  5GL9 A;  2H0T A;  1ZC2 A;  5F83 A;  1PZP A;  4E3L A;  4UA7 A;  5HAR A;  3A3I A;  5EVL A;  3EQU A;  4LEN A;  3C7V A;  2RCX A;  4KQO A;  3IQA A;  2PU2 A;  1K57 A;  2XGN A;  1HZO A;  3GRJ A;  3IXB A;  2A3U A;  2BLS A;  4KEN B;  3TG9 A;  1ES2 A;  5FQI A;  3A3F A;  4GNU A;  4ZJ1 A;  1HTZ A;  2ZC6 B;  4S2O A;  4WEL A;  5EVI A;  1PIO A;  1PYY A;  1PWC A;  2JCH A;  2Z2M B;  2ZQ9 A;  3G32 A;  4P87 A;  3HRE A;  3UY6 A;  2V20 A;  1JTG A;  1K56 D;  1AXB A;  2H5S A;  1BLC A;  1ERM A;  2RL3 A;  2XK1 A;  5E2E A;  4E3M A;  1NZO A;  5GLC A;  4GDB A;  1YLW A;  2R9W A;  5FQJ A;  3IXG A;  5GHX A;  2EFX A;  5CXW A;  4HBT A;  1K55 C;  3SH8 A;  3FZC A;  1DJA A;  3Q7Z A;  3IXH A;  3V3S A;  3SS5 A;  1IKI A;  4JBF A;  2XFT A;  1I2S A;  1WE4 A;  1BTL A;  3OPH A;  3BLS A;  4Y0O A;  1XP4 A;  3IF6 A;  1W8Q A;  1ZG4 A;  3ITB A;  4JPM A;  5FAS A;  1PW1 A;  1E3U A;  1RP5 A;  3BYD A;  1G6A A;  4DDS A;  3WRT A;  4DE3 A;  1DY6 A;  4IBR A;  3LEZ A;  3N7W A;  2OV5 A;  3IWI A;  4MLL A;  5BOH A;  1FCO A;  4EUZ A;  4KZ7 A;  4FCF A;  4BL3 A;  1CI8 A;  4FH2 A;  2WZX A;  4P6B A;  2HDS A;  1L0E A;  4ID4 A;  5A90 A;  5DTT A;  2Z2L B;  5TFQ A;  5FAT A;  3WS5 A;  5EVI B;  3IH9 A;  3W4P A;  4PM7 A;  4DXC A;  2H10 A;  2WKI A;  1L0D A;  4OQG A;  4FD8 A;  3VP3 A;  1ONG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...