3SH8A

Crystal structure of fluorophore-labeled beta-lactamase penp in complex with cephaloridine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
257
structure length
253
Chain Sequence
KDDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFCPENPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increased structural flexibility at the active site of a fluorophore-conjugated beta-lactamase distinctively impacts its binding toward diverse cephalosporin antibiotics
pubmed doi rcsb
molecule keywords Beta-lactamase
molecule tags Hydrolase/antibiotic
source organism Bacillus licheniformis
total genus 84
structure length 253
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3sh8A00
2EX9A 4JF6A 3NDGA 4OH0A 4ZAMA 1EWZA 3W8KA 2JE5A 3G4PA 1ES3A 5L2FA 4ZTKA 3HVFA 3PBSA 1LI0A 1E3UA 2XFSA 1QMFA 3G30A 4KZ7A 4GNUA 3CMZA 2XK1A 3UE1A 3ZVWA 4CJNA 4B88A 3BFDA 4PPRA 1K54A 4EQIA 1XA7A 4BL3A 4DE0A 4OQHA 4RVAA 2ZJ9A 2QMIA 5TR7A 3A3FA 5DTSA 5I94A 1JVJA 4JXGA 3G2YA 4N9KA 3NCKA 3LO7A 3QNBA 3GRJA 2H0YA 2A3UA 3PBNA 2Y2MA 3Q07A 3IHAA 3ZGAB 3W4QA 3BLSA 3WS1A 4GDBA 1JWZA 4PM9A 3G2ZA 2ZC5B 1PZPA 2P74A 2XF3A 3IF5A 4Z9QA 1IEMA 2HP6A 2PBYA 2G2WA 3OCNA 4C6YA 4FD8A 1K6RA 3BYDA 1PWDA 4X53A 1MY8A 3IH8A 4DF6A 2P9VA 4OPZA 5HAIA 2A49A 3AGDA 2EXAA 4S2PA 5DF7A 4EWFA 4WMCD 5EVIA 4QY5A 4WZ4A 2XLNA 1LLBA 5E2HA 2ZC3B 5GHYA 4Y7PA 2ZMAA 3GTCA 1K54C 2DRWA 5DVAA 4ZJ2A 5JYOA 2H0TA 4K0WA 4WELA 4OLDA 4DDSA 3EQVA 4JKTA 3IXDA 1KDWA 1O07A 3GMWA 3SS4A 1YLTA 3OPLA 3TSGA 4BD1A 4OQGA 3G35A 4ID4A 2BG1A 3NDEA 1IYPA 2OLUA 1XP4A 2WAFA 3MZFA 3CJMA 1PIOA 4YFMA 1TEMA 3N6IA 3NI9A 4X55A 3VP3A 4ZBEA 4KZ8A 4O7DA 3LCEA 1YMSA 1MBLA 2C5WB 2V20A 3A3DA 3HLDA 1H8ZA 5G18A 4OVDA 4CPKA 3HL9A 3GVBA 2J7VA 2Y2KA 1TDGA 4RYEA 4P6BA 4LENA 4JF4A 3N8LA 4QB8A 2J9PA 2VGKA 4KZBA 3WS2A 2B5RA 3IF6A 1M40A 3N8RA 3WRTA 3WWXA 2WUQA 3FV7A 3SOIA 2HP9A 1K56A 3O3VA 3UDFA 1FCMA 3OCLA 3OPPA 3IT9A 4EBLA 3SH8A 5CTMA 5CECA 5CEBA 4B4XA 4A5RA 1YMXA 1YLWA 4IBRA 5CERA 1BUEA 1CK3A 1DJAA 1TDLA 2E8IA 2ZQAA 5FDHA 3QNCA 4KQRA 1K57A 3ZNTA 1G68A 4JXWA 2C6WB 3UPNA 1YM1A 3E2KA 5GHXA 3BFGA 2XDMA 1PW1A 3HLEA 1LI9A 4M3KA 5EECA 1HVBA 4X68A 3ZNYA 5E2FA 3O87A 1PI4A 5CHMA 1ZG6A 3Q7ZA 1Y54A 1XGJA 4YINA 3ZHHA 3VP4A 1DJCA 4RX2A 5GHZA 1NJ4A 4IVKA 3GQZA 5CHJA 2EFUA 3BRMA 4E6WA 5FQMA 3MXRA 5M18A 4OONA 1VQQA 3HBRA 4N9LA 5M1AA 2XD1A 3S4XA 4E6XA 1RGYA 4MBKA 3V5MA 3G32A 5CHUA 4LV1A 5FAPA 1IYQA 4FCFA 3WS4A 2HDQA 2X02A 1L0EA 1Z6FA 2ZQ8A 4E3IA 3UE3A 2Y2JA 3FYZA 4DKIA 2WGWB 4OP5A 3LY4A 1K6SA 1NYMA 3FWLA 1DJBA 1YLYA 2HPBA 3RJUA 1K57C 1SCWA 4R0QA 1S0WA 1N9BA 2VGJA 2ZQ9A 2J8YA 1MWRA 4UA9A 4UHUA 3DWKA 5DF8A 4GB7A 4WMCA 2V2FF 1HTZA 1G6AA 2WADA 1KE0A 3SH7A 4KG2A 5M19A 4R3BA 2BLSA 1E4DA 1L2SA 2EFXA 3ZCZA 1ZG4A 3ISGA 1GA0A 4P0MA 4C3QA 3WRZA 4WYYA 4GD6A 3IHBA 4QD4A 1MWSA 4HBUA 1IYSA 1PWGA 3IQAA 1IELA 1NZOA 1W5DA 3IWIA 4R4SA 5CGSA 3IXHA 1GHIA 2IWCA 5FI6A 2H10A 1BTLA 2XQZA 3NIAA 4OQ0A 5AQBA 3C5AA 3N7WA 1HZOA 1L0FA 5FQJA 1L0GA 1GHMA 1YT4A 2ZQDA 2Y2OA 1SKFA 1JWVA 2WYXA 4BL2A 3HLWA 3BFFA 5F82A 3HUMA 3PBOA 4EBNA 1XKZA 3A3JA 5FQQA 5FQ9A 1SHVA 2ZLYA 2V1ZA 3E2LA 3BLMA 1BSGA 1OMEA 3M6HA 2Y2QA 4MNRA 5A92A 1BLHA 3A3IA 1EROA 2Y2PA 3ITAA 2OV5A 5JYPA 5A91A 2Y4AA 1E3UD 5A93A 4DXCA 3ITBA 1VM1A 1KE3A 1NYYA 2WZXA 5AQAA 1XGIA 1MWTA 1XA1A 4JXSA 3QHYA 3HUOA 5GLAA 2EXBA 4JBFA 4MLLA 2EX6A 4DDYA 5F83A 5FASA 1C3BA 4LV2A 1FCOA 4DE3A 3Q7VB 3ZG9B 1ERMA 4R23A 3JYIA 3IH9A 1BZAA 5E43A 2Y2IA 1ZC2A 4WBGA 3UN7A 4BENA 2GDNA 3ZG0A 4RA7A 3RXXA 1W79A 4R1GA 4U0XA 4E3MA 5DF9A 3A3EA 1PWCA 2JCHA 4D2OA 1ONHA 1FCNA 1I5QA 1Q2PA 4IBXA 4L0LA 3B3XA 4OOMA 1K55A 1JWPA 1SDEA 4S2MA 2UWXA 5EVID 1NZUA 2XEPA 1K4FA 2FFYA 2WAEA 4XXRA 1CEFA 3UE0A 5AQ9A 1KDSA 1NRFA 1BLSA 5KSCA 3VP2A 4KQQA 2JBFA 2XH9A 5U47A 3I7JA 3LEZA 1KGEA 1ES4A 4DE2A 3P98A 5CRFA 3UDIA 3VOZA 2IWBA 3MBZA 3Q7VA 5CXWA 4FH4A 4OPYA 2PU4A 4UAAA 1MKIA 4H8RA 5EOEA 5HARA 4KZ4A 3Q1FA 3SH9A 3N8SA 1WYCA 3PBTA 1ESUA 1MWUA 5HAQA 2Y2GA 4B4ZA 4BD0A 4E3KA 3GSGA 2WGVA 2WGIA 3D4FA 3MXSA 3O86A 1IYOA 3ZG7B 1RCJA 3VP1A 4IEDA 4PM5A 1FQGA 5KSHA 3MFDA 4EUZA 5KMWA 1NY0A 3VFHA 1NXYA 4S2OA 4GDNA 4S2LA 5DTKA 3ZVTA 4KZAA 5HX9A 3VFFA 3ZDJA 5J8XA 4OQIA 5CGXA 1K55C 2Y2NA 4GN2A 3NC8A 2PU2A 4KQOA 1GCEA 1U60A 4KENB 3DWZA 1CI8A 2XR0A 1E25A 4KG6A 1FSWA 4S2KA 3V50A 4NETA 3ZG5A 4E3JA 2OSUA 1K56D 4ZDXA 1MPLA 4KZ6A 4Y0TA 1BT5A 3V3RA 3MKEA 4FSFA 1LHYA 3VOYA 1Q2QA 3OC2A 5KZHA 4F94A 2ZQ7A 3HUNA 4PMAA 5GL9A 3UO9A 4WZ5C 3AGFA 3BEBA 4JLFA 5DTTA 2Y55A 4QY6A 1QMEA 3PBRA 1O7EA 1L0DA 3PBQA 3ZFZA 2P9VB 3SS5A 2X71A 2R9WA 2I72A 4OPQA 2WK0A 5EPHA 2ZM0A 3SS3A 4MBFA 5EVIB 2J9OA 3BM6A 4UA6A 3AGEA 4ZJ3A 3M2JA 3WS0A 5EVLA 1H8YA 3OZHA 4R3JA 1WE4A 3TG9A 1ES5A 3PAEA 4C75A 4GD8A 2ZM2A 3Q82A 4OLGA 3VSLA 2DCFA 3IXGA 4LCLA 3VSKA 4BJPA 1K4EA 4RX3A 5HL1A 3C4PA 3TOIA 4KG5A 3G34A 1DY6A 3OPHA 2EX2A 5IHVA 4HBTA 4S2JA 5EOOA 5FI2A 5FSRA 4BLMA 3M6BA 4QJGA 3UNWA 3C7VA 2ZM8A 4XUZA 2WGWA 1BULA 2OLVA 2Y2LA 2G2UA 1YLPA 4GZBA 4PM7A 4S2NC 3NY4A 5EE8A 3PAGA 1ESIA 1K38A 4N92A 2EX8A 2HDSA 3DW0A 5HFOA 1LL9A 5GLBA 4Q8IA 1LL5A 1SDNA 2XGNA 1KE4A 1KVMA 4OP8A 5FATA 4LCMA 3ZG8B 2WKHA 3DTMA 1ES2A 1K25A 3P09A 5AQ7A 3PTEA 4P85A 1ONGA 3S1YA 3W4OA 3W4PA 5FAQA 1XX2A 1I2WA 1ALQA 1XPBA 3EQUA 3HLFA 5A90A 1PW8A 2DNSA 5FI7A 1J9MA 1N4OA 4P87A 2X01A 3VMAA 2H5SA 3IF6B 2Y91A 1WYBA 3MKFA 1HD8A 1KGGA 1YLZA 4DXBA 2RCXA 2HDUA 3GV9A 5TFQA 4LV3A 4Y0UA 3FKWA 4HESA 3N4IA 2Y2HA 4WEKA 1PZOA 4OOLA 5EUAA 1IKGA 1H5XA 4NK3A 2HDRA 2QPNA 5HAPA 4K0XA 4K91A 2XD5A 4EBPA 1MXOA 3HLGA 4X6TA 4WM9A 2Q9MA 1I2SA 3LY3A 3NBLA 1YLJA 2HP5A 3UDXA 5E2EA 2ZQCA 3RXWA 3G31A 2ZC6B 1RP5A 4MEZA 2Q9NA 2R9XA 4R4RA 3OPRA 4E3NA 2JC7A 2ZD8A 1BLCA 1GA9A 4JXVA 1W8YA 5FQKA 1ERQA 3MZEA 1PI5A 1IKIA 4LV0A 1FR6A 3BFEA 4KZ3A 4QU3A 3HLCA 2ZC4B 4WEJA 3HREA 1JTDA 3HLBA 4X56A 5HW3A 5EVIC 3UPOA 4PM8A 2ZC7A 4BQMA 4PM6A 1FR1A 2WKEA 4WZ5A 3C7UA 1M6KA 1CEGA 3FKVA 1FOFA 1KVLA 2Z2LB 4U3TA 1YQSA 5D3OA 3UY6A 2FFFB 4FH2A 1GHPA 4ZJ1A 3O88A 4E3OA 2Z2MB 3BECA 4E3LA 3BFCA 1TVFA 3V3SA 3MZDA 4QHCA 3WS5A 5E2GA 1AXBA 4DE1A 3Q81A 4IVIA 2Y59A 5CTNA 1KGFA 3S22A 3GR2A 3IWOA 4S2IA 5CGWA 3V39A 1PYYA 2WKIA 3FZCA 1XXMA 4N1HA 5TGFA 1W8QA 4OKPA 4U0TA 1FSYA 1CI9A 4UA7A 5BOHA 4GKUA 4JF5A 4OOYA 4X69A 3CG5A 4EV4A 2RL3A 4XUXA 4Y0OA 5FAOA 5FA7A 1S6RA 4MBHA 5GLCA 4KZ9A 5FQIA 5GLDA 5F1GA 4JPMA 4S2NA 2CC1A 4OPRA 2WZZA 3C4OA 3UPPA 3CZDA 3IWQA 1RGZA 3M2KA 1W7FA 4HEFA 1JTGA 1EI5A 3IF6C 5F1FA 3VP0A 4DRTA 1ZKJA 3IXBA 2XFTA 2IWDA 1BLPA 2QZ6A 5CEDA 4KZ5A 4N1XA 4GOGA
chains in the Genus database with same CATH superfamily
1EWZA 3H82B 3G4PA 4R70A 3PBSA 1E3UA 3CMZA 2XK1A 4MN7A 4PPRA 1K54A 3T4QA 4I39A 2QMIA 4HP4A 3A3FA 4QPRA 4JXGA 3G2YA 3NCKA 4O01A 4HJ4A 3PBNA 2CMNA 3W4QA 3BLSA 3WS1A 4GDBA 1PZPA 2A24B 1UWNX 1IEMA 2G2WA 4LFUA 1GSXA 4C6YA 2J3TC 1K6RA 2XSSA 3KSIA 4EEPA 1PWDA 3QP8A 3IH8A 4DF6A 1AWIA 3AGDA 5DF7A 4WZ4A 3H82A 4E04A 3GTCA 3MQ0A 4ZJ2A 4K0WA 3PR6A 4NXBA 4OLDA 3MFXA 4JKTA 3SS4A 3TSGA 3B47A 3G35A 3TW8A 2HJ9C 3NI9A 3VP3A 2J3WA 4KZ8A 2ZL1A 4MDZA 1MBLA 1W63Q 5AVFA 2OAP1 2Y2KA 1P9WA 4HOIA 4JF4A 4KZBA 1M40A 2VV7A 3FV7A 1K56A 3IT9A 3IBRA 5MC7A 1MZUA 4B4XA 1WA9A 2JHEA 1VHMA 2W27A 1TDLA 1K57A 3T12B 1VEUA 3T50A 2XDMA 1LI9A 3SZTA 4M3KA 4AFIA 5EECA 5DFYA 5CHMA 3T4SA 1ZG6A 2JKFA 1Y54A 3F1OA 3Q7ZA 4P6ZS 5G4ZA 1DJCA 3KYEA 3MXRA 1VQQA 3S4XA 4GHIA 4I38A 2HDQA 1L0EA 3CHWP 4E3IA 3S7QA 2VKSA 1Z09A 1A0KA 1NYMA 3FWLA 1L3LA 1LL8A 3S7PA 3RJUA 4Y5FA 4BBUA 4UHUA 3DWKA 1HTZA 2O9AA 1KE0A 3SH7A 5M19A 4Y13A 3T4OA 3ZCZA 4P0MA 3ISGA 4ARZB 3WRZA 3LR5A 4WYYA 3BQAA 4QD4A 1MWSA 5HPIA 1PWGA 1D06A 3CWFA 1TF1A 1W5DA 3IWIA 4R4SA 5CGSA 5FI6A 1ZTUA 3NIAA 4OQ0A 3C5AA 3N7WA 1YAXA 1GHMA 3HLWA 2M7UA 3DAVA 5DJTA 1XKZA 1SHVA 1TS7A 2ZLYA 2V1ZA 1TS8A 4NG2A 3LIDA 3W2ZA 3M6HA 1BLHA 2Y2PA 5A93A 1KE3A 1NYYA 3EGXC 2VGLS 4JGPA 4JXSA 2EXBA 1HLUP 4LV2A 2UV0E 2ZOIA 2W1TA 3L9KA 2Y2IA 3BJNA 4WBGA 2GDNA 1ONHA 4KQDA 2OWJA 3NULA 4OOMA 4S2MA 3LI8A 2XEPA 1K4FA 1CEFA 3D72A 3NECA 4WLAA 1BLSA 2JBFA 5U47A 1KGEA 4DE2A 4FH4A 3QP2A 4H8RA 5HARA 1WYCA 5HAQA 2Y2GA 3CLOA 4BD0A 2WGVA 3ZG7B 4WN5A 1FQGA 5KSHA 3F1NB 1NY0A 3VFHA 1NXYA 4S2LA 5HX9A 4OQIA 1K55C 3CI6A 3KYQA 3NC8A 2VEAA 4KENB 2AVXA 1FSWA 1BT5A 4EQ1A 1SKOB 3OC2A 4X1MA 3UO9A 3JVVA 3E4QA 2ZMFA 3D3OA 2P9VB 2FH5A 2ZM0A 3AGEA 3WS0A 3M2JA 1H8YA 2QJ7A 3OZHA 1WE4A 4CLCE 3EGDC 4GD8A 3CUEC 4BJPA 5HL1A 3C4PA 4EUVA 1H3QA 3G34A 3E0YA 4FTXA 3E4OA 5EOOA 4QJGA 1D1JA 3UNWA 3KSGA 2INWA 5EV0A 4RQ9A 1BULA 2G2UA 4S2NC 3PAGA 2KDKA 5GLBA 1SKOA 5FATA 4LCMA 4F3LB 1K25A 4P85A 4YNRA 2KLIA 2DNSA 5FI7A 1N4OA 3IF6B 5EVEA 4K08A 3N4IA 2VV6A 5HDDA 1IKGA 1OTEA 1YSQA 4K91A 2PBDP 2XD5A 4EBPA 1MXOA 4R6LA 4WM9A 1OJ5A 4PAUA 1RP5A 2Q9NA 2R9XA 4R4RA 4F3LA 1GA9A 3E4PA 1W8YA 3KX0X 2ZC4B 3HLBA 4X56A 2MJ6A 1Y4OA 1N9NA 4D60A 1ZHHB 1KVLA 3UY6A 3O88A 2Z2MB 1TVFA 1Y28A 3V3SA 4DE1A 3H7WA 3Q81A 4IVIA 5G4YA 5IU1A 4S2IA 5CGWA 2PD8A 1PYYA 5FL3A 3LIFA 3QP5A 4UA7A 5BOHA 4BBVA 2JKGA 4OOYA 4Y0OA 1T19A 4KZ9A 5GLDA 4S2NA 2QYBA 4OPRA 3CZDA 3M2KA 4HEFA 1JTGA 1EI5A 3VP0A 2IWDA 2XFTA 4KZ5A 2EX9A 4XT2B 3PHYA 3NDGA 4ZAMA 2JE5A 3HVFA 2XFSA 1QMFA 3CITA 4GNUA 3BFDA 4DE0A 4OQHA 3QP6A 5DTSA 5I94A 4N9KA 1DP6A 1OT6A 2Y2MA 3Q07A 5EM0A 1JWZA 2EWWA 3G2ZA 4PM9A 1OJGA 2ZC5B 4HJ6A 4LLOB 2P74A 4Z9QA 2W1RA 3BW6A 3IS2B 2XLNA 1LLBA 2ZMAA 1K54C 2HZ5A 5JYOA 1TD5A 4Z1WA 4DDSA 3MMHA 3MJQA 3IBJA 1O07A 4BD1A 4OQGA 2BG1A 1IYPA 2WAFA 3CJMA 2XROA 1PIOA 1TEMA 4ZBEA 3IX4A 4KUOA 4O7DA 1YMSA 2C5WB 2V20A 1H8ZA 4CPKA 4ETZA 5L10A 4PKYA 4RYEA 4MCWA 3N8LA 4HP9A 4QB8A 2J9PA 3K3DA 3N8RA 4Q0JA 2HP9A 3OCLA 5EFWA 4EBLA 2XA7S 1TS6A 4A5RA 1BUEA 1DJAA 5FDHA 3QNCA 3GECA 1G68A 3F1PA 3R7WA 2PYRA 3HLEA 2PR5A 1HVBA 1XJ6A 3ZNYA 5E2FA 4YINA 1NJ4A 3GQZA 3IX8A 5M18A 1T1AA 4N9LA 5M1AA 2XD1A 2NUPC 3G32A 3BY9A 4FCFA 1XJ2A 1Z6FA 2ZQ8A 3UE3A 2ZBBA 4OP5A 1VETB 4HH2A 1DJBA 1YLYA 1K57C 2ZQ9A 1N9BA 1MWRA 4G3WA 4GB7A 4WMCA 2PAVP 3KSHA 2WADA 5A8BA 4KG2A 1E4DA 1ZG4A 5IS1A 3CPTB 1T1BA 1GHIA 3B33A 1BTLA 4O0PA 1HZOA 3PBOA 3LR4A 5FQQA 3A3IA 2OV5A 4Q0IA 3ITBA 1VM1A 2WZXA 5AQAA 3TE8A 4JBFA 4MLLA 2EX6A 5LBRA 3ZG9B 2A24A 3JYIA 1DRMA 5E43A 2V1AA 3OBFA 3RXXA 3A3EA 4HH3A 2JCHA 4D2OA 1I5QA 4IBXA 4L0LA 1OTAA 1F9IA 2M1CA 2UWXA 1NZUA 4XXRA 2B95A 5AQ9A 5F5YA 5TJJA 2W3GA 5KSCA 2W3DA 1ES4A 2PR6A 2IWBA 5CXWA 5F6AA 2PU4A 1MKIA 5EOEA 3SH9A 2IA2A 3N8SA 1STZA 3MXSA 3O86A 1IYOA 4IEDA 4PM5A 4EUZA 5KMWA 2FZ0A 2K7SA 5CGXA 2L0WA 4EEUA 2PU2A 4KQOA 1U60A 3DWZA 1E25A 4KG6A 4E3JA 3ZG5A 2LB9A 2HGVA 4Y0TA 1LHYA 3VOYA 5KZHA 4UQIM 4PMAA 5GL9A 5FEGA 3AGFA 3BEBA 1QMEA 3JPUA 3PBRA 1O7EA 3T1SA 4NXFA 2WK0A 3LIAA 4MBFA 5EVIB 3BM6A 1T18A 4R3JA 3QP4A 3PAEA 5KIZA 3Q82A 2DCFA 4M4XA 3ULFA 4LCLA 3VSKA 3TOIA 4KG5A 5HDSA 5IHVA 1CQAA 5FSRA 2ZM8A 2J80A 4FUWA 5EE8A 1K38A 3MR0A 4N92A 2P08A 1LL9A 4EW7A 1LL5A 1KE4A 2WKHA 1ES2A 3FC7A 1ONGA 3S1YA 3W4PA 5FAQA 1XX2A 1XPBA 3EQUA 1PW8A 4P87A 5I5LA 4ARZA 1WYBA 3MKFA 1KGGA 4DXBA 2HDUA 4LV3A 2HF6A 1OTBA 4WEKA 4OOLA 5EUAA 5HAPA 3UMEA 2VX8A 3HLGA 4Y15A 1W63M 1YLJA 3TJZC 1ACFA 3T4LA 2ZQCA 2ZC6B 2JC7A 2ZD8A 1FILA 4JXVA 5FQKA 5L07A 3MZEA 1IKIA 2EWVA 1JTDA 5HW3A 3UPOA 4PM8A 1FR1A 1FOFA 5D3OA 2FFFB 2W0NA 4E3OA 4PKYG 3BECA 3MZDA 5E2GA 1AXBA 5CTNA 3RFBA 1OPXA 3C38A 1G5UA 1YKDA 4X69A 3CG5A 4EV4A 1JNUA 4XUXA 5FAOA 4MBHA 5FQIA 3MSHA 3IWQA 3UB6A 3IF6C 5DKKA 4HQAA 1BLPA 1OTIA 4GOGA 3W8KA 5K5BA 1LI0A 3ZVWA 4B88A 3A0SA 1XA7A 2GNXA 3F1NA 3RTYA 2L4RA 4P6ZM 4RVAA 2ZJ9A 1P97A 4L9EA 1JVJA 3LO7A 4WF0A 3QNBA 3GRJA 3C8CA 3T4JA 2VV8A 3IHAA 3ZGAB 2XF3A 3IF5A 3OCNA 4FD8A 3T1RA 3NHQA 2P9VA 5J3WA 4OPZA 3T1XA 4O8GA 2EXAA 4S2PA 4WMCD 4QY5A 4Y7PA 5DVAA 2H0TA 4DN0A 5HWVA 3EQVA 1KDWA 3K3CA 1YLTA 3OPLA 3G6OA 3FPVA 1G28A 1XP4A 2O0YA 4YFMA 3N6IA 1H8MA 3LCEA 3A3DA 4OVDA 3GVBA 2J7VA 5HDCA 2VGKA 2B5RA 3D9YA 4HNBA 3IF6A 3WRTA 2WUQA 4KUKA 3SOIA 5J4EA 3UDFA 3SW1A 1LSWA 1FCMA 1UWPX 2VGLM 5CTMA 5CECA 5CEBA 3LI9A 1GSWA 2EA9A 5AVEA 1CK3A 2ZQAA 2E8IA 4IUHA 4KQRA 3C30A 3HCYA 1YM1A 5GHXA 1EW0A 3JVUA 2ACGA 4CLCB 3EEAA 4JGRA 1PI4A 3CAXA 1XGJA 3VP4A 4RX2A 5GHZA 3ICYA 3UB7A 2PDRA 3BRMA 4E6WA 5FQMA 4OONA 2ZOHA 4MBKA 3V5MA 5CHUA 4LV1A 5FAPA 1IYQA 3WS4A 5DKLA 2ZMVA 3FYZA 4DKIA 3IX3A 2WGWB 2HPBA 4MN5A 3NOUC 4R0QA 1GSVA 2V2FF 3BWLA 5HZHA 1G6AA 3DBAA 3T1QB 1L2SA 2EFXA 3V67A 1GA0A 4HBUA 1LSVA 1IYSA 3IQAA 3MXQA 1ODVA 2IWCA 2XQZA 3FPWA 1SKFA 4BL2A 3BFFA 4XT2A 3P7NA 3A3JA 5FQ9A 3E2LA 1OMEA 2Y2QA 4MNRA 5A92A 1EROA 3ITAA 2Y8HA 5A91A 2Y4AA 2PHYA 3S7OA 2K2NA 1XGIA 1XA1A 3QHYA 3VV4A 5GLAA 4DDYA 5FASA 4R38A 1C3BA 1LSXA 4UEYA 3UE6A 1FCOA 4DE3A 3Q7VB 2WKQA 4R23A 5HL6A 2KOIA 3VE3A 1XFQA 1ZC2A 3UN7A 3LICA 2G7UA 4Q0HA 4E3MA 5DF9A 1T1CA 4HIAA 4WL9A 2V9AA 3IS2A 1FCNA 1Q2PA 1CF0A 1JWPA 4GLQA 5J7EA 5EVID 2W3HA 2FFYA 2WAEA 2R78A 4GW9A 3UE0A 1NRFA 3NJAA 3VP2A 4I3AA 2XH9A 3K2NA 3OLOA 4GJ4A 5CX7A 3P98A 1NRJA 3UDIA 3KO6A 3VOZA 3Q7VA 4UAAA 2W3EA 4KZ4A 3Q1FA 3PBTA 1PRQA 5HWTA 2WGIA 3LIBA 2VK3A 1NWZA 1D7EA 1S4SA 3BY8A 3MFDA 5DTKA 5FDSA 3VFFA 1G6OA 2PRFA 5J8XA 2PYPA 1CI8A 1TS0A 4NETA 3BQ8A 2GX5A 4ZDXA 4KZ6A 3E98A 2L1MA 3V3RA 1Q2QA 3VE4A 5DFXA 3LFVA 2ZQ7A 3HUNA 4HJ3A 5DTTA 2PD7A 3ZFZA 4B93A 2WKPA 1FIKA 2VLGA 2R9WA 5F68A 4BMWA 2J9OA 4UA6A 4ZJ3A 4NXEA 5EVLA 1ES5A 1J3WA 3VSLA 3IXGA 1NLYA 3UB5P 1DY6A 4EU0A 3OPHA 2EX2A 4HBTA 3H9WA 3VOLA 4BLMA 3C7VA 2OLVA 1K0KA 4PM7A 1VETA 1DP9A 3FG8A 4GZBA 1CJFA 1ESIA 2EX8A 2HDSA 5HFOA 3EWKA 2ZL1B 4Q8IA 4H6JB 2QWSA 3LIEA 3ZG8B 5AQ7A 1J9MA 2X01A 2H5SA 3QP1A 4I3IA 1YLZA 2RCXA 3CPTA 3GV9A 5TFQA 5FEFA 1OTDA 4DJ3A 1YPRA 1X0OA 4CQHA 3OOVA 1PZOA 4NK3A 2HDRA 2QPNA 1VEUB 2JN7A 2Q9MA 3LY3A 2HP5A 4I3JA 3UDXA 3RXWA 4H6JA 1V9YA 4E3NA 3F1OB 4HY8A 1ERQA 4IUKA 1PI5A 1FR6A 3BFEA 2K31A 3HREA 3TRCA 5EVIC 2ZC7A 3HJIA 4PM6A 4GHIB 2WKEA 3C7UA 1CEGA 1YQSA 4FH2A 4ZJ1A 4MMNA 4HI4A 3UMDA 4E3LA 4QHCA 2Y59A 1KGFA 3GR2A 3IWOA 3V39A 2WKIA 1XXMA 3B42A 4U0TA 1FSYA 2V8CA 1CI9A 4GKUA 4JF5A 4X25A 2RL3A 5FA7A 1S6RA 5F1GA 4LRZE 2V0WA 1RGZA 1W7FA 2XA7M 2D01A 3UB9A 1ZKJA 2O9CA 3IXBA 5L8MA 4DMZA 1N9LA 2QZ6A 5CEDA 4Y3IA 4BWIA 3C2WA 3PYPA 2JKRI 3LR0A 4JF6A 4G3VA 4OH0A 1ES3A 5L2FA 4ZTKA 1OT9A 4NKPA 3G30A 4KZ7A 3UE1A 4CJNA 4PHTA 4EQIA 4Y2FA 4BL3A 5TR7A 2B02A 1PFLA 2H0YA 2A3UA 4BBTA 2W1TB 2HP6A 2PBYA 3LEQA 3BYDA 4X53A 1MY8A 5HAIA 2A49A 4EWFA 5EVIA 4G3KA 5E2HA 2ZC3B 5GHYA 4CLCD 2DRWA 4EESA 4IHQA 4WELA 2H28A 3IXDA 4EXOA 2GJ3A 3GMWA 4B9OA 2XRNA 2YKFA 4ID4A 3NDEA 2OLUA 3MZFA 4GCZA 1LT0A 4LRXC 2O9BA 4X55A 5F69A 3HLDA 5G18A 3ZQ5A 2B18A 3HL9A 2JKRM 1TDGA 4P6BA 4LENA 1DP8A 3EOIA 3WS2A 4II7A 2JKTI 3WWXA 1S1YA 3O3VA 3P01A 2V1BA 3OPPA 3SH8A 1YMXA 1YLWA 4IBRA 4LRYC 5CERA 4R3AA 2DMWA 3ZNTA 2NUTC 4JXWA 2C6WB 3UPNA 3E2KA 1VB6A 3BFGA 1PW1A 1SZVA 5HD3A 4X68A 1S1ZA 3O87A 3ZHHA 4QWOA 2Z6DA 4IVKA 3LR3A 5CHJA 2EFUA 1S4RA 3HBRA 3DTEA 2QKPA 4E6XA 1H0MA 4LGWA 1RGYA 4NXGA 3MS6A 2X02A 2Y2JA 4YWZA 3LY4A 1K6SA 5HD5A 2BTFP 1SCWA 4LPZA 1S0WA 2VGJA 4JGOA 4UA9A 2J8YA 1XFNA 5DF8A 2OWHA 4FOFA 3LYXA 4R3BA 2BLSA 3R4KA 4C3QA 4MN6A 2P04A 4GD6A 3IHBA 4ESPA 1IELA 2JKTM 1NZOA 3IXHA 2H10A 5AQBA 5FQJA 1L0FA 1L0GA 1F5MA 1YT4A 2ZQDA 3MQQA 2Y2OA 1JWVA 2P7JA 2WYXA 3GDIA 2WKRA 5F82A 3HUMA 3LGOA 4EBNA 3BLMA 1BSGA 2KX6A 5JYPA 1E3UD 4DXCA 4CLCC 1PNEA 1MWTA 3HUOA 3PXPA 5F83A 5HWWA 2OOLA 4DJ2A 1ERMA 4L9GA 1MKMA 2E8JA 2QJ5A 4HHDA 3IH9A 4WUJA 1BZAA 3A0VA 4BENA 2YKHA 3H7WB 1YSPA 3ZG0A 4RA7A 1S67L 1W79A 4R1GA 4U0XA 1XJ3A 1PWCA 3UB8A 1MC0A 4L9FA 4X1LA 3B3XA 3T4KA 1K55A 1SDEA 5C5KA 3EEHA 5L09A 1KDSA 4KQQA 4YOFA 1N9OA 3I7JA 3LEZA 1S66L 5CRFA 4NEED 3MBZA 4OPYA 2VA0A 1XJ4A 1ESUA 1MWUA 1F2KA 4B4ZA 4E3KA 3GSGA 3D4FA 1RCJA 3VP1A 4EERA 3CUEA 4S2OA 4GDNA 3ZVTA 4KZAA 4ETXA 3ZDJA 2A2LA 3KSFA 2Y2NA 4GN2A 1GCEA 2XR0A 4S2KA 3V50A 5EM1A 2OSUA 1K56D 1MPLA 3U2AA 2O99A 3RH8B 3MKEA 4FSFA 4F94A 4WZ5C 1P9RA 4JLFA 2Y55A 4QY6A 4IJGA 1L0DA 1IOUA 3PBQA 4ME4A 3SS5A 4CLCA 2X71A 2Z6CA 2I72A 4OPQA 5EPHA 3SS3A 2W3FA 1P0ZA 3DTIA 3TG9A 4GS9B 4C75A 2ZM2A 4OLGA 2VJWA 1K4EA 4RX3A 4S2JA 5FI2A 3M6BA 4XUZA 2HJEA 2WGWA 2Y2LA 1YLPA 1V9ZA 3NY4A 2J3TD 1KOUA 3DW0A 1SDNA 2XGNA 2Q0OA 1KVMA 2PT7A 4OP8A 1BYWA 3DTMA 3P09A 3PTEA 3W4OA 1I2WA 1ALQA 3HLFA 5TBMB 5A90A 1UGUA 3VMAA 3MF0A 3MQOA 2Y91A 1HD8A 4GS9A 4Y0UA 2M7VA 3FKWA 4HESA 2Y2HA 1H5XA 3ZYTA 4K0XA 4X6TA 3F1PB 3KYZA 1I2SA 3NBLA 2D02A 3R7WB 5E2EA 3HJKA 3G31A 2OAQ1 4MEZA 2GZAA 3OPRA 3LUQA 4EETB 1BLCA 4LV0A 4KZ3A 3U4LP 4QU3A 3HLCA 4WEJA 5TBMA 4BQMA 4WZ5A 2I9VA 1M6KA 3FKVA 5DJUA 2Z2LB 4U3TA 1GHPA 4UQIS 3BFCA 3WS5A 3L7HA 2VZWA 3DTKA 3S22A 3T4TA 1IFQA 2QHKA 3A0RA 3FZCA 3NOTC 5TGFA 4N1HA 1W8QA 4OKPA 5HSQA 2HV1A 5AJGA 4JGQA 1F98A 5HPFA 5GLCA 4Y17A 2BASA 2V8FA 4JPMA 2CC1A 5IT5A 2WZZA 3C4OA 3UPPA 2Y79A 4I5SA 5F1FA 4DRTA 3S7NA 2LB5A 2V0UA 3NOPC 4ZRRA 3O5YA 4N1XA 1NLZA
chains in the Genus database with same CATH topology
2EX9A 4JF6A 3NDGA 4OH0A 4ZAMA 1EWZA 3W8KA 2JE5A 3G4PA 1ES3A 5L2FA 4ZTKA 3HVFA 3PBSA 1LI0A 1E3UA 2XFSA 1QMFA 3G30A 4KZ7A 4GNUA 3CMZA 2XK1A 3UE1A 3ZVWA 4CJNA 4B88A 3BFDA 4PPRA 1K54A 4EQIA 1XA7A 4BL3A 4DE0A 4OQHA 4RVAA 2ZJ9A 2QMIA 5TR7A 3A3FA 5DTSA 5I94A 1JVJA 4JXGA 3G2YA 4N9KA 3NCKA 3LO7A 3QNBA 3GRJA 2H0YA 2A3UA 3PBNA 2Y2MA 3Q07A 3IHAA 3ZGAB 3W4QA 3BLSA 3WS1A 4GDBA 1JWZA 4PM9A 3G2ZA 2ZC5B 1PZPA 2P74A 2XF3A 3IF5A 4Z9QA 1IEMA 2HP6A 2PBYA 2G2WA 3OCNA 4C6YA 4FD8A 1K6RA 3BYDA 1PWDA 4X53A 1MY8A 3IH8A 4DF6A 2P9VA 4OPZA 5HAIA 2A49A 3AGDA 2EXAA 4S2PA 5DF7A 4EWFA 4WMCD 5EVIA 4QY5A 4WZ4A 2XLNA 1LLBA 5E2HA 2ZC3B 5GHYA 4Y7PA 2ZMAA 3GTCA 1K54C 2DRWA 5DVAA 4ZJ2A 5JYOA 2H0TA 4K0WA 4WELA 4OLDA 4DDSA 3EQVA 4JKTA 3IXDA 1KDWA 1O07A 3GMWA 3SS4A 1YLTA 3OPLA 3TSGA 4BD1A 4OQGA 3G35A 4ID4A 2BG1A 3NDEA 1IYPA 2OLUA 1XP4A 2WAFA 3MZFA 3CJMA 1PIOA 4YFMA 1TEMA 3N6IA 3NI9A 4X55A 3VP3A 4ZBEA 4KZ8A 4O7DA 3LCEA 1YMSA 1MBLA 2C5WB 2V20A 3A3DA 3HLDA 1H8ZA 5G18A 4OVDA 4CPKA 3HL9A 3GVBA 2J7VA 2Y2KA 1TDGA 4RYEA 4P6BA 4LENA 4JF4A 3N8LA 4QB8A 2J9PA 2VGKA 4KZBA 3WS2A 2B5RA 3IF6A 1M40A 3N8RA 3WRTA 3WWXA 2WUQA 3FV7A 3SOIA 2HP9A 1K56A 3O3VA 3UDFA 1FCMA 3OCLA 3OPPA 3IT9A 4EBLA 3SH8A 5CTMA 5CECA 5CEBA 4B4XA 4A5RA 1YMXA 1YLWA 4IBRA 5CERA 1BUEA 1CK3A 1DJAA 1TDLA 2E8IA 2ZQAA 5FDHA 3QNCA 4KQRA 1K57A 3ZNTA 1G68A 4JXWA 2C6WB 3UPNA 1YM1A 3E2KA 5GHXA 3BFGA 2XDMA 1PW1A 3HLEA 1LI9A 4M3KA 5EECA 1HVBA 4X68A 3ZNYA 5E2FA 3O87A 1PI4A 5CHMA 1ZG6A 3Q7ZA 1Y54A 1XGJA 4YINA 3ZHHA 3VP4A 1DJCA 4RX2A 5GHZA 1NJ4A 4IVKA 3GQZA 5CHJA 2EFUA 3BRMA 4E6WA 5FQMA 3MXRA 5M18A 4OONA 1VQQA 3HBRA 4N9LA 5M1AA 2XD1A 3S4XA 4E6XA 1RGYA 4MBKA 3V5MA 3G32A 5CHUA 4LV1A 5FAPA 1IYQA 4FCFA 3WS4A 2HDQA 2X02A 1L0EA 1Z6FA 2ZQ8A 4E3IA 3UE3A 2Y2JA 3FYZA 4DKIA 2WGWB 4OP5A 3LY4A 1K6SA 1NYMA 3FWLA 1DJBA 1YLYA 2HPBA 3RJUA 1K57C 1SCWA 4R0QA 1S0WA 1N9BA 2VGJA 2ZQ9A 2J8YA 1MWRA 4UA9A 4UHUA 3DWKA 5DF8A 4GB7A 4WMCA 2V2FF 1HTZA 1G6AA 2WADA 1KE0A 3SH7A 4KG2A 5M19A 4R3BA 2BLSA 1E4DA 1L2SA 2EFXA 3ZCZA 1ZG4A 3ISGA 1GA0A 4P0MA 4C3QA 3WRZA 4WYYA 4GD6A 3IHBA 4QD4A 1MWSA 4HBUA 1IYSA 1PWGA 3IQAA 1IELA 1NZOA 1W5DA 3IWIA 4R4SA 5CGSA 3IXHA 1GHIA 2IWCA 5FI6A 2H10A 1BTLA 2XQZA 3NIAA 4OQ0A 5AQBA 3C5AA 3N7WA 1HZOA 1L0FA 5FQJA 1L0GA 1GHMA 1YT4A 2ZQDA 2Y2OA 1SKFA 1JWVA 2WYXA 4BL2A 3HLWA 3BFFA 5F82A 3HUMA 3PBOA 4EBNA 1XKZA 3A3JA 5FQQA 5FQ9A 1SHVA 2ZLYA 2V1ZA 3E2LA 3BLMA 1BSGA 1OMEA 3M6HA 2Y2QA 4MNRA 5A92A 1BLHA 3A3IA 1EROA 2Y2PA 3ITAA 2OV5A 5JYPA 5A91A 2Y4AA 1E3UD 5A93A 4DXCA 3ITBA 1VM1A 1KE3A 1NYYA 2WZXA 5AQAA 1XGIA 1MWTA 1XA1A 4JXSA 3QHYA 3HUOA 5GLAA 2EXBA 4JBFA 4MLLA 2EX6A 4DDYA 5F83A 5FASA 1C3BA 4LV2A 1FCOA 4DE3A 3Q7VB 3ZG9B 1ERMA 4R23A 3JYIA 3IH9A 1BZAA 5E43A 2Y2IA 1ZC2A 4WBGA 3UN7A 4BENA 2GDNA 3ZG0A 4RA7A 3RXXA 1W79A 4R1GA 4U0XA 4E3MA 5DF9A 3A3EA 1PWCA 2JCHA 4D2OA 1ONHA 1FCNA 1I5QA 1Q2PA 4IBXA 4L0LA 3B3XA 4OOMA 1K55A 1JWPA 1SDEA 4S2MA 2UWXA 5EVID 1NZUA 2XEPA 1K4FA 2FFYA 2WAEA 4XXRA 1CEFA 3UE0A 5AQ9A 1KDSA 1NRFA 1BLSA 5KSCA 3VP2A 4KQQA 2JBFA 2XH9A 5U47A 3I7JA 3LEZA 1KGEA 1ES4A 4DE2A 3P98A 5CRFA 3UDIA 3VOZA 2IWBA 3MBZA 3Q7VA 5CXWA 4FH4A 4OPYA 2PU4A 4UAAA 1MKIA 4H8RA 5EOEA 5HARA 4KZ4A 3Q1FA 3SH9A 3N8SA 1WYCA 3PBTA 1ESUA 1MWUA 5HAQA 2Y2GA 4B4ZA 4BD0A 4E3KA 3GSGA 2WGVA 2WGIA 3D4FA 3MXSA 3O86A 1IYOA 3ZG7B 1RCJA 3VP1A 4IEDA 4PM5A 1FQGA 5KSHA 3MFDA 4EUZA 5KMWA 1NY0A 3VFHA 1NXYA 4S2OA 4GDNA 4S2LA 5DTKA 3ZVTA 4KZAA 5HX9A 3VFFA 3ZDJA 5J8XA 4OQIA 5CGXA 1K55C 2Y2NA 4GN2A 3NC8A 2PU2A 4KQOA 1GCEA 1U60A 4KENB 3DWZA 1CI8A 2XR0A 1E25A 4KG6A 1FSWA 4S2KA 3V50A 4NETA 3ZG5A 4E3JA 2OSUA 1K56D 4ZDXA 1MPLA 4KZ6A 4Y0TA 1BT5A 3V3RA 3MKEA 4FSFA 1LHYA 3VOYA 1Q2QA 3OC2A 5KZHA 4F94A 2ZQ7A 3HUNA 4PMAA 5GL9A 3UO9A 4WZ5C 3AGFA 3BEBA 4JLFA 5DTTA 2Y55A 4QY6A 1QMEA 3PBRA 1O7EA 1L0DA 3PBQA 3ZFZA 2P9VB 3SS5A 2X71A 2R9WA 2I72A 4OPQA 2WK0A 5EPHA 2ZM0A 3SS3A 4MBFA 5EVIB 2J9OA 3BM6A 4UA6A 3AGEA 4ZJ3A 3M2JA 3WS0A 5EVLA 1H8YA 3OZHA 4R3JA 1WE4A 3TG9A 1ES5A 3PAEA 4C75A 4GD8A 2ZM2A 3Q82A 4OLGA 3VSLA 2DCFA 3IXGA 4LCLA 3VSKA 4BJPA 1K4EA 4RX3A 5HL1A 3C4PA 3TOIA 4KG5A 3G34A 1DY6A 3OPHA 2EX2A 5IHVA 4HBTA 4S2JA 5EOOA 5FI2A 5FSRA 4BLMA 3M6BA 4QJGA 3UNWA 3C7VA 2ZM8A 4XUZA 2WGWA 1BULA 2OLVA 2Y2LA 2G2UA 1YLPA 4GZBA 4PM7A 4S2NC 3NY4A 5EE8A 3PAGA 1ESIA 1K38A 4N92A 2EX8A 2HDSA 3DW0A 5HFOA 1LL9A 5GLBA 4Q8IA 1LL5A 1SDNA 2XGNA 1KE4A 1KVMA 4OP8A 5FATA 4LCMA 3ZG8B 2WKHA 3DTMA 1ES2A 1K25A 3P09A 5AQ7A 3PTEA 4P85A 1ONGA 3S1YA 3W4OA 3W4PA 5FAQA 1XX2A 1I2WA 1ALQA 1XPBA 3EQUA 3HLFA 5A90A 1PW8A 2DNSA 5FI7A 1J9MA 1N4OA 4P87A 2X01A 3VMAA 2H5SA 3IF6B 2Y91A 1WYBA 3MKFA 1HD8A 1KGGA 1YLZA 4DXBA 2RCXA 2HDUA 3GV9A 5TFQA 4LV3A 4Y0UA 3FKWA 4HESA 3N4IA 2Y2HA 4WEKA 1PZOA 4OOLA 5EUAA 1IKGA 1H5XA 4NK3A 2HDRA 2QPNA 5HAPA 4K0XA 4K91A 2XD5A 4EBPA 1MXOA 3HLGA 4X6TA 4WM9A 2Q9MA 1I2SA 3LY3A 3NBLA 1YLJA 2HP5A 3UDXA 5E2EA 2ZQCA 3RXWA 3G31A 2ZC6B 1RP5A 4MEZA 2Q9NA 2R9XA 4R4RA 3OPRA 4E3NA 2JC7A 2ZD8A 1BLCA 1GA9A 4JXVA 1W8YA 5FQKA 1ERQA 3MZEA 1PI5A 1IKIA 4LV0A 1FR6A 3BFEA 4KZ3A 4QU3A 3HLCA 2ZC4B 4WEJA 3HREA 1JTDA 3HLBA 4X56A 5HW3A 5EVIC 3UPOA 4PM8A 2ZC7A 4BQMA 4PM6A 1FR1A 2WKEA 4WZ5A 3C7UA 1M6KA 1CEGA 3FKVA 1FOFA 1KVLA 2Z2LB 4U3TA 1YQSA 5D3OA 3UY6A 2FFFB 4FH2A 1GHPA 4ZJ1A 3O88A 4E3OA 2Z2MB 3BECA 4E3LA 3BFCA 1TVFA 3V3SA 3MZDA 4QHCA 3WS5A 5E2GA 1AXBA 4DE1A 3Q81A 4IVIA 2Y59A 5CTNA 1KGFA 3S22A 3GR2A 3IWOA 4S2IA 5CGWA 3V39A 1PYYA 2WKIA 3FZCA 1XXMA 4N1HA 5TGFA 1W8QA 4OKPA 4U0TA 1FSYA 1CI9A 4UA7A 5BOHA 4GKUA 4JF5A 4OOYA 4X69A 3CG5A 4EV4A 2RL3A 4XUXA 4Y0OA 5FAOA 5FA7A 1S6RA 4MBHA 5GLCA 4KZ9A 5FQIA 5GLDA 5F1GA 4JPMA 4S2NA 2CC1A 4OPRA 2WZZA 3C4OA 3UPPA 3CZDA 3IWQA 1RGZA 3M2KA 1W7FA 4HEFA 1JTGA 1EI5A 3IF6C 5F1FA 3VP0A 4DRTA 1ZKJA 3IXBA 2XFTA 2IWDA 1BLPA 2QZ6A 5CEDA 4KZ5A 4N1XA 4GOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EX9 A;  4JF6 A;  3NDG A;  4OH0 A;  4ZAM A;  1EWZ A;  3W8K A;  2JE5 A;  3G4P A;  1ES3 A;  5L2F A;  4ZTK A;  3HVF A;  3PBS A;  1LI0 A;  1E3U A;  2XFS A;  1QMF A;  3G30 A;  4KZ7 A;  4GNU A;  3CMZ A;  2XK1 A;  3UE1 A;  3ZVW A;  4CJN A;  4B88 A;  3BFD A;  4PPR A;  1K54 A;  4EQI A;  1XA7 A;  4BL3 A;  4DE0 A;  4OQH A;  4RVA A;  2ZJ9 A;  2QMI A;  5TR7 A;  3A3F A;  5DTS A;  5I94 A;  1JVJ A;  4JXG A;  3G2Y A;  4N9K A;  3NCK A;  3LO7 A;  3QNB A;  3GRJ A;  2H0Y A;  2A3U A;  3PBN A;  2Y2M A;  3Q07 A;  3IHA A;  3ZGA B;  3W4Q A;  3BLS A;  3WS1 A;  4GDB A;  1JWZ A;  4PM9 A;  3G2Z A;  2ZC5 B;  1PZP A;  2P74 A;  2XF3 A;  3IF5 A;  4Z9Q A;  1IEM A;  2HP6 A;  2PBY A;  2G2W A;  3OCN A;  4C6Y A;  4FD8 A;  1K6R A;  3BYD A;  1PWD A;  4X53 A;  1MY8 A;  3IH8 A;  4DF6 A;  2P9V A;  4OPZ A;  5HAI A;  2A49 A;  3AGD A;  2EXA A;  4S2P A;  5DF7 A;  4EWF A;  4WMC D;  5EVI A;  4QY5 A;  4WZ4 A;  2XLN A;  1LLB A;  5E2H A;  2ZC3 B;  5GHY A;  4Y7P A;  2ZMA A;  3GTC A;  1K54 C;  2DRW A;  5DVA A;  4ZJ2 A;  5JYO A;  2H0T A;  4K0W A;  4WEL A;  4OLD A;  4DDS A;  3EQV A;  4JKT A;  3IXD A;  1KDW A;  1O07 A;  3GMW A;  3SS4 A;  1YLT A;  3OPL A;  3TSG A;  4BD1 A;  4OQG A;  3G35 A;  4ID4 A;  2BG1 A;  3NDE A;  1IYP A;  2OLU A;  1XP4 A;  2WAF A;  3MZF A;  3CJM A;  1PIO A;  4YFM A;  1TEM A;  3N6I A;  3NI9 A;  4X55 A;  3VP3 A;  4ZBE A;  4KZ8 A;  4O7D A;  3LCE A;  1YMS A;  1MBL A;  2C5W B;  2V20 A;  3A3D A;  3HLD A;  1H8Z A;  5G18 A;  4OVD A;  4CPK A;  3HL9 A;  3GVB A;  2J7V A;  2Y2K A;  1TDG A;  4RYE A;  4P6B A;  4LEN A;  4JF4 A;  3N8L A;  4QB8 A;  2J9P A;  2VGK A;  4KZB A;  3WS2 A;  2B5R A;  3IF6 A;  1M40 A;  3N8R A;  3WRT A;  3WWX A;  2WUQ A;  3FV7 A;  3SOI A;  2HP9 A;  1K56 A;  3O3V A;  3UDF A;  1FCM A;  3OCL A;  3OPP A;  3IT9 A;  4EBL A;  3SH8 A;  5CTM A;  5CEC A;  5CEB A;  4B4X A;  4A5R A;  1YMX A;  1YLW A;  4IBR A;  5CER A;  1BUE A;  1CK3 A;  1DJA A;  1TDL A;  2E8I A;  2ZQA A;  5FDH A;  3QNC A;  4KQR A;  1K57 A;  3ZNT A;  1G68 A;  4JXW A;  2C6W B;  3UPN A;  1YM1 A;  3E2K A;  5GHX A;  3BFG A;  2XDM A;  1PW1 A;  3HLE A;  1LI9 A;  4M3K A;  5EEC A;  1HVB A;  4X68 A;  3ZNY A;  5E2F A;  3O87 A;  1PI4 A;  5CHM A;  1ZG6 A;  3Q7Z A;  1Y54 A;  1XGJ A;  4YIN A;  3ZHH A;  3VP4 A;  1DJC A;  4RX2 A;  5GHZ A;  1NJ4 A;  4IVK A;  3GQZ A;  5CHJ A;  2EFU A;  3BRM A;  4E6W A;  5FQM A;  3MXR A;  5M18 A;  4OON A;  1VQQ A;  3HBR A;  4N9L A;  5M1A A;  2XD1 A;  3S4X A;  4E6X A;  1RGY A;  4MBK A;  3V5M A;  3G32 A;  5CHU A;  4LV1 A;  5FAP A;  1IYQ A;  4FCF A;  3WS4 A;  2HDQ A;  2X02 A;  1L0E A;  1Z6F A;  2ZQ8 A;  4E3I A;  3UE3 A;  2Y2J A;  3FYZ A;  4DKI A;  2WGW B;  4OP5 A;  3LY4 A;  1K6S A;  1NYM A;  3FWL A;  1DJB A;  1YLY A;  2HPB A;  3RJU A;  1K57 C;  1SCW A;  4R0Q A;  1S0W A;  1N9B A;  2VGJ A;  2ZQ9 A;  2J8Y A;  1MWR A;  4UA9 A;  4UHU A;  3DWK A;  5DF8 A;  4GB7 A;  4WMC A;  2V2F F;  1HTZ A;  1G6A A;  2WAD A;  1KE0 A;  3SH7 A;  4KG2 A;  5M19 A;  4R3B A;  2BLS A;  1E4D A;  1L2S A;  2EFX A;  3ZCZ A;  1ZG4 A;  3ISG A;  1GA0 A;  4P0M A;  4C3Q A;  3WRZ A;  4WYY A;  4GD6 A;  3IHB A;  4QD4 A;  1MWS A;  4HBU A;  1IYS A;  1PWG A;  3IQA A;  1IEL A;  1NZO A;  1W5D A;  3IWI A;  4R4S A;  5CGS A;  3IXH A;  1GHI A;  2IWC A;  5FI6 A;  2H10 A;  1BTL A;  2XQZ A;  3NIA A;  4OQ0 A;  5AQB A;  3C5A A;  3N7W A;  1HZO A;  1L0F A;  5FQJ A;  1L0G A;  1GHM A;  1YT4 A;  2ZQD A;  2Y2O A;  1SKF A;  1JWV A;  2WYX A;  4BL2 A;  3HLW A;  3BFF A;  5F82 A;  3HUM A;  3PBO A;  4EBN A;  1XKZ A;  3A3J A;  5FQQ A;  5FQ9 A;  1SHV A;  2ZLY A;  2V1Z A;  3E2L A;  3BLM A;  1BSG A;  1OME A;  3M6H A;  2Y2Q A;  4MNR A;  5A92 A;  1BLH A;  3A3I A;  1ERO A;  2Y2P A;  3ITA A;  2OV5 A;  5JYP A;  5A91 A;  2Y4A A;  1E3U D;  5A93 A;  4DXC A;  3ITB A;  1VM1 A;  1KE3 A;  1NYY A;  2WZX A;  5AQA A;  1XGI A;  1MWT A;  1XA1 A;  4JXS A;  3QHY A;  3HUO A;  5GLA A;  2EXB A;  4JBF A;  4MLL A;  2EX6 A;  4DDY A;  5F83 A;  5FAS A;  1C3B A;  4LV2 A;  1FCO A;  4DE3 A;  3Q7V B;  3ZG9 B;  1ERM A;  4R23 A;  3JYI A;  3IH9 A;  1BZA A;  5E43 A;  2Y2I A;  1ZC2 A;  4WBG A;  3UN7 A;  4BEN A;  2GDN A;  3ZG0 A;  4RA7 A;  3RXX A;  1W79 A;  4R1G A;  4U0X A;  4E3M A;  5DF9 A;  3A3E A;  1PWC A;  2JCH A;  4D2O A;  1ONH A;  1FCN A;  1I5Q A;  1Q2P A;  4IBX A;  4L0L A;  3B3X A;  4OOM A;  1K55 A;  1JWP A;  1SDE A;  4S2M A;  2UWX A;  5EVI D;  1NZU A;  2XEP A;  1K4F A;  2FFY A;  2WAE A;  4XXR A;  1CEF A;  3UE0 A;  5AQ9 A;  1KDS A;  1NRF A;  1BLS A;  5KSC A;  3VP2 A;  4KQQ A;  2JBF A;  2XH9 A;  5U47 A;  3I7J A;  3LEZ A;  1KGE A;  1ES4 A;  4DE2 A;  3P98 A;  5CRF A;  3UDI A;  3VOZ A;  2IWB A;  3MBZ A;  3Q7V A;  5CXW A;  4FH4 A;  4OPY A;  2PU4 A;  4UAA A;  1MKI A;  4H8R A;  5EOE A;  5HAR A;  4KZ4 A;  3Q1F A;  3SH9 A;  3N8S A;  1WYC A;  3PBT A;  1ESU A;  1MWU A;  5HAQ A;  2Y2G A;  4B4Z A;  4BD0 A;  4E3K A;  3GSG A;  2WGV A;  2WGI A;  3D4F A;  3MXS A;  3O86 A;  1IYO A;  3ZG7 B;  1RCJ A;  3VP1 A;  4IED A;  4PM5 A;  1FQG A;  5KSH A;  3MFD A;  4EUZ A;  5KMW A;  1NY0 A;  3VFH A;  1NXY A;  4S2O A;  4GDN A;  4S2L A;  5DTK A;  3ZVT A;  4KZA A;  5HX9 A;  3VFF A;  3ZDJ A;  5J8X A;  4OQI A;  5CGX A;  1K55 C;  2Y2N A;  4GN2 A;  3NC8 A;  2PU2 A;  4KQO A;  1GCE A;  1U60 A;  4KEN B;  3DWZ A;  1CI8 A;  2XR0 A;  1E25 A;  4KG6 A;  1FSW A;  4S2K A;  3V50 A;  4NET A;  3ZG5 A;  4E3J A;  2OSU A;  1K56 D;  4ZDX A;  1MPL A;  4KZ6 A;  4Y0T A;  1BT5 A;  3V3R A;  3MKE A;  4FSF A;  1LHY A;  3VOY A;  1Q2Q A;  3OC2 A;  5KZH A;  4F94 A;  2ZQ7 A;  3HUN A;  4PMA A;  5GL9 A;  3UO9 A;  4WZ5 C;  3AGF A;  3BEB A;  4JLF A;  5DTT A;  2Y55 A;  4QY6 A;  1QME A;  3PBR A;  1O7E A;  1L0D A;  3PBQ A;  3ZFZ A;  2P9V B;  3SS5 A;  2X71 A;  2R9W A;  2I72 A;  4OPQ A;  2WK0 A;  5EPH A;  2ZM0 A;  3SS3 A;  4MBF A;  5EVI B;  2J9O A;  3BM6 A;  4UA6 A;  3AGE A;  4ZJ3 A;  3M2J A;  3WS0 A;  5EVL A;  1H8Y A;  3OZH A;  4R3J A;  1WE4 A;  3TG9 A;  1ES5 A;  3PAE A;  4C75 A;  4GD8 A;  2ZM2 A;  3Q82 A;  4OLG A;  3VSL A;  2DCF A;  3IXG A;  4LCL A;  3VSK A;  4BJP A;  1K4E A;  4RX3 A;  5HL1 A;  3C4P A;  3TOI A;  4KG5 A;  3G34 A;  1DY6 A;  3OPH A;  2EX2 A;  5IHV A;  4HBT A;  4S2J A;  5EOO A;  5FI2 A;  5FSR A;  4BLM A;  3M6B A;  4QJG A;  3UNW A;  3C7V A;  2ZM8 A;  4XUZ A;  2WGW A;  1BUL A;  2OLV A;  2Y2L A;  2G2U A;  1YLP A;  4GZB A;  4PM7 A;  4S2N C;  3NY4 A;  5EE8 A;  3PAG A;  1ESI A;  1K38 A;  4N92 A;  2EX8 A;  2HDS A;  3DW0 A;  5HFO A;  1LL9 A;  5GLB A;  4Q8I A;  1LL5 A;  1SDN A;  2XGN A;  1KE4 A;  1KVM A;  4OP8 A;  5FAT A;  4LCM A;  3ZG8 B;  2WKH A;  3DTM A;  1ES2 A;  1K25 A;  3P09 A;  5AQ7 A;  3PTE A;  4P85 A;  1ONG A;  3S1Y A;  3W4O A;  3W4P A;  5FAQ A;  1XX2 A;  1I2W A;  1ALQ A;  1XPB A;  3EQU A;  3HLF A;  5A90 A;  1PW8 A;  2DNS A;  5FI7 A;  1J9M A;  1N4O A;  4P87 A;  2X01 A;  3VMA A;  2H5S A;  3IF6 B;  2Y91 A;  1WYB A;  3MKF A;  1HD8 A;  1KGG A;  1YLZ A;  4DXB A;  2RCX A;  2HDU A;  3GV9 A;  5TFQ A;  4LV3 A;  4Y0U A;  3FKW A;  4HES A;  3N4I A;  2Y2H A;  4WEK A;  1PZO A;  4OOL A;  5EUA A;  1IKG A;  1H5X A;  4NK3 A;  2HDR A;  2QPN A;  5HAP A;  4K0X A;  4K91 A;  2XD5 A;  4EBP A;  1MXO A;  3HLG A;  4X6T A;  4WM9 A;  2Q9M A;  1I2S A;  3LY3 A;  3NBL A;  1YLJ A;  2HP5 A;  3UDX A;  5E2E A;  2ZQC A;  3RXW A;  3G31 A;  2ZC6 B;  1RP5 A;  4MEZ A;  2Q9N A;  2R9X A;  4R4R A;  3OPR A;  4E3N A;  2JC7 A;  2ZD8 A;  1BLC A;  1GA9 A;  4JXV A;  1W8Y A;  5FQK A;  1ERQ A;  3MZE A;  1PI5 A;  1IKI A;  4LV0 A;  1FR6 A;  3BFE A;  4KZ3 A;  4QU3 A;  3HLC A;  2ZC4 B;  4WEJ A;  3HRE A;  1JTD A;  3HLB A;  4X56 A;  5HW3 A;  5EVI C;  3UPO A;  4PM8 A;  2ZC7 A;  4BQM A;  4PM6 A;  1FR1 A;  2WKE A;  4WZ5 A;  3C7U A;  1M6K A;  1CEG A;  3FKV A;  1FOF A;  1KVL A;  2Z2L B;  4U3T A;  1YQS A;  5D3O A;  3UY6 A;  2FFF B;  4FH2 A;  1GHP A;  4ZJ1 A;  3O88 A;  4E3O A;  2Z2M B;  3BEC A;  4E3L A;  3BFC A;  1TVF A;  3V3S A;  3MZD A;  4QHC A;  3WS5 A;  5E2G A;  1AXB A;  4DE1 A;  3Q81 A;  4IVI A;  2Y59 A;  5CTN A;  1KGF A;  3S22 A;  3GR2 A;  3IWO A;  4S2I A;  5CGW A;  3V39 A;  1PYY A;  2WKI A;  3FZC A;  1XXM A;  4N1H A;  5TGF A;  1W8Q A;  4OKP A;  4U0T A;  1FSY A;  1CI9 A;  4UA7 A;  5BOH A;  4GKU A;  4JF5 A;  4OOY A;  4X69 A;  3CG5 A;  4EV4 A;  2RL3 A;  4XUX A;  4Y0O A;  5FAO A;  5FA7 A;  1S6R A;  4MBH A;  5GLC A;  4KZ9 A;  5FQI A;  5GLD A;  5F1G A;  4JPM A;  4S2N A;  2CC1 A;  4OPR A;  2WZZ A;  3C4O A;  3UPP A;  3CZD A;  3IWQ A;  1RGZ A;  3M2K A;  1W7F A;  4HEF A;  1JTG A;  1EI5 A;  3IF6 C;  5F1F A;  3VP0 A;  4DRT A;  1ZKJ A;  3IXB A;  2XFT A;  2IWD A;  1BLP A;  2QZ6 A;  5CED A;  4KZ5 A;  4N1X A;  4GOG A; 
#chains in the Genus database with same CATH topology
 1EWZ A;  3H82 B;  3G4P A;  4R70 A;  3PBS A;  1E3U A;  3CMZ A;  2XK1 A;  4MN7 A;  4PPR A;  1K54 A;  3T4Q A;  4I39 A;  2QMI A;  4HP4 A;  3A3F A;  4QPR A;  4JXG A;  3G2Y A;  3NCK A;  4O01 A;  4HJ4 A;  3PBN A;  2CMN A;  3W4Q A;  3BLS A;  3WS1 A;  4GDB A;  1PZP A;  2A24 B;  1UWN X;  1IEM A;  2G2W A;  4LFU A;  1GSX A;  4C6Y A;  2J3T C;  1K6R A;  2XSS A;  3KSI A;  4EEP A;  1PWD A;  3QP8 A;  3IH8 A;  4DF6 A;  1AWI A;  3AGD A;  5DF7 A;  4WZ4 A;  3H82 A;  4E04 A;  3GTC A;  3MQ0 A;  4ZJ2 A;  4K0W A;  3PR6 A;  4NXB A;  4OLD A;  3MFX A;  4JKT A;  3SS4 A;  3TSG A;  3B47 A;  3G35 A;  3TW8 A;  2HJ9 C;  3NI9 A;  3VP3 A;  2J3W A;  4KZ8 A;  2ZL1 A;  4MDZ A;  1MBL A;  1W63 Q;  5AVF A;  2OAP 1;  2Y2K A;  1P9W A;  4HOI A;  4JF4 A;  4KZB A;  1M40 A;  2VV7 A;  3FV7 A;  1K56 A;  3IT9 A;  3IBR A;  5MC7 A;  1MZU A;  4B4X A;  1WA9 A;  2JHE A;  1VHM A;  2W27 A;  1TDL A;  1K57 A;  3T12 B;  1VEU A;  3T50 A;  2XDM A;  1LI9 A;  3SZT A;  4M3K A;  4AFI A;  5EEC A;  5DFY A;  5CHM A;  3T4S A;  1ZG6 A;  2JKF A;  1Y54 A;  3F1O A;  3Q7Z A;  4P6Z S;  5G4Z A;  1DJC A;  3KYE A;  3MXR A;  1VQQ A;  3S4X A;  4GHI A;  4I38 A;  2HDQ A;  1L0E A;  3CHW P;  4E3I A;  3S7Q A;  2VKS A;  1Z09 A;  1A0K A;  1NYM A;  3FWL A;  1L3L A;  1LL8 A;  3S7P A;  3RJU A;  4Y5F A;  4BBU A;  4UHU A;  3DWK A;  1HTZ A;  2O9A A;  1KE0 A;  3SH7 A;  5M19 A;  4Y13 A;  3T4O A;  3ZCZ A;  4P0M A;  3ISG A;  4ARZ B;  3WRZ A;  3LR5 A;  4WYY A;  3BQA A;  4QD4 A;  1MWS A;  5HPI A;  1PWG A;  1D06 A;  3CWF A;  1TF1 A;  1W5D A;  3IWI A;  4R4S A;  5CGS A;  5FI6 A;  1ZTU A;  3NIA A;  4OQ0 A;  3C5A A;  3N7W A;  1YAX A;  1GHM A;  3HLW A;  2M7U A;  3DAV A;  5DJT A;  1XKZ A;  1SHV A;  1TS7 A;  2ZLY A;  2V1Z A;  1TS8 A;  4NG2 A;  3LID A;  3W2Z A;  3M6H A;  1BLH A;  2Y2P A;  5A93 A;  1KE3 A;  1NYY A;  3EGX C;  2VGL S;  4JGP A;  4JXS A;  2EXB A;  1HLU P;  4LV2 A;  2UV0 E;  2ZOI A;  2W1T A;  3L9K A;  2Y2I A;  3BJN A;  4WBG A;  2GDN A;  1ONH A;  4KQD A;  2OWJ A;  3NUL A;  4OOM A;  4S2M A;  3LI8 A;  2XEP A;  1K4F A;  1CEF A;  3D72 A;  3NEC A;  4WLA A;  1BLS A;  2JBF A;  5U47 A;  1KGE A;  4DE2 A;  4FH4 A;  3QP2 A;  4H8R A;  5HAR A;  1WYC A;  5HAQ A;  2Y2G A;  3CLO A;  4BD0 A;  2WGV A;  3ZG7 B;  4WN5 A;  1FQG A;  5KSH A;  3F1N B;  1NY0 A;  3VFH A;  1NXY A;  4S2L A;  5HX9 A;  4OQI A;  1K55 C;  3CI6 A;  3KYQ A;  3NC8 A;  2VEA A;  4KEN B;  2AVX A;  1FSW A;  1BT5 A;  4EQ1 A;  1SKO B;  3OC2 A;  4X1M A;  3UO9 A;  3JVV A;  3E4Q A;  2ZMF A;  3D3O A;  2P9V B;  2FH5 A;  2ZM0 A;  3AGE A;  3WS0 A;  3M2J A;  1H8Y A;  2QJ7 A;  3OZH A;  1WE4 A;  4CLC E;  3EGD C;  4GD8 A;  3CUE C;  4BJP A;  5HL1 A;  3C4P A;  4EUV A;  1H3Q A;  3G34 A;  3E0Y A;  4FTX A;  3E4O A;  5EOO A;  4QJG A;  1D1J A;  3UNW A;  3KSG A;  2INW A;  5EV0 A;  4RQ9 A;  1BUL A;  2G2U A;  4S2N C;  3PAG A;  2KDK A;  5GLB A;  1SKO A;  5FAT A;  4LCM A;  4F3L B;  1K25 A;  4P85 A;  4YNR A;  2KLI A;  2DNS A;  5FI7 A;  1N4O A;  3IF6 B;  5EVE A;  4K08 A;  3N4I A;  2VV6 A;  5HDD A;  1IKG A;  1OTE A;  1YSQ A;  4K91 A;  2PBD P;  2XD5 A;  4EBP A;  1MXO A;  4R6L A;  4WM9 A;  1OJ5 A;  4PAU A;  1RP5 A;  2Q9N A;  2R9X A;  4R4R A;  4F3L A;  1GA9 A;  3E4P A;  1W8Y A;  3KX0 X;  2ZC4 B;  3HLB A;  4X56 A;  2MJ6 A;  1Y4O A;  1N9N A;  4D60 A;  1ZHH B;  1KVL A;  3UY6 A;  3O88 A;  2Z2M B;  1TVF A;  1Y28 A;  3V3S A;  4DE1 A;  3H7W A;  3Q81 A;  4IVI A;  5G4Y A;  5IU1 A;  4S2I A;  5CGW A;  2PD8 A;  1PYY A;  5FL3 A;  3LIF A;  3QP5 A;  4UA7 A;  5BOH A;  4BBV A;  2JKG A;  4OOY A;  4Y0O A;  1T19 A;  4KZ9 A;  5GLD A;  4S2N A;  2QYB A;  4OPR A;  3CZD A;  3M2K A;  4HEF A;  1JTG A;  1EI5 A;  3VP0 A;  2IWD A;  2XFT A;  4KZ5 A;  2EX9 A;  4XT2 B;  3PHY A;  3NDG A;  4ZAM A;  2JE5 A;  3HVF A;  2XFS A;  1QMF A;  3CIT A;  4GNU A;  3BFD A;  4DE0 A;  4OQH A;  3QP6 A;  5DTS A;  5I94 A;  4N9K A;  1DP6 A;  1OT6 A;  2Y2M A;  3Q07 A;  5EM0 A;  1JWZ A;  2EWW A;  3G2Z A;  4PM9 A;  1OJG A;  2ZC5 B;  4HJ6 A;  4LLO B;  2P74 A;  4Z9Q A;  2W1R A;  3BW6 A;  3IS2 B;  2XLN A;  1LLB A;  2ZMA A;  1K54 C;  2HZ5 A;  5JYO A;  1TD5 A;  4Z1W A;  4DDS A;  3MMH A;  3MJQ A;  3IBJ A;  1O07 A;  4BD1 A;  4OQG A;  2BG1 A;  1IYP A;  2WAF A;  3CJM A;  2XRO A;  1PIO A;  1TEM A;  4ZBE A;  3IX4 A;  4KUO A;  4O7D A;  1YMS A;  2C5W B;  2V20 A;  1H8Z A;  4CPK A;  4ETZ A;  5L10 A;  4PKY A;  4RYE A;  4MCW A;  3N8L A;  4HP9 A;  4QB8 A;  2J9P A;  3K3D A;  3N8R A;  4Q0J A;  2HP9 A;  3OCL A;  5EFW A;  4EBL A;  2XA7 S;  1TS6 A;  4A5R A;  1BUE A;  1DJA A;  5FDH A;  3QNC A;  3GEC A;  1G68 A;  3F1P A;  3R7W A;  2PYR A;  3HLE A;  2PR5 A;  1HVB A;  1XJ6 A;  3ZNY A;  5E2F A;  4YIN A;  1NJ4 A;  3GQZ A;  3IX8 A;  5M18 A;  1T1A A;  4N9L A;  5M1A A;  2XD1 A;  2NUP C;  3G32 A;  3BY9 A;  4FCF A;  1XJ2 A;  1Z6F A;  2ZQ8 A;  3UE3 A;  2ZBB A;  4OP5 A;  1VET B;  4HH2 A;  1DJB A;  1YLY A;  1K57 C;  2ZQ9 A;  1N9B A;  1MWR A;  4G3W A;  4GB7 A;  4WMC A;  2PAV P;  3KSH A;  2WAD A;  5A8B A;  4KG2 A;  1E4D A;  1ZG4 A;  5IS1 A;  3CPT B;  1T1B A;  1GHI A;  3B33 A;  1BTL A;  4O0P A;  1HZO A;  3PBO A;  3LR4 A;  5FQQ A;  3A3I A;  2OV5 A;  4Q0I A;  3ITB A;  1VM1 A;  2WZX A;  5AQA A;  3TE8 A;  4JBF A;  4MLL A;  2EX6 A;  5LBR A;  3ZG9 B;  2A24 A;  3JYI A;  1DRM A;  5E43 A;  2V1A A;  3OBF A;  3RXX A;  3A3E A;  4HH3 A;  2JCH A;  4D2O A;  1I5Q A;  4IBX A;  4L0L A;  1OTA A;  1F9I A;  2M1C A;  2UWX A;  1NZU A;  4XXR A;  2B95 A;  5AQ9 A;  5F5Y A;  5TJJ A;  2W3G A;  5KSC A;  2W3D A;  1ES4 A;  2PR6 A;  2IWB A;  5CXW A;  5F6A A;  2PU4 A;  1MKI A;  5EOE A;  3SH9 A;  2IA2 A;  3N8S A;  1STZ A;  3MXS A;  3O86 A;  1IYO A;  4IED A;  4PM5 A;  4EUZ A;  5KMW A;  2FZ0 A;  2K7S A;  5CGX A;  2L0W A;  4EEU A;  2PU2 A;  4KQO A;  1U60 A;  3DWZ A;  1E25 A;  4KG6 A;  4E3J A;  3ZG5 A;  2LB9 A;  2HGV A;  4Y0T A;  1LHY A;  3VOY A;  5KZH A;  4UQI M;  4PMA A;  5GL9 A;  5FEG A;  3AGF A;  3BEB A;  1QME A;  3JPU A;  3PBR A;  1O7E A;  3T1S A;  4NXF A;  2WK0 A;  3LIA A;  4MBF A;  5EVI B;  3BM6 A;  1T18 A;  4R3J A;  3QP4 A;  3PAE A;  5KIZ A;  3Q82 A;  2DCF A;  4M4X A;  3ULF A;  4LCL A;  3VSK A;  3TOI A;  4KG5 A;  5HDS A;  5IHV A;  1CQA A;  5FSR A;  2ZM8 A;  2J80 A;  4FUW A;  5EE8 A;  1K38 A;  3MR0 A;  4N92 A;  2P08 A;  1LL9 A;  4EW7 A;  1LL5 A;  1KE4 A;  2WKH A;  1ES2 A;  3FC7 A;  1ONG A;  3S1Y A;  3W4P A;  5FAQ A;  1XX2 A;  1XPB A;  3EQU A;  1PW8 A;  4P87 A;  5I5L A;  4ARZ A;  1WYB A;  3MKF A;  1KGG A;  4DXB A;  2HDU A;  4LV3 A;  2HF6 A;  1OTB A;  4WEK A;  4OOL A;  5EUA A;  5HAP A;  3UME A;  2VX8 A;  3HLG A;  4Y15 A;  1W63 M;  1YLJ A;  3TJZ C;  1ACF A;  3T4L A;  2ZQC A;  2ZC6 B;  2JC7 A;  2ZD8 A;  1FIL A;  4JXV A;  5FQK A;  5L07 A;  3MZE A;  1IKI A;  2EWV A;  1JTD A;  5HW3 A;  3UPO A;  4PM8 A;  1FR1 A;  1FOF A;  5D3O A;  2FFF B;  2W0N A;  4E3O A;  4PKY G;  3BEC A;  3MZD A;  5E2G A;  1AXB A;  5CTN A;  3RFB A;  1OPX A;  3C38 A;  1G5U A;  1YKD A;  4X69 A;  3CG5 A;  4EV4 A;  1JNU A;  4XUX A;  5FAO A;  4MBH A;  5FQI A;  3MSH A;  3IWQ A;  3UB6 A;  3IF6 C;  5DKK A;  4HQA A;  1BLP A;  1OTI A;  4GOG A;  3W8K A;  5K5B A;  1LI0 A;  3ZVW A;  4B88 A;  3A0S A;  1XA7 A;  2GNX A;  3F1N A;  3RTY A;  2L4R A;  4P6Z M;  4RVA A;  2ZJ9 A;  1P97 A;  4L9E A;  1JVJ A;  3LO7 A;  4WF0 A;  3QNB A;  3GRJ A;  3C8C A;  3T4J A;  2VV8 A;  3IHA A;  3ZGA B;  2XF3 A;  3IF5 A;  3OCN A;  4FD8 A;  3T1R A;  3NHQ A;  2P9V A;  5J3W A;  4OPZ A;  3T1X A;  4O8G A;  2EXA A;  4S2P A;  4WMC D;  4QY5 A;  4Y7P A;  5DVA A;  2H0T A;  4DN0 A;  5HWV A;  3EQV A;  1KDW A;  3K3C A;  1YLT A;  3OPL A;  3G6O A;  3FPV A;  1G28 A;  1XP4 A;  2O0Y A;  4YFM A;  3N6I A;  1H8M A;  3LCE A;  3A3D A;  4OVD A;  3GVB A;  2J7V A;  5HDC A;  2VGK A;  2B5R A;  3D9Y A;  4HNB A;  3IF6 A;  3WRT A;  2WUQ A;  4KUK A;  3SOI A;  5J4E A;  3UDF A;  3SW1 A;  1LSW A;  1FCM A;  1UWP X;  2VGL M;  5CTM A;  5CEC A;  5CEB A;  3LI9 A;  1GSW A;  2EA9 A;  5AVE A;  1CK3 A;  2ZQA A;  2E8I A;  4IUH A;  4KQR A;  3C30 A;  3HCY A;  1YM1 A;  5GHX A;  1EW0 A;  3JVU A;  2ACG A;  4CLC B;  3EEA A;  4JGR A;  1PI4 A;  3CAX A;  1XGJ A;  3VP4 A;  4RX2 A;  5GHZ A;  3ICY A;  3UB7 A;  2PDR A;  3BRM A;  4E6W A;  5FQM A;  4OON A;  2ZOH A;  4MBK A;  3V5M A;  5CHU A;  4LV1 A;  5FAP A;  1IYQ A;  3WS4 A;  5DKL A;  2ZMV A;  3FYZ A;  4DKI A;  3IX3 A;  2WGW B;  2HPB A;  4MN5 A;  3NOU C;  4R0Q A;  1GSV A;  2V2F F;  3BWL A;  5HZH A;  1G6A A;  3DBA A;  3T1Q B;  1L2S A;  2EFX A;  3V67 A;  1GA0 A;  4HBU A;  1LSV A;  1IYS A;  3IQA A;  3MXQ A;  1ODV A;  2IWC A;  2XQZ A;  3FPW A;  1SKF A;  4BL2 A;  3BFF A;  4XT2 A;  3P7N A;  3A3J A;  5FQ9 A;  3E2L A;  1OME A;  2Y2Q A;  4MNR A;  5A92 A;  1ERO A;  3ITA A;  2Y8H A;  5A91 A;  2Y4A A;  2PHY A;  3S7O A;  2K2N A;  1XGI A;  1XA1 A;  3QHY A;  3VV4 A;  5GLA A;  4DDY A;  5FAS A;  4R38 A;  1C3B A;  1LSX A;  4UEY A;  3UE6 A;  1FCO A;  4DE3 A;  3Q7V B;  2WKQ A;  4R23 A;  5HL6 A;  2KOI A;  3VE3 A;  1XFQ A;  1ZC2 A;  3UN7 A;  3LIC A;  2G7U A;  4Q0H A;  4E3M A;  5DF9 A;  1T1C A;  4HIA A;  4WL9 A;  2V9A A;  3IS2 A;  1FCN A;  1Q2P A;  1CF0 A;  1JWP A;  4GLQ A;  5J7E A;  5EVI D;  2W3H A;  2FFY A;  2WAE A;  2R78 A;  4GW9 A;  3UE0 A;  1NRF A;  3NJA A;  3VP2 A;  4I3A A;  2XH9 A;  3K2N A;  3OLO A;  4GJ4 A;  5CX7 A;  3P98 A;  1NRJ A;  3UDI A;  3KO6 A;  3VOZ A;  3Q7V A;  4UAA A;  2W3E A;  4KZ4 A;  3Q1F A;  3PBT A;  1PRQ A;  5HWT A;  2WGI A;  3LIB A;  2VK3 A;  1NWZ A;  1D7E A;  1S4S A;  3BY8 A;  3MFD A;  5DTK A;  5FDS A;  3VFF A;  1G6O A;  2PRF A;  5J8X A;  2PYP A;  1CI8 A;  1TS0 A;  4NET A;  3BQ8 A;  2GX5 A;  4ZDX A;  4KZ6 A;  3E98 A;  2L1M A;  3V3R A;  1Q2Q A;  3VE4 A;  5DFX A;  3LFV A;  2ZQ7 A;  3HUN A;  4HJ3 A;  5DTT A;  2PD7 A;  3ZFZ A;  4B93 A;  2WKP A;  1FIK A;  2VLG A;  2R9W A;  5F68 A;  4BMW A;  2J9O A;  4UA6 A;  4ZJ3 A;  4NXE A;  5EVL A;  1ES5 A;  1J3W A;  3VSL A;  3IXG A;  1NLY A;  3UB5 P;  1DY6 A;  4EU0 A;  3OPH A;  2EX2 A;  4HBT A;  3H9W A;  3VOL A;  4BLM A;  3C7V A;  2OLV A;  1K0K A;  4PM7 A;  1VET A;  1DP9 A;  3FG8 A;  4GZB A;  1CJF A;  1ESI A;  2EX8 A;  2HDS A;  5HFO A;  3EWK A;  2ZL1 B;  4Q8I A;  4H6J B;  2QWS A;  3LIE A;  3ZG8 B;  5AQ7 A;  1J9M A;  2X01 A;  2H5S A;  3QP1 A;  4I3I A;  1YLZ A;  2RCX A;  3CPT A;  3GV9 A;  5TFQ A;  5FEF A;  1OTD A;  4DJ3 A;  1YPR A;  1X0O A;  4CQH A;  3OOV A;  1PZO A;  4NK3 A;  2HDR A;  2QPN A;  1VEU B;  2JN7 A;  2Q9M A;  3LY3 A;  2HP5 A;  4I3J A;  3UDX A;  3RXW A;  4H6J A;  1V9Y A;  4E3N A;  3F1O B;  4HY8 A;  1ERQ A;  4IUK A;  1PI5 A;  1FR6 A;  3BFE A;  2K31 A;  3HRE A;  3TRC A;  5EVI C;  2ZC7 A;  3HJI A;  4PM6 A;  4GHI B;  2WKE A;  3C7U A;  1CEG A;  1YQS A;  4FH2 A;  4ZJ1 A;  4MMN A;  4HI4 A;  3UMD A;  4E3L A;  4QHC A;  2Y59 A;  1KGF A;  3GR2 A;  3IWO A;  3V39 A;  2WKI A;  1XXM A;  3B42 A;  4U0T A;  1FSY A;  2V8C A;  1CI9 A;  4GKU A;  4JF5 A;  4X25 A;  2RL3 A;  5FA7 A;  1S6R A;  5F1G A;  4LRZ E;  2V0W A;  1RGZ A;  1W7F A;  2XA7 M;  2D01 A;  3UB9 A;  1ZKJ A;  2O9C A;  3IXB A;  5L8M A;  4DMZ A;  1N9L A;  2QZ6 A;  5CED A;  4Y3I A;  4BWI A;  3C2W A;  3PYP A;  2JKR I;  3LR0 A;  4JF6 A;  4G3V A;  4OH0 A;  1ES3 A;  5L2F A;  4ZTK A;  1OT9 A;  4NKP A;  3G30 A;  4KZ7 A;  3UE1 A;  4CJN A;  4PHT A;  4EQI A;  4Y2F A;  4BL3 A;  5TR7 A;  2B02 A;  1PFL A;  2H0Y A;  2A3U A;  4BBT A;  2W1T B;  2HP6 A;  2PBY A;  3LEQ A;  3BYD A;  4X53 A;  1MY8 A;  5HAI A;  2A49 A;  4EWF A;  5EVI A;  4G3K A;  5E2H A;  2ZC3 B;  5GHY A;  4CLC D;  2DRW A;  4EES A;  4IHQ A;  4WEL A;  2H28 A;  3IXD A;  4EXO A;  2GJ3 A;  3GMW A;  4B9O A;  2XRN A;  2YKF A;  4ID4 A;  3NDE A;  2OLU A;  3MZF A;  4GCZ A;  1LT0 A;  4LRX C;  2O9B A;  4X55 A;  5F69 A;  3HLD A;  5G18 A;  3ZQ5 A;  2B18 A;  3HL9 A;  2JKR M;  1TDG A;  4P6B A;  4LEN A;  1DP8 A;  3EOI A;  3WS2 A;  4II7 A;  2JKT I;  3WWX A;  1S1Y A;  3O3V A;  3P01 A;  2V1B A;  3OPP A;  3SH8 A;  1YMX A;  1YLW A;  4IBR A;  4LRY C;  5CER A;  4R3A A;  2DMW A;  3ZNT A;  2NUT C;  4JXW A;  2C6W B;  3UPN A;  3E2K A;  1VB6 A;  3BFG A;  1PW1 A;  1SZV A;  5HD3 A;  4X68 A;  1S1Z A;  3O87 A;  3ZHH A;  4QWO A;  2Z6D A;  4IVK A;  3LR3 A;  5CHJ A;  2EFU A;  1S4R A;  3HBR A;  3DTE A;  2QKP A;  4E6X A;  1H0M A;  4LGW A;  1RGY A;  4NXG A;  3MS6 A;  2X02 A;  2Y2J A;  4YWZ A;  3LY4 A;  1K6S A;  5HD5 A;  2BTF P;  1SCW A;  4LPZ A;  1S0W A;  2VGJ A;  4JGO A;  4UA9 A;  2J8Y A;  1XFN A;  5DF8 A;  2OWH A;  4FOF A;  3LYX A;  4R3B A;  2BLS A;  3R4K A;  4C3Q A;  4MN6 A;  2P04 A;  4GD6 A;  3IHB A;  4ESP A;  1IEL A;  2JKT M;  1NZO A;  3IXH A;  2H10 A;  5AQB A;  5FQJ A;  1L0F A;  1L0G A;  1F5M A;  1YT4 A;  2ZQD A;  3MQQ A;  2Y2O A;  1JWV A;  2P7J A;  2WYX A;  3GDI A;  2WKR A;  5F82 A;  3HUM A;  3LGO A;  4EBN A;  3BLM A;  1BSG A;  2KX6 A;  5JYP A;  1E3U D;  4DXC A;  4CLC C;  1PNE A;  1MWT A;  3HUO A;  3PXP A;  5F83 A;  5HWW A;  2OOL A;  4DJ2 A;  1ERM A;  4L9G A;  1MKM A;  2E8J A;  2QJ5 A;  4HHD A;  3IH9 A;  4WUJ A;  1BZA A;  3A0V A;  4BEN A;  2YKH A;  3H7W B;  1YSP A;  3ZG0 A;  4RA7 A;  1S67 L;  1W79 A;  4R1G A;  4U0X A;  1XJ3 A;  1PWC A;  3UB8 A;  1MC0 A;  4L9F A;  4X1L A;  3B3X A;  3T4K A;  1K55 A;  1SDE A;  5C5K A;  3EEH A;  5L09 A;  1KDS A;  4KQQ A;  4YOF A;  1N9O A;  3I7J A;  3LEZ A;  1S66 L;  5CRF A;  4NEE D;  3MBZ A;  4OPY A;  2VA0 A;  1XJ4 A;  1ESU A;  1MWU A;  1F2K A;  4B4Z A;  4E3K A;  3GSG A;  3D4F A;  1RCJ A;  3VP1 A;  4EER A;  3CUE A;  4S2O A;  4GDN A;  3ZVT A;  4KZA A;  4ETX A;  3ZDJ A;  2A2L A;  3KSF A;  2Y2N A;  4GN2 A;  1GCE A;  2XR0 A;  4S2K A;  3V50 A;  5EM1 A;  2OSU A;  1K56 D;  1MPL A;  3U2A A;  2O99 A;  3RH8 B;  3MKE A;  4FSF A;  4F94 A;  4WZ5 C;  1P9R A;  4JLF A;  2Y55 A;  4QY6 A;  4IJG A;  1L0D A;  1IOU A;  3PBQ A;  4ME4 A;  3SS5 A;  4CLC A;  2X71 A;  2Z6C A;  2I72 A;  4OPQ A;  5EPH A;  3SS3 A;  2W3F A;  1P0Z A;  3DTI A;  3TG9 A;  4GS9 B;  4C75 A;  2ZM2 A;  4OLG A;  2VJW A;  1K4E A;  4RX3 A;  4S2J A;  5FI2 A;  3M6B A;  4XUZ A;  2HJE A;  2WGW A;  2Y2L A;  1YLP A;  1V9Z A;  3NY4 A;  2J3T D;  1KOU A;  3DW0 A;  1SDN A;  2XGN A;  2Q0O A;  1KVM A;  2PT7 A;  4OP8 A;  1BYW A;  3DTM A;  3P09 A;  3PTE A;  3W4O A;  1I2W A;  1ALQ A;  3HLF A;  5TBM B;  5A90 A;  1UGU A;  3VMA A;  3MF0 A;  3MQO A;  2Y91 A;  1HD8 A;  4GS9 A;  4Y0U A;  2M7V A;  3FKW A;  4HES A;  2Y2H A;  1H5X A;  3ZYT A;  4K0X A;  4X6T A;  3F1P B;  3KYZ A;  1I2S A;  3NBL A;  2D02 A;  3R7W B;  5E2E A;  3HJK A;  3G31 A;  2OAQ 1;  4MEZ A;  2GZA A;  3OPR A;  3LUQ A;  4EET B;  1BLC A;  4LV0 A;  4KZ3 A;  3U4L P;  4QU3 A;  3HLC A;  4WEJ A;  5TBM A;  4BQM A;  4WZ5 A;  2I9V A;  1M6K A;  3FKV A;  5DJU A;  2Z2L B;  4U3T A;  1GHP A;  4UQI S;  3BFC A;  3WS5 A;  3L7H A;  2VZW A;  3DTK A;  3S22 A;  3T4T A;  1IFQ A;  2QHK A;  3A0R A;  3FZC A;  3NOT C;  5TGF A;  4N1H A;  1W8Q A;  4OKP A;  5HSQ A;  2HV1 A;  5AJG A;  4JGQ A;  1F98 A;  5HPF A;  5GLC A;  4Y17 A;  2BAS A;  2V8F A;  4JPM A;  2CC1 A;  5IT5 A;  2WZZ A;  3C4O A;  3UPP A;  2Y79 A;  4I5S A;  5F1F A;  4DRT A;  3S7N A;  2LB5 A;  2V0U A;  3NOP C;  4ZRR A;  3O5Y A;  4N1X A;  1NLZ A; 
#chains in the Genus database with same CATH homology
 2EX9 A;  4JF6 A;  3NDG A;  4OH0 A;  4ZAM A;  1EWZ A;  3W8K A;  2JE5 A;  3G4P A;  1ES3 A;  5L2F A;  4ZTK A;  3HVF A;  3PBS A;  1LI0 A;  1E3U A;  2XFS A;  1QMF A;  3G30 A;  4KZ7 A;  4GNU A;  3CMZ A;  2XK1 A;  3UE1 A;  3ZVW A;  4CJN A;  4B88 A;  3BFD A;  4PPR A;  1K54 A;  4EQI A;  1XA7 A;  4BL3 A;  4DE0 A;  4OQH A;  4RVA A;  2ZJ9 A;  2QMI A;  5TR7 A;  3A3F A;  5DTS A;  5I94 A;  1JVJ A;  4JXG A;  3G2Y A;  4N9K A;  3NCK A;  3LO7 A;  3QNB A;  3GRJ A;  2H0Y A;  2A3U A;  3PBN A;  2Y2M A;  3Q07 A;  3IHA A;  3ZGA B;  3W4Q A;  3BLS A;  3WS1 A;  4GDB A;  1JWZ A;  4PM9 A;  3G2Z A;  2ZC5 B;  1PZP A;  2P74 A;  2XF3 A;  3IF5 A;  4Z9Q A;  1IEM A;  2HP6 A;  2PBY A;  2G2W A;  3OCN A;  4C6Y A;  4FD8 A;  1K6R A;  3BYD A;  1PWD A;  4X53 A;  1MY8 A;  3IH8 A;  4DF6 A;  2P9V A;  4OPZ A;  5HAI A;  2A49 A;  3AGD A;  2EXA A;  4S2P A;  5DF7 A;  4EWF A;  4WMC D;  5EVI A;  4QY5 A;  4WZ4 A;  2XLN A;  1LLB A;  5E2H A;  2ZC3 B;  5GHY A;  4Y7P A;  2ZMA A;  3GTC A;  1K54 C;  2DRW A;  5DVA A;  4ZJ2 A;  5JYO A;  2H0T A;  4K0W A;  4WEL A;  4OLD A;  4DDS A;  3EQV A;  4JKT A;  3IXD A;  1KDW A;  1O07 A;  3GMW A;  3SS4 A;  1YLT A;  3OPL A;  3TSG A;  4BD1 A;  4OQG A;  3G35 A;  4ID4 A;  2BG1 A;  3NDE A;  1IYP A;  2OLU A;  1XP4 A;  2WAF A;  3MZF A;  3CJM A;  1PIO A;  4YFM A;  1TEM A;  3N6I A;  3NI9 A;  4X55 A;  3VP3 A;  4ZBE A;  4KZ8 A;  4O7D A;  3LCE A;  1YMS A;  1MBL A;  2C5W B;  2V20 A;  3A3D A;  3HLD A;  1H8Z A;  5G18 A;  4OVD A;  4CPK A;  3HL9 A;  3GVB A;  2J7V A;  2Y2K A;  1TDG A;  4RYE A;  4P6B A;  4LEN A;  4JF4 A;  3N8L A;  4QB8 A;  2J9P A;  2VGK A;  4KZB A;  3WS2 A;  2B5R A;  3IF6 A;  1M40 A;  3N8R A;  3WRT A;  3WWX A;  2WUQ A;  3FV7 A;  3SOI A;  2HP9 A;  1K56 A;  3O3V A;  3UDF A;  1FCM A;  3OCL A;  3OPP A;  3IT9 A;  4EBL A;  3SH8 A;  5CTM A;  5CEC A;  5CEB A;  4B4X A;  4A5R A;  1YMX A;  1YLW A;  4IBR A;  5CER A;  1BUE A;  1CK3 A;  1DJA A;  1TDL A;  2E8I A;  2ZQA A;  5FDH A;  3QNC A;  4KQR A;  1K57 A;  3ZNT A;  1G68 A;  4JXW A;  2C6W B;  3UPN A;  1YM1 A;  3E2K A;  5GHX A;  3BFG A;  2XDM A;  1PW1 A;  3HLE A;  1LI9 A;  4M3K A;  5EEC A;  1HVB A;  4X68 A;  3ZNY A;  5E2F A;  3O87 A;  1PI4 A;  5CHM A;  1ZG6 A;  3Q7Z A;  1Y54 A;  1XGJ A;  4YIN A;  3ZHH A;  3VP4 A;  1DJC A;  4RX2 A;  5GHZ A;  1NJ4 A;  4IVK A;  3GQZ A;  5CHJ A;  2EFU A;  3BRM A;  4E6W A;  5FQM A;  3MXR A;  5M18 A;  4OON A;  1VQQ A;  3HBR A;  4N9L A;  5M1A A;  2XD1 A;  3S4X A;  4E6X A;  1RGY A;  4MBK A;  3V5M A;  3G32 A;  5CHU A;  4LV1 A;  5FAP A;  1IYQ A;  4FCF A;  3WS4 A;  2HDQ A;  2X02 A;  1L0E A;  1Z6F A;  2ZQ8 A;  4E3I A;  3UE3 A;  2Y2J A;  3FYZ A;  4DKI A;  2WGW B;  4OP5 A;  3LY4 A;  1K6S A;  1NYM A;  3FWL A;  1DJB A;  1YLY A;  2HPB A;  3RJU A;  1K57 C;  1SCW A;  4R0Q A;  1S0W A;  1N9B A;  2VGJ A;  2ZQ9 A;  2J8Y A;  1MWR A;  4UA9 A;  4UHU A;  3DWK A;  5DF8 A;  4GB7 A;  4WMC A;  2V2F F;  1HTZ A;  1G6A A;  2WAD A;  1KE0 A;  3SH7 A;  4KG2 A;  5M19 A;  4R3B A;  2BLS A;  1E4D A;  1L2S A;  2EFX A;  3ZCZ A;  1ZG4 A;  3ISG A;  1GA0 A;  4P0M A;  4C3Q A;  3WRZ A;  4WYY A;  4GD6 A;  3IHB A;  4QD4 A;  1MWS A;  4HBU A;  1IYS A;  1PWG A;  3IQA A;  1IEL A;  1NZO A;  1W5D A;  3IWI A;  4R4S A;  5CGS A;  3IXH A;  1GHI A;  2IWC A;  5FI6 A;  2H10 A;  1BTL A;  2XQZ A;  3NIA A;  4OQ0 A;  5AQB A;  3C5A A;  3N7W A;  1HZO A;  1L0F A;  5FQJ A;  1L0G A;  1GHM A;  1YT4 A;  2ZQD A;  2Y2O A;  1SKF A;  1JWV A;  2WYX A;  4BL2 A;  3HLW A;  3BFF A;  5F82 A;  3HUM A;  3PBO A;  4EBN A;  1XKZ A;  3A3J A;  5FQQ A;  5FQ9 A;  1SHV A;  2ZLY A;  2V1Z A;  3E2L A;  3BLM A;  1BSG A;  1OME A;  3M6H A;  2Y2Q A;  4MNR A;  5A92 A;  1BLH A;  3A3I A;  1ERO A;  2Y2P A;  3ITA A;  2OV5 A;  5JYP A;  5A91 A;  2Y4A A;  1E3U D;  5A93 A;  4DXC A;  3ITB A;  1VM1 A;  1KE3 A;  1NYY A;  2WZX A;  5AQA A;  1XGI A;  1MWT A;  1XA1 A;  4JXS A;  3QHY A;  3HUO A;  5GLA A;  2EXB A;  4JBF A;  4MLL A;  2EX6 A;  4DDY A;  5F83 A;  5FAS A;  1C3B A;  4LV2 A;  1FCO A;  4DE3 A;  3Q7V B;  3ZG9 B;  1ERM A;  4R23 A;  3JYI A;  3IH9 A;  1BZA A;  5E43 A;  2Y2I A;  1ZC2 A;  4WBG A;  3UN7 A;  4BEN A;  2GDN A;  3ZG0 A;  4RA7 A;  3RXX A;  1W79 A;  4R1G A;  4U0X A;  4E3M A;  5DF9 A;  3A3E A;  1PWC A;  2JCH A;  4D2O A;  1ONH A;  1FCN A;  1I5Q A;  1Q2P A;  4IBX A;  4L0L A;  3B3X A;  4OOM A;  1K55 A;  1JWP A;  1SDE A;  4S2M A;  2UWX A;  5EVI D;  1NZU A;  2XEP A;  1K4F A;  2FFY A;  2WAE A;  4XXR A;  1CEF A;  3UE0 A;  5AQ9 A;  1KDS A;  1NRF A;  1BLS A;  5KSC A;  3VP2 A;  4KQQ A;  2JBF A;  2XH9 A;  5U47 A;  3I7J A;  3LEZ A;  1KGE A;  1ES4 A;  4DE2 A;  3P98 A;  5CRF A;  3UDI A;  3VOZ A;  2IWB A;  3MBZ A;  3Q7V A;  5CXW A;  4FH4 A;  4OPY A;  2PU4 A;  4UAA A;  1MKI A;  4H8R A;  5EOE A;  5HAR A;  4KZ4 A;  3Q1F A;  3SH9 A;  3N8S A;  1WYC A;  3PBT A;  1ESU A;  1MWU A;  5HAQ A;  2Y2G A;  4B4Z A;  4BD0 A;  4E3K A;  3GSG A;  2WGV A;  2WGI A;  3D4F A;  3MXS A;  3O86 A;  1IYO A;  3ZG7 B;  1RCJ A;  3VP1 A;  4IED A;  4PM5 A;  1FQG A;  5KSH A;  3MFD A;  4EUZ A;  5KMW A;  1NY0 A;  3VFH A;  1NXY A;  4S2O A;  4GDN A;  4S2L A;  5DTK A;  3ZVT A;  4KZA A;  5HX9 A;  3VFF A;  3ZDJ A;  5J8X A;  4OQI A;  5CGX A;  1K55 C;  2Y2N A;  4GN2 A;  3NC8 A;  2PU2 A;  4KQO A;  1GCE A;  1U60 A;  4KEN B;  3DWZ A;  1CI8 A;  2XR0 A;  1E25 A;  4KG6 A;  1FSW A;  4S2K A;  3V50 A;  4NET A;  3ZG5 A;  4E3J A;  2OSU A;  1K56 D;  4ZDX A;  1MPL A;  4KZ6 A;  4Y0T A;  1BT5 A;  3V3R A;  3MKE A;  4FSF A;  1LHY A;  3VOY A;  1Q2Q A;  3OC2 A;  5KZH A;  4F94 A;  2ZQ7 A;  3HUN A;  4PMA A;  5GL9 A;  3UO9 A;  4WZ5 C;  3AGF A;  3BEB A;  4JLF A;  5DTT A;  2Y55 A;  4QY6 A;  1QME A;  3PBR A;  1O7E A;  1L0D A;  3PBQ A;  3ZFZ A;  2P9V B;  3SS5 A;  2X71 A;  2R9W A;  2I72 A;  4OPQ A;  2WK0 A;  5EPH A;  2ZM0 A;  3SS3 A;  4MBF A;  5EVI B;  2J9O A;  3BM6 A;  4UA6 A;  3AGE A;  4ZJ3 A;  3M2J A;  3WS0 A;  5EVL A;  1H8Y A;  3OZH A;  4R3J A;  1WE4 A;  3TG9 A;  1ES5 A;  3PAE A;  4C75 A;  4GD8 A;  2ZM2 A;  3Q82 A;  4OLG A;  3VSL A;  2DCF A;  3IXG A;  4LCL A;  3VSK A;  4BJP A;  1K4E A;  4RX3 A;  5HL1 A;  3C4P A;  3TOI A;  4KG5 A;  3G34 A;  1DY6 A;  3OPH A;  2EX2 A;  5IHV A;  4HBT A;  4S2J A;  5EOO A;  5FI2 A;  5FSR A;  4BLM A;  3M6B A;  4QJG A;  3UNW A;  3C7V A;  2ZM8 A;  4XUZ A;  2WGW A;  1BUL A;  2OLV A;  2Y2L A;  2G2U A;  1YLP A;  4GZB A;  4PM7 A;  4S2N C;  3NY4 A;  5EE8 A;  3PAG A;  1ESI A;  1K38 A;  4N92 A;  2EX8 A;  2HDS A;  3DW0 A;  5HFO A;  1LL9 A;  5GLB A;  4Q8I A;  1LL5 A;  1SDN A;  2XGN A;  1KE4 A;  1KVM A;  4OP8 A;  5FAT A;  4LCM A;  3ZG8 B;  2WKH A;  3DTM A;  1ES2 A;  1K25 A;  3P09 A;  5AQ7 A;  3PTE A;  4P85 A;  1ONG A;  3S1Y A;  3W4O A;  3W4P A;  5FAQ A;  1XX2 A;  1I2W A;  1ALQ A;  1XPB A;  3EQU A;  3HLF A;  5A90 A;  1PW8 A;  2DNS A;  5FI7 A;  1J9M A;  1N4O A;  4P87 A;  2X01 A;  3VMA A;  2H5S A;  3IF6 B;  2Y91 A;  1WYB A;  3MKF A;  1HD8 A;  1KGG A;  1YLZ A;  4DXB A;  2RCX A;  2HDU A;  3GV9 A;  5TFQ A;  4LV3 A;  4Y0U A;  3FKW A;  4HES A;  3N4I A;  2Y2H A;  4WEK A;  1PZO A;  4OOL A;  5EUA A;  1IKG A;  1H5X A;  4NK3 A;  2HDR A;  2QPN A;  5HAP A;  4K0X A;  4K91 A;  2XD5 A;  4EBP A;  1MXO A;  3HLG A;  4X6T A;  4WM9 A;  2Q9M A;  1I2S A;  3LY3 A;  3NBL A;  1YLJ A;  2HP5 A;  3UDX A;  5E2E A;  2ZQC A;  3RXW A;  3G31 A;  2ZC6 B;  1RP5 A;  4MEZ A;  2Q9N A;  2R9X A;  4R4R A;  3OPR A;  4E3N A;  2JC7 A;  2ZD8 A;  1BLC A;  1GA9 A;  4JXV A;  1W8Y A;  5FQK A;  1ERQ A;  3MZE A;  1PI5 A;  1IKI A;  4LV0 A;  1FR6 A;  3BFE A;  4KZ3 A;  4QU3 A;  3HLC A;  2ZC4 B;  4WEJ A;  3HRE A;  1JTD A;  3HLB A;  4X56 A;  5HW3 A;  5EVI C;  3UPO A;  4PM8 A;  2ZC7 A;  4BQM A;  4PM6 A;  1FR1 A;  2WKE A;  4WZ5 A;  3C7U A;  1M6K A;  1CEG A;  3FKV A;  1FOF A;  1KVL A;  2Z2L B;  4U3T A;  1YQS A;  5D3O A;  3UY6 A;  2FFF B;  4FH2 A;  1GHP A;  4ZJ1 A;  3O88 A;  4E3O A;  2Z2M B;  3BEC A;  4E3L A;  3BFC A;  1TVF A;  3V3S A;  3MZD A;  4QHC A;  3WS5 A;  5E2G A;  1AXB A;  4DE1 A;  3Q81 A;  4IVI A;  2Y59 A;  5CTN A;  1KGF A;  3S22 A;  3GR2 A;  3IWO A;  4S2I A;  5CGW A;  3V39 A;  1PYY A;  2WKI A;  3FZC A;  1XXM A;  4N1H A;  5TGF A;  1W8Q A;  4OKP A;  4U0T A;  1FSY A;  1CI9 A;  4UA7 A;  5BOH A;  4GKU A;  4JF5 A;  4OOY A;  4X69 A;  3CG5 A;  4EV4 A;  2RL3 A;  4XUX A;  4Y0O A;  5FAO A;  5FA7 A;  1S6R A;  4MBH A;  5GLC A;  4KZ9 A;  5FQI A;  5GLD A;  5F1G A;  4JPM A;  4S2N A;  2CC1 A;  4OPR A;  2WZZ A;  3C4O A;  3UPP A;  3CZD A;  3IWQ A;  1RGZ A;  3M2K A;  1W7F A;  4HEF A;  1JTG A;  1EI5 A;  3IF6 C;  5F1F A;  3VP0 A;  4DRT A;  1ZKJ A;  3IXB A;  2XFT A;  2IWD A;  1BLP A;  2QZ6 A;  5CED A;  4KZ5 A;  4N1X A;  4GOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...