3SH8A

Crystal structure of fluorophore-labeled beta-lactamase penp in complex with cephaloridine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
257
structure length
253
Chain Sequence
b'KDDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFCPENPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
molecule tags Hydrolase/antibiotic
source organism Bacillus licheniformis
publication title Increased structural flexibility at the active site of a fluorophore-conjugated beta-lactamase distinctively impacts its binding toward diverse cephalosporin antibiotics
pubmed doi rcsb
total genus 84
structure length 253
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3sh8A00
4IBXA 4WYYA 2HP6A 3ZDJA 3ZVTA 3DWZA 3UDIA 3TSGA 2H0TA 1XA7A 3E2KA 4JLFA 4X68A 4D2OA 2EX2A 2P9VA 4R1GA 5HAQA 1WE4A 1FR6A 3WWXA 4EBPA 4EV4A 3SOIA 5FASA 4Q8IA 1PW8A 1JWVA 4JPMA 3LY4A 3HLBA 5AQ9A 2ZC7A 1GA0A 3IH9A 5GLDA 4DKIA 2J9OA 1ES3A 1GHMA 5EVIA 2WUQA 4X69A 5HW3A 4K91A 2WKEA 3PBTA 3ZFZA 4OLGA 1NZUA 1I2WA 4KG6A 4DDYA 4QY6A 4KQQA 1H5XA 1MWTA 3N6IA 2ZD8A 4E3OA 1JWPA 4IVIA 2A3UA 1ZC2A 3GV9A 3UE3A 5A92A 4ZBEA 1EWZA 3G30A 4DE3A 4JKTA 2XLNA 1MWSA 1NJ4A 3N8SA 3OCNA 4QJGA 3MXRA 3LCEA 4O7DA 2Y2HA 1KDWA 1XX2A 1BZAA 5A93A 5M19A 1CEGA 4MLLA 4S2KA 3HLEA 2Y2KA 2Q9MA 3BRMA 5CTNA 5AQ7A 3ZG8B 5EOOA 1Y54A 4U0TA 5GLBA 3G34A 5EOEA 3VSKA 5CHMA 3BEBA 5FAOA 3EQVA 2EXBA 1O7EA 3IT9A 3N8LA 3VP4A 1K6RA 1FCOA 3HUNA 5G18A 4KZ8A 3C4OA 3BFCA 3VP0A 5HAIA 1JVJA 4RYEA 3SS3A 3M6HA 4E3KA 3G2YA 4PM8A 5FA7A 4IVKA 4KZ7A 2OSUA 2Y2OA 3MFDA 1EI5A 4MNRA 4WBGA 5M18A 1N9BA 2Y2JA 4IBRA 3IXGA 3JYIA 1NXYA 5GHXA 4OOMA 5E2HA 4R3BA 4B4XA 1DY6A 2ZM2A 2XD1A 3NY4A 5DF7A 2G2WA 4Y0TA 1GHIA 1S0WA 2ZC4B 3PAEA 2WZZA 1KE3A 3WRZA 1SDEA 4DDSA 3CZDA 2X71A 2QZ6A 3IF5A 2DCFA 1RP5A 5CGXA 4C3QA 2WK0A 1H8YA 1W7FA 4F94A 1YLWA 5EVIC 3HVFA 3AGEA 3RXWA 1MKIA 3HLGA 1K57A 3IWQA 3HL9A 1FR1A 1KDSA 3IXBA 4BD1A 4N92A 5FQQA 5U47A 4XXRA 4OP8A 2ZQDA 3VP1A 2XFTA 1BLPA 2EX8A 3A3JA 4S2NC 3NDGA 4Y0UA 3WS1A 3IF6B 4E3MA 2ZQ8A 4JF6A 2J7VA 3S1YA 4BL3A 3V39A 3ISGA 3M6BA 4EUZA 3O86A 3QNBA 4KENB 5CGWA 4PPRA 5E2GA 3SS4A 3O3VA 1YLZA 5D3OA 3BFFA 3GSGA 1W79A 2VGKA 3G32A 3OPPA 2H0YA 4UAAA 4PM9A 1GHPA 2HDQA 3HLDA 5FAQA 3VOYA 4DE1A 5FQ9A 4ZTKA 1DJBA 3ITAA 1PZOA 3IWOA 4OLDA 2R9XA 3G4PA 3P09A 4FH4A 4WZ5C 1FCNA 4KZBA 1C3BA 3A3DA 3ITBA 3IXHA 2Y2GA 4FH2A 4MBHA 1MXOA 2XGNA 4MEZA 1G68A 4JXVA 4OH0A 2XD5A 4JF5A 3OPLA 2HDSA 3QNCA 3MZDA 5EUAA 3ZG5A 3E2LA 3MZFA 4LCMA 4MBKA 3GR2A 1MWRA 4FD8A 3RXXA 1ES2A 2IWDA 1S6RA 4C6YA 4UHUA 3UPNA 4JF4A 1PZPA 4OKPA 5DTKA 4KZ6A 4N9KA 4DF6A 1CI9A 4RVAA 3PBNA 3LY3A 2WKIA 2ZMAA 5E2FA 5KSHA 1NYMA 3GQZA 3WS4A 3OCLA 2JE5A 5F83A 3SH9A 2C6WB 1K56D 4FCFA 1KGFA 4LENA 2HPBA 4DE2A 2EXAA 4BQMA 2ZQ9A 3OPHA 4JBFA 4OPYA 4KZAA 4OPRA 1AXBA 3IXDA 3OPRA 1L2SA 5I94A 1K6SA 1BSGA 3VFFA 3QHYA 5IHVA 4K0XA 3UNWA 4ZAMA 4GNUA 1FQGA 5HL1A 3HLWA 4PM6A 2HDUA 5HAPA 2DRWA 3IHBA 1HD8A 4GB7A 2V1ZA 4R4RA 4YFMA 2V2FF 3ZGAB 5FQJA 3G2ZA 3V50A 3PBOA 1K55A 1K25A 4UA6A 3D4FA 1PYYA 2H10A 3NBLA 5CHUA 1IYPA 2XEPA 5E43A 2ZJ9A 3TOIA 1K54A 1HVBA 2BLSA 2XQZA 4FSFA 4OP5A 4S2OA 1PI4A 5DTSA 3GTCA 3EQUA 1KE0A 4PMAA 5F1GA 2ZC5B 3WRTA 2RL3A 1XKZA 3HREA 5EE8A 4GOGA 3FV7A 1JTGA 1KE4A 2XK1A 4PM7A 3ZG9B 2DNSA 5EVID 1HTZA 4UA7A 2WGWA 4B88A 4GN2A 1MY8A 2CC1A 3BYDA 1M40A 4EBNA 1O07A 4WELA 4A5RA 5GHYA 3HLCA 2Y2MA 1N4OA 1OMEA 1U60A 3PBRA 3BFDA 1K4FA 3OC2A 4E6XA 3Q7VA 1VQQA 2Y2QA 2PBYA 3M2KA 5FSRA 3FYZA 4KG5A 2RCXA 3BFGA 1DJAA 3HUOA 3IH8A 4KQOA 3C7VA 4ZJ3A 2FFYA 2EX9A 2QPNA 1G6AA 2EFXA 2P9VB 3MXSA 1IEMA 1BLCA 1XGIA 4XUZA 1ALQA 1WYBA 1NYYA 3M2JA 2V20A 4KZ5A 3AGFA 1K38A 4HBTA 3HUMA 3W4PA 1W8QA 1QMEA 3NC8A 4WMCA 1IKGA 2I72A 4WEJA 1RGZA 1ONGA 5F1FA 2X01A 3SH8A 2ZM8A 4GZBA 4S2JA 3UN7A 4RA7A 2QMIA 5GHZA 1ES5A 3IQAA 5DF8A 4LV0A 3UDXA 4KQRA 3OZHA 3ZNYA 5CXWA 1NRFA 1FOFA 5FQMA 2JCHA 2UWXA 4Y0OA 4QHCA 1YLJA 3LO7A 2XF3A 1QMFA 4N1HA 1GA9A 1EROA 2XDMA 4DXBA 4EWFA 3HBRA 1J9MA 5CHJA 2XH9A 4OQIA 1TDLA 1TEMA 2R9WA 3PTEA 1PWCA 4X56A 1RCJA 3CMZA 3N8RA 4H8RA 4P87A 3W8KA 4JXWA 3C4PA 4R3JA 4N1XA 5KMWA 3C7UA 4WEKA 5FI7A 3O88A 1MBLA 4JXSA 3WS2A 3N4IA 2X02A 1KGEA 5EECA 5CEDA 1ES4A 1E3UD 1ZG4A 4P6BA 3VFHA 1RGYA 3G35A 1CK3A 1K54C 4OQHA 4HBUA 3NI9A 3IF6A 5HX9A 4GD8A 4X55A 1BTLA 4LV1A 4P0MA 4RX2A 4WM9A 3UE0A 1IYQA 3Q7ZA 4OOLA 3UY6A 1I2SA 4U0XA 1IKIA 3BECA 3NCKA 3PBSA 4X53A 2Y2NA 3UDFA 5KZHA 2WZXA 4M3KA 4E6WA 4OQ0A 1K55C 5CECA 4C75A 3MZEA 3ZNTA 4X6TA 1Z6FA 4B4ZA 5FI6A 4YINA 3UE1A 3BLSA 1M6KA 4GKUA 4S2NA 5EVLA 2JBFA 3G31A 1JTDA 4R23A 1BLHA 1CEFA 1HZOA 4E3NA 2WGVA 4WZ5A 1LL9A 5TGFA 2ZLYA 1K56A 3VOZA 5A91A 3ZG7B 2ZC6B 2HP5A 4LV3A 3BLMA 5EVIB 5FATA 5TFQA 4OQGA 5FQKA 1E4DA 3FKVA 2WKHA 4GDBA 1KVLA 1ZG6A 5AQBA 4QY5A 3MKEA 1YMXA 1YM1A 4DXCA 2OLVA 3P98A 1Q2QA 1SCWA 2WYXA 3NIAA 1ERQA 1I5QA 4R4SA 5KSCA 2E8IA 1PIOA 3NDEA 3Q07A 2Y2IA 3IF6C 4U3TA 3UO9A 4QB8A 5BOHA 2Y91A 3A3EA 4IEDA 4S2MA 5AQAA 4CJNA 5TR7A 1IELA 3BFEA 4KZ9A 3CJMA 1PW1A 3FZCA 2WAEA 5CERA 1K4EA 2Z2LB 4S2IA 3ZVWA 3ZCZA 4BLMA 1KGGA 1Q2PA 2PU2A 5FAPA 1W8YA 5CEBA 4KZ4A 1L0FA 2ZQCA 3Q7VB 3O87A 2A49A 1LI0A 3UPPA 4OOYA 2EFUA 1WYCA 4DRTA 3FWLA 4Y7PA 4S2PA 5FQIA 5JYOA 3TG9A 1YQSA 3FKWA 3Q81A 1IYOA 5L2FA 2GDNA 1BT5A 2ZQ7A 1ZKJA 1KVMA 3VSLA 1E25A 3ZHHA 4GDNA 1YLTA 5GLAA 3WS0A 2PU4A 4NETA 2WADA 2Y59A 3B3XA 3V5MA 5CTMA 1TDGA 4E3JA 2ZQAA 1FCMA 1MWUA 1XP4A 5DVAA 3V3SA 4DE0A 1GCEA 4OONA 1YMSA 2HDRA 3IHAA 1VM1A 2P74A 1IYSA 4QU3A 2J9PA 1LL5A 5FDHA 3ZG0A 4KZ3A 1XGJA 3PAGA 5GLCA 3RJUA 5HARA 3AGDA 4BJPA 1K57C 1XXMA 1SDNA 2OV5A 2G2UA 4NK3A 3V3RA 4ZDXA 3VMAA 3GVBA 4R0QA 4HEFA 1SKFA 1YLYA 1CI8A 4L0LA 4ZJ2A 4EQIA 5A90A 5M1AA 1ERMA 4BD0A 1L0GA 1XA1A 4BENA 2C5WB 2Y55A 2BG1A 1ESIA 3DTMA 3LEZA 1LI9A 2Y2LA 4OVDA 4EBLA 1NZOA 3C5AA 3N7WA 3A3IA 1H8ZA 4BL2A 3BM6A 4ID4A 2Y4AA 3SH7A 2Y2PA 2XFSA 2IWCA 1BUEA 1ONHA 3GMWA 4MBFA 5CRFA 4Z9QA 5DTTA 3SS5A 1PWDA 3A3FA 2H5SA 2HP9A 3IWIA 4XUXA 4GD6A 3I7JA 5GL9A 3VP3A 1NY0A 2VGJA 4ZJ1A 3W4OA 5CGSA 3GRJA 3W4QA 4OPQA 4LV2A 1L0DA 2WGWB 1ESUA 3DWKA 4S2LA 4OPZA 1SHVA 3Q82A 2ZM0A 2FFFB 2EX6A 5FI2A 1LLBA 3MBZA 1YLPA 4WZ4A 5EPHA 4PM5A 3UPOA 1JWZA 2JC7A 2WAFA 2ZC3B 2WGIA 1PWGA 2IWBA 4QD4A 1L0EA 1FSWA 3Q1FA 3S4XA 3S22A 1TVFA 4RX3A 2B5RA 3WS5A 5F82A 3MKFA 5HFOA 2J8YA 4UA9A 1XPBA 4E3LA 3VP2A 5JYPA 1YT4A 5DF9A 4K0WA 5E2EA 2Q9NA 4CPKA 4E3IA 1MPLA 1BLSA 4WMCD 1PI5A 1DJCA 3CG5A 3HLFA 4HESA 3PBQA 4LCLA 1BULA 4P85A 1FSYA 4N9LA 1LHYA 1W5DA 1E3UA 2XR0A 4KG2A 4JXGA 2Z2MB 5J8XA 2OLUA 3DW0A
chains in the Genus database with same CATH superfamily
2VV8A 3NOPC 2O9AA 1GSVA 3E2KA 4KQDA 4EETB 1WE4A 5MC7A 4HQAA 4EV4A 3H82A 1PW8A 3A0VA 4HP9A 3B47A 4JPMA 4WN5A 2ZC7A 1YKDA 4XT2B 3SZTA 1GA0A 5GLDA 2J9OA 1GHMA 2WUQA 2O0YA 4OLGA 1I2WA 2XROA 1H5XA 1MWTA 4IVIA 2A3UA 1G6OA 3G30A 1MWSA 1NJ4A 2KDKA 4QJGA 1KDWA 4S2KA 3S7OA 5AQ7A 3ZG8B 5EOOA 4U0TA 1TS6A 3BQAA 3BEBA 3RFBA 3EQVA 1O7EA 2W3HA 5AVEA 5K5BA 1T19A 3HUNA 3BFCA 3F1PB 4RYEA 3SS3A 1S1YA 2Y2OA 3MFDA 5IS1A 1EI5A 4WBGA 2Y2JA 2XSSA 2E8JA 3OOVA 4OOMA 5HWVA 4EU0A 4B4XA 2XD1A 2L4RA 2WZZA 1KE3A 4YWZA 1SDEA 2DMWA 3CZDA 4DDSA 2DCFA 1V9ZA 1MKIA 3HLGA 3F1OB 2GJ3A 4N92A 3QP1A 3R4KA 3LIEA 5EM1A 2PYPA 1Y28A 3UMEA 3V39A 3M6BA 3O3VA 4MN5A 4UAAA 2V1BA 5FAQA 2ZMFA 5FQ9A 5TBMB 4ZTKA 3ITAA 2R9XA 4WZ5C 1FCNA 1N9NA 1N9LA 2ZMVA 4CLCB 2XGNA 3JVVA 2HDSA 3QNCA 3CUEA 3UPNA 4JF4A 4KZ6A 4MDZA 4RVAA 3LY3A 5E2FA 5KSHA 3KYZA 1NYMA 4LENA 1OJGA 2HPBA 4JGOA 1H0MA 2VLGA 2ZQ9A 4KZAA 3IXDA 4WF0A 3PYPA 3VFFA 5HL1A 5HAPA 2DRWA 3IHBA 4R4RA 5FQJA 3G2ZA 4I38A 5HD5A 1K25A 4HY8A 3D4FA 1PYYA 2H10A 2PAVP 2XEPA 3CPTA 2ZJ9A 1HVBA 4OP5A 1KE0A 2JKTM 5FDSA 2RL3A 2V0UA 2PYRA 2M7UA 4PM7A 4GN2A 3LIDA 5GHYA 2ZBBA 2ACGA 1H3QA 1OMEA 5LBRA 3PBRA 3BFDA 4CLCE 4ZJ3A 3IH8A 2NUTC 1PFLA 5EM0A 2FFYA 1G6AA 3MXSA 1BLCA 4XUZA 2FZ0A 3M2JA 3AGFA 1K38A 4HBTA 2W3EA 2M7VA 3B33A 2I72A 2B95A 4GZBA 4Y17A 5HDSA 2INWA 3DAVA 3UN7A 2JHEA 2JKRI 3G6OA 2BTFP 4F3LA 3ZNYA 3E4QA 2WKPA 5CXWA 4RQ9A 4Y0OA 1YLJA 2XF3A 4N1HA 4EWFA 4B9OA 3PHYA 1J9MA 5CHJA 2XH9A 3BY8A 4OQIA 2R9WA 5DKLA 1RCJA 4H8RA 3C4PA 4R3JA 4N1XA 5HPFA 3O88A 2QHKA 4EERA 3WS2A 2PBDP 5CEDA 1RGYA 1K54C 5HX9A 3IF6A 4X55A 1S4SA 4LV1A 4P0MA 3UE0A 4NG2A 1IKIA 3NCKA 2B18A 3F1OA 1K55C 5CECA 3ZNTA 4X6TA 1Z6FA 1FIKA 2JBFA 2V0WA 4R23A 1BLHA 1LL9A 1K56A 5A91A 2ZC6B 3C2WA 2O9BA 3BLMA 4P6ZM 3VE3A 2JKTI 2WKHA 1H8MA 4GDBA 1ZG6A 2GZAA 2OLVA 3P98A 1Q2QA 1SCWA 2WYXA 3NIAA 2XA7S 1AWIA 1SZVA 5TR7A 3S7NA 3KSGA 4KZ9A 4MN6A 3CJMA 4JGRA 2WAEA 4BLMA 1XJ2A 5FAPA 3T12B 2A49A 4FUWA 3UPPA 2VEAA 4GLQA 5F5YA 3TG9A 3FKWA 2LB5A 1ZKJA 1E25A 5GLAA 2WADA 4HP4A 2Y59A 3B3XA 1TDGA 2EA9A 4E3JA 1FCMA 1T1BA 4OONA 1LT0A 4HIAA 1LL5A 5FDHA 3PAGA 3RJUA 1K57C 2OV5A 4X1MA 3CPTB 1ZHHB 1SKFA 1ERMA 1L0GA 4BENA 5J4EA 2C5WB 3D9YA 2BG1A 1LI9A 2Y2LA 1WA9A 4BL2A 1CQAA 3BM6A 3SH7A 3GMWA 4Z9QA 1ONHA 1W63M 2W3FA 4MBFA 2AVXA 1PWDA 2QJ7A 4XUXA 5GL9A 1A0KA 1NY0A 3ZYTA 4GHIA 4OPQA 1F5MA 2QKPA 2VGLM 2ZM0A 4R70A 2EX6A 3MBZA 1YLPA 4WZ4A 5EPHA 3VE4A 2GNXA 2ZC3B 4GCZA 4NEED 3NOUC 4RX3A 2B5RA 3T4QA 5G4ZA 4GW9A 5JYPA 5E2EA 2Q9NA 3CAXA 3CG5A 4Q0JA 3T1SA 1G28A 3HLFA 2FH5A 4HESA 2LB9A 1LHYA 4EESA 3EEHA 2Z2MB 2Y8HA 4EEUA 5J8XA 3MMHA 4IBXA 1P0ZA 2HP6A 5IU1A 2H0TA 1TS0A 1XA7A 4JLFA 4R1GA 5DJUA 4EUVA 4EBPA 1JWVA 4CQHA 5IT5A 2PHYA 4NXGA 3IH9A 5EVIA 3OBFA 4K91A 3PBTA 3ZFZA 4CLCA 4KQQA 3N6IA 4HH3A 1ZC2A 2V9AA 4JKTA 3N8SA 3LCEA 1XX2A 5M19A 1CEGA 1YSQA 4MLLA 1PNEA 3BRMA 5TJJA 4AFIA 2Z6CA 2QJ5A 1Y54A 3G34A 3VSKA 5CHMA 2EXBA 3VP4A 1FCOA 3M6HA 2W1TA 1NLYA 3G2YA 4IVKA 1OJ5A 4MNRA 5M18A 3IXGA 3LIFA 5GHXA 3UE6A 4Y0TA 3KYEA 2ZC4B 3PAEA 1YSPA 3TE8A 3IF5A 4C3QA 1LSXA 1YLWA 1D7EA 5EVIC 3IBRA 3LI8A 2HZ5A 4EW7A 2Z6DA 5U47A 4XXRA 4OP8A 1VB6A 1BLPA 3A3JA 3NDGA 3S7QA 3WS1A 1VHMA 2J7VA 4BL3A 3ISGA 3LFVA 4EUZA 5CGWA 1W63Q 1YLZA 3GSGA 1W79A 3G32A 1EW0A 3OPPA 2H0YA 3S7PA 1DP9A 3MXQA 1ODVA 4DE1A 1XJ3A 3MS6A 4OLDA 4FH4A 3G4PA 1F9IA 4KZBA 1FILA 3IXHA 4MBHA 4NXBA 1G68A 3JVUA 2XD5A 4JF5A 3DTKA 5EUAA 3ZG5A 4BBUA 3MZFA 3GR2A 1MWRA 5EFWA 1ES2A 1S6RA 4UHUA 4HJ3A 1PZPA 1T18A 4OKPA 1OT6A 2WKIA 3GQZA 3MQ0A 3SH9A 2C6WB 1KGFA 4EQ1A 1IFQA 4JBFA 4OPRA 1AXBA 5L07A 3OPRA 3QHYA 4GHIB 4ZAMA 3HLWA 1HD8A 2V1ZA 3RTYA 4Y3IA 2V2FF 3ZGAB 2WKRA 1G5UA 1K54A 5DTSA 3GTCA 4PMAA 1MC0A 2V1AA 1JTGA 2P04A 1KE4A 5CX7A 4LRYC 5EVID 3KX0X 2CC1A 3BYDA 4HI4A 4EBNA 1O07A 2PDRA 3K2NA 2Y2MA 3OC2A 4E6XA 4Y5FA 2PBYA 3M2KA 3FYZA 4ESPA 4KG5A 2RCXA 2HJEA 4UEYA 4QPRA 4YOFA 2EX9A 1GSXA 3KSFA 1IEMA 3PXPA 4G3WA 4KZ5A 1MZUA 1VEUA 3T1XA 3U2AA 1IOUA 3IX4A 1ONGA 5F1FA 3T4TA 2QMIA 1ES5A 5F69A 4D60A 3FPVA 1FOFA 2JKGA 2ZOIA 3C30A 1QMFA 4DXBA 1UGUA 3E0YA 1PWCA 1UWNX 3N8RA 3W8KA 4JXWA 3MR0A 5KMWA 3K3CA 1MBLA 3LYXA 1ZG4A 3UB8A 3TW8A 3JPUA 3VFHA 4OQHA 3LR4A 3Q7ZA 3BJNA 4G3KA 3UY6A 5L10A 3DTIA 4X53A 3UDFA 2WZXA 4M3KA 4ETXA 4C75A 5FI6A 4YINA 1BYWA 3L9KA 4UQIM 4DJ2A 4WZ5A 1YPRA 4O0PA 3ZG7B 3NOTC 5FATA 1E4DA 2OAQ1 1KVLA 4QY5A 3MKEA 1YAXA 1ERQA 5KSCA 2E8IA 1PIOA 3IS2A 3IF6C 4O01A 3A3EA 4S2MA 5AQAA 4CJNA 1IELA 1GSWA 3FZCA 1PW1A 1OTBA 2Z2LB 3L7HA 3LR0A 1Q2PA 2PU2A 1DP8A 3T50A 3U4LP 3O87A 3E98A 2ZOHA 1WYCA 3RH8B 4DRTA 2QYBA 1L3LA 5FQIA 1NRJA 1BT5A 3BY9A 2VZWA 4KUOA 2PU4A 3V5MA 5CTMA 5DVAA 1XP4A 3V3SA 2XA7M 2J9PA 2JKRM 2D01A 2MJ6A 5L8MA 1ACFA 4ZDXA 4NK3A 3GVBA 4R0QA 1YLYA 4ZJ2A 5M1AA 4BD0A 3DTMA 4EBLA 3C5AA 4PKYA 3A3IA 1H8ZA 4NXFA 3VOLA 2IWCA 1BUEA 1Z09A 2PR5A 4ZJ1A 3W4OA 5CGSA 3E4OA 4Z1WA 4LV2A 4Y2FA 2WGWB 1ESUA 3DWKA 4P6ZS 5FI2A 2CMNA 4PM5A 2JC7A 2WAFA 3HCYA 5HSQA 2K7SA 1SKOB 1FSWA 4K08A 3IX3A 4QWOA 5F82A 4F3LB 5HFOA 4UA9A 1VEUB 4ME4A 3VP2A 5DF9A 4K0WA 1MPLA 2GX5A 3NULA 1FSYA 4N9LA 1W5DA 4E04A 2OLUA 3T1QB 1J3WA 3ZDJA 3DWZA 4EEPA 3TSGA 3O5YA 2L0WA 3WWXA 5AVFA 1TD5A 3HLBA 5AQ9A 5DJTA 1UWPX 4WLAA 5DFYA 4DKIA 1ES3A 4X69A 4R6LA 4DDYA 4UQIS 2ZD8A 4E3OA 3UE3A 3GV9A 4ZBEA 4DE3A 5FEFA 2Y2HA 5A93A 4PHTA 2Q9MA 5DKKA 4GJ4A 5I5LA 5EOEA 3VV4A 5FAOA 3IT9A 3N8LA 2JN7A 5HZHA 4KZ8A 1DRMA 3C4OA 1JVJA 3H9WA 4Q0HA 3JYIA 5E2HA 1JNUA 1DY6A 3T4SA 3NY4A 5DF7A 2G2WA 1GHIA 2A2LA 1S0WA 1S1ZA 4HHDA 3T4JA 1RP5A 5CGXA 2WK0A 1W7FA 4R3AA 4F94A 3HVFA 3AGEA 3RXWA 1K57A 3IWQA 3HL9A 1KDSA 4KUKA 3HJIA 3VP1A 3NECA 4S2NC 4Y0UA 2Y79A 2ZQ8A 3MQQA 4JF6A 1OTEA 2BASA 3NHQA 5E2GA 3QNBA 3SS4A 1NLZA 3BFFA 3LI9A 2G7UA 2KOIA 1X0OA 1PZOA 3IWOA 5KIZA 3ITBA 2Y2GA 2VK3A 4MEZA 4JXVA 4OH0A 3FC7A 2W3GA 3OPLA 3MZDA 4BMWA 3IBJA 3E2LA 2VKSA 4MBKA 3RXXA 2A24B 1VETA 5DTKA 1PRQA 4ARZA 1CI9A 3PBNA 3WS4A 2JE5A 5F83A 1K56D 4FCFA 4H6JA 1XJ6A 4BQMA 3LUQA 3OPHA 3KYQA 4O8GA 1L2SA 1BSGA 5IHVA 4K0XA 3QP8A 1T1CA 3QP4A 4GNUA 4DJ3A 2HDUA 4FTXA 4YFMA 3PBOA 1K55A 4UA6A 1OPXA 1KOUA 1S4RA 2PR6A 4S2OA 2BLSA 2ZL1A 1SKOA 3EQUA 2ZC5B 1XKZA 5EE8A 3FV7A 3BQ8A 2XK1A 3ZG9B 2DNSA 3UB6A 2D02A 1HTZA 1M40A 3EOIA 4R38A 4LRZE 4HH2A 1V9YA 4MN7A 3NJAA 1K4FA 2Y2QA 3GDIA 3A0RA 4KQOA 3F1NA 3C7VA 1NWZA 2QPNA 1XGIA 4L9GA 2V20A 2W1TB 3HUMA 4L9FA 3LR5A 1W8QA 3T4KA 4WMCA 4BWIA 1IKGA 3MJQA 4WEJA 1RGZA 2ZM8A 4I3IA 4S2JA 5GHZA 3IQAA 4LV0A 3UDXA 4KQRA 3SW1A 3OZHA 1NRFA 2JCHA 3LEQA 4QHCA 3LO7A 4ZRRA 3KSIA 3HBRA 1K0KA 2PT7A 3ZQ5A 4MMNA 1TDLA 1TEMA 3PTEA 2K2NA 3ULFA 3TRCA 3P01A 4WEKA 2OOLA 5FI7A 4DN0A 2OWHA 4IUHA 3UB5P 1KGEA 5AJGA 4P6BA 3H82B 3QP2A 4GD8A 1BTLA 2JKFA 3PBSA 4OQ0A 3MZEA 3UE1A 3BLSA 4GKUA 4S2NA 3G31A 1JTDA 1CEFA 1HZOA 5EVEA 3IX8A 5TGFA 3VOZA 4OQGA 5FQKA 3UB9A 3FKVA 1S66L 5AQBA 1YM1A 4I5SA 5C5KA 2O99A 1I5QA 3Q07A 2Y2IA 4U3TA 3F1PA 4IEDA 2IA2A 4FOFA 5CERA 1K4EA 5TBMA 4S2IA 3ZCZA 1KGGA 1W8YA 5CEBA 2W1RA 4KZ4A 2ZQCA 3P7NA 4OOYA 2EFUA 1LL8A 1YQSA 3Q81A 1IYOA 5L2FA 1TF1A 4BBVA 1KVMA 3VSLA 3WS0A 1MWUA 1VETB 4GS9A 1P9RA 4DE0A 1GCEA 2NUPC 1YMSA 2HDRA 1VM1A 4QU3A 1XGJA 5GLCA 4HJ4A 1D06A 4BJPA 1SDNA 1XFQA 2G2UA 3V3RA 5L09A 4HEFA 4L0LA 3HJKA 2P08A 1XA1A 4OVDA 2HGVA 3N7WA 2XFSA 5CRFA 5DTTA 2VA0A 3A3FA 3K3DA 2HP9A 3FPWA 4GD6A 2VGLS 3I7JA 3VP3A 2VGJA 2XRNA 1L0DA 3DTEA 4S2LA 4ETZA 3H7WB 1LLBA 4LPZA 2WGIA 2IWBA 1PWGA 2OAP1 4LRXC 4QD4A 4M4XA 3ICYA 3Q1FA 3LIAA 3S22A 3UMDA 3WS5A 3MKFA 3V67A 4E3LA 3OLOA 4CPKA 2PRFA 4E3IA 3T1RA 3CWFA 3MSHA 2V8FA 1S67L 2K31A 3QP6A 4JXGA 3DW0A 4WYYA 3ZVTA 3UDIA 4X68A 4D2OA 2KLIA 2EX2A 2P9VA 5HAQA 2KX6A 1FR6A 1CJFA 3SOIA 5FASA 4Q8IA 3LY4A 1F2KA 5HW3A 2WKEA 1NZUA 4KG6A 4QY6A 5HPIA 1JWPA 5A92A 1EWZA 4LGWA 2XLNA 3OCNA 3MXRA 4O7DA 1BZAA 2A24A 3HLEA 2Y2KA 5CTNA 4MCWA 5GLBA 4DMZA 3BWLA 2W3DA 4H6JB 1K6RA 5G18A 1T1AA 3VP0A 4E3KA 5HAIA 2R78A 1STZA 4PM8A 5FA7A 4KZ7A 2OSUA 5F68A 1N9BA 4IBRA 3MF0A 3B42A 1NXYA 4R3BA 2ZM2A 1DP6A 3LR3A 3QP5A 3WRZA 2HF6A 2X71A 2QZ6A 1CF0A 1H8YA 5G4YA 3LIBA 2YKHA 3CHWP 2M1CA 1FR1A 4BD1A 3IXBA 5FQQA 3H7WA 3C8CA 2ZQDA 3MQOA 2XFTA 2EX8A 3IF6B 4E3MA 3S1YA 3CI6A 1F98A 3O86A 4KENB 4PPRA 4G3VA 5D3OA 2P7JA 2VGKA 2PD8A 2O9CA 4PM9A 3F1NB 1GHPA 2HDQA 3HLDA 4L9EA 3VOYA 5HD3A 1DJBA 3BW6A 3P09A 1C3BA 3A3DA 2PD7A 4FH2A 1MXOA 1XJ4A 2QWSA 4LCMA 4FD8A 2VJWA 3EEAA 2IWDA 4C6YA 4N9KA 4DF6A 3MFXA 2ZMAA 3OCLA 4WL9A 4HNBA 4CLCC 5J3WA 2H28A 4DE2A 2EXAA 4NKPA 4OPYA 2L1MA 4HJ6A 3GECA 4IHQA 5I94A 5F6AA 1K6SA 3UNWA 1FQGA 4PM6A 4GB7A 4X25A 3V50A 3KO6A 3NBLA 1P97A 5CHUA 1IYPA 5E43A 3TOIA 2XQZA 4FSFA 3IS2B 3EGXC 1PI4A 5F1GA 3WRTA 4YNRA 3HREA 4GOGA 3D3OA 1XFNA 3LGOA 4GS9B 1LSVA 3T4OA 1TS7A 4UA7A 2WGWA 4B88A 1MY8A 3T4LA 1P9WA 2VV7A 4WELA 4A5RA 3HLCA 1N4OA 1U60A 2W0NA 3Q7VA 1VQQA 5FSRA 5J7EA 3BFGA 3HUOA 1DJAA 2EFXA 2P9VB 1ALQA 1TS8A 5HDCA 1WYBA 1D1JA 1NYYA 3UB7A 4JGPA 5EV0A 4Y13A 3W4PA 1QMEA 4I3JA 5FL3A 3NC8A 4HOIA 2Q0OA 4PKYG 2X01A 3SH8A 3W2ZA 4RA7A 1Y4OA 1MKMA 3E4PA 5DF8A 3FG8A 5FQMA 2UWXA 4NXEA 1GA9A 1EROA 2XDMA 3CUEC 4CLCD 1OT9A 4XT2A 4X56A 3CMZA 4P87A 2ZL1B 5FEGA 3C7UA 4JGQA 4JXSA 4X1LA 3N4IA 2X02A 3DBAA 5EECA 2W27A 1ES4A 1E3UD 2J3TC 3G35A 1CK3A 4HBUA 3NI9A 2B02A 2EWVA 3D72A 4IJGA 4WM9A 4RX2A 1IYQA 4EXOA 4OOLA 1I2SA 2YKFA 4U0XA 3BECA 1OTAA 4I3AA 2Y2NA 5KZHA 4Q0IA 4E6WA 4B4ZA 1M6KA 5EVLA 1HLUP 2VX8A 3A0SA 2UV0E 4E3NA 2WGVA 4I39A 3KSHA 2ZLYA 5DFXA 4ARZB 2HP5A 2I9VA 4LV3A 5TFQA 5EVIB 4LFUA 2OWJA 4WUJA 4BBTA 1YMXA 4DXCA 4R4SA 3TJZC 3NDEA 2J80A 4QB8A 3UO9A 5BOHA 2Y91A 3CLOA 3BFEA 3ZVWA 4PAUA 1L0FA 3Q7VB 1LI0A 5HDDA 3FWLA 4Y7PA 4S2PA 5JYOA 2GDNA 2J3WA 2ZQ7A 3ZHHA 4GDNA 1YLTA 4NETA 3EGDC 2ZQAA 2VV6A 5HWWA 3IHAA 1N9OA 2P74A 1IYSA 3C38A 4LLOB 3ZG0A 4KZ3A 4B93A 5HARA 3AGDA 1XXMA 3VMAA 2WKQA 5A8BA 1CI8A 5A90A 4EQIA 3R7WA 1OTDA 2J3TD 2Y55A 1ESIA 3LEZA 1NZOA 4II7A 4ID4A 2Y4AA 2Y2PA 5HWTA 3R7WB 3SS5A 4Y15A 3EWKA 2H5SA 3IWIA 3GRJA 3W4QA 2HV1A 1ZTUA 4OPZA 1SHVA 3Q82A 2EWWA 2FFFB 1OTIA 3UPOA 1JWZA 2V8CA 1LSWA 1L0EA 3S4XA 3LICA 1TVFA 5HL6A 4IUKA 2J8YA 3PR6A 1XPBA 1YT4A 1BLSA 2HJ9C 4WMCD 1PI5A 1DJCA 3CITA 3PBQA 4LCLA 1BULA 4P85A 1E3UA 2XR0A 4KG2A
chains in the Genus database with same CATH topology
4IBXA 4WYYA 2HP6A 3ZDJA 3ZVTA 3DWZA 3UDIA 3TSGA 2H0TA 1XA7A 3E2KA 4JLFA 4X68A 4D2OA 2EX2A 2P9VA 4R1GA 5HAQA 1WE4A 1FR6A 3WWXA 4EBPA 4EV4A 3SOIA 5FASA 4Q8IA 1PW8A 1JWVA 4JPMA 3LY4A 3HLBA 5AQ9A 2ZC7A 1GA0A 3IH9A 5GLDA 4DKIA 2J9OA 1ES3A 1GHMA 5EVIA 2WUQA 4X69A 5HW3A 4K91A 2WKEA 3PBTA 3ZFZA 4OLGA 1NZUA 1I2WA 4KG6A 4DDYA 4QY6A 4KQQA 1H5XA 1MWTA 3N6IA 2ZD8A 4E3OA 1JWPA 4IVIA 2A3UA 1ZC2A 3GV9A 3UE3A 5A92A 4ZBEA 1EWZA 3G30A 4DE3A 4JKTA 2XLNA 1MWSA 1NJ4A 3N8SA 3OCNA 4QJGA 3MXRA 3LCEA 4O7DA 2Y2HA 1KDWA 1XX2A 1BZAA 5A93A 5M19A 1CEGA 4MLLA 4S2KA 3HLEA 2Y2KA 2Q9MA 3BRMA 5CTNA 5AQ7A 3ZG8B 5EOOA 1Y54A 4U0TA 5GLBA 3G34A 5EOEA 3VSKA 5CHMA 3BEBA 5FAOA 3EQVA 2EXBA 1O7EA 3IT9A 3N8LA 3VP4A 1K6RA 1FCOA 3HUNA 5G18A 4KZ8A 3C4OA 3BFCA 3VP0A 5HAIA 1JVJA 4RYEA 3SS3A 3M6HA 4E3KA 3G2YA 4PM8A 5FA7A 4IVKA 4KZ7A 2OSUA 2Y2OA 3MFDA 1EI5A 4MNRA 4WBGA 5M18A 1N9BA 2Y2JA 4IBRA 3IXGA 3JYIA 1NXYA 5GHXA 4OOMA 5E2HA 4R3BA 4B4XA 1DY6A 2ZM2A 2XD1A 3NY4A 5DF7A 2G2WA 4Y0TA 1GHIA 1S0WA 2ZC4B 3PAEA 2WZZA 1KE3A 3WRZA 1SDEA 4DDSA 3CZDA 2X71A 2QZ6A 3IF5A 2DCFA 1RP5A 5CGXA 4C3QA 2WK0A 1H8YA 1W7FA 4F94A 1YLWA 5EVIC 3HVFA 3AGEA 3RXWA 1MKIA 3HLGA 1K57A 3IWQA 3HL9A 1FR1A 1KDSA 3IXBA 4BD1A 4N92A 5FQQA 5U47A 4XXRA 4OP8A 2ZQDA 3VP1A 2XFTA 1BLPA 2EX8A 3A3JA 4S2NC 3NDGA 4Y0UA 3WS1A 3IF6B 4E3MA 2ZQ8A 4JF6A 2J7VA 3S1YA 4BL3A 3V39A 3ISGA 3M6BA 4EUZA 3O86A 3QNBA 4KENB 5CGWA 4PPRA 5E2GA 3SS4A 3O3VA 1YLZA 5D3OA 3BFFA 3GSGA 1W79A 2VGKA 3G32A 3OPPA 2H0YA 4UAAA 4PM9A 1GHPA 2HDQA 3HLDA 5FAQA 3VOYA 4DE1A 5FQ9A 4ZTKA 1DJBA 3ITAA 1PZOA 3IWOA 4OLDA 2R9XA 3G4PA 3P09A 4FH4A 4WZ5C 1FCNA 4KZBA 1C3BA 3A3DA 3ITBA 3IXHA 2Y2GA 4FH2A 4MBHA 1MXOA 2XGNA 4MEZA 1G68A 4JXVA 4OH0A 2XD5A 4JF5A 3OPLA 2HDSA 3QNCA 3MZDA 5EUAA 3ZG5A 3E2LA 3MZFA 4LCMA 4MBKA 3GR2A 1MWRA 4FD8A 3RXXA 1ES2A 2IWDA 1S6RA 4C6YA 4UHUA 3UPNA 4JF4A 1PZPA 4OKPA 5DTKA 4KZ6A 4N9KA 4DF6A 1CI9A 4RVAA 3PBNA 3LY3A 2WKIA 2ZMAA 5E2FA 5KSHA 1NYMA 3GQZA 3WS4A 3OCLA 2JE5A 5F83A 3SH9A 2C6WB 1K56D 4FCFA 1KGFA 4LENA 2HPBA 4DE2A 2EXAA 4BQMA 2ZQ9A 3OPHA 4JBFA 4OPYA 4KZAA 4OPRA 1AXBA 3IXDA 3OPRA 1L2SA 5I94A 1K6SA 1BSGA 3VFFA 3QHYA 5IHVA 4K0XA 3UNWA 4ZAMA 4GNUA 1FQGA 5HL1A 3HLWA 4PM6A 2HDUA 5HAPA 2DRWA 3IHBA 1HD8A 4GB7A 2V1ZA 4R4RA 4YFMA 2V2FF 3ZGAB 5FQJA 3G2ZA 3V50A 3PBOA 1K55A 1K25A 4UA6A 3D4FA 1PYYA 2H10A 3NBLA 5CHUA 1IYPA 2XEPA 5E43A 2ZJ9A 3TOIA 1K54A 1HVBA 2BLSA 2XQZA 4FSFA 4OP5A 4S2OA 1PI4A 5DTSA 3GTCA 3EQUA 1KE0A 4PMAA 5F1GA 2ZC5B 3WRTA 2RL3A 1XKZA 3HREA 5EE8A 4GOGA 3FV7A 1JTGA 1KE4A 2XK1A 4PM7A 3ZG9B 2DNSA 5EVID 1HTZA 4UA7A 2WGWA 4B88A 4GN2A 1MY8A 2CC1A 3BYDA 1M40A 4EBNA 1O07A 4WELA 4A5RA 5GHYA 3HLCA 2Y2MA 1N4OA 1OMEA 1U60A 3PBRA 3BFDA 1K4FA 3OC2A 4E6XA 3Q7VA 1VQQA 2Y2QA 2PBYA 3M2KA 5FSRA 3FYZA 4KG5A 2RCXA 3BFGA 1DJAA 3HUOA 3IH8A 4KQOA 3C7VA 4ZJ3A 2FFYA 2EX9A 2QPNA 1G6AA 2EFXA 2P9VB 3MXSA 1IEMA 1BLCA 1XGIA 4XUZA 1ALQA 1WYBA 1NYYA 3M2JA 2V20A 4KZ5A 3AGFA 1K38A 4HBTA 3HUMA 3W4PA 1W8QA 1QMEA 3NC8A 4WMCA 1IKGA 2I72A 4WEJA 1RGZA 1ONGA 5F1FA 2X01A 3SH8A 2ZM8A 4GZBA 4S2JA 3UN7A 4RA7A 2QMIA 5GHZA 1ES5A 3IQAA 5DF8A 4LV0A 3UDXA 4KQRA 3OZHA 3ZNYA 5CXWA 1NRFA 1FOFA 5FQMA 2JCHA 2UWXA 4Y0OA 4QHCA 1YLJA 3LO7A 2XF3A 1QMFA 4N1HA 1GA9A 1EROA 2XDMA 4DXBA 4EWFA 3HBRA 1J9MA 5CHJA 2XH9A 4OQIA 1TDLA 1TEMA 2R9WA 3PTEA 1PWCA 4X56A 1RCJA 3CMZA 3N8RA 4H8RA 4P87A 3W8KA 4JXWA 3C4PA 4R3JA 4N1XA 5KMWA 3C7UA 4WEKA 5FI7A 3O88A 1MBLA 4JXSA 3WS2A 3N4IA 2X02A 1KGEA 5EECA 5CEDA 1ES4A 1E3UD 1ZG4A 4P6BA 3VFHA 1RGYA 3G35A 1CK3A 1K54C 4OQHA 4HBUA 3NI9A 3IF6A 5HX9A 4GD8A 4X55A 1BTLA 4LV1A 4P0MA 4RX2A 4WM9A 3UE0A 1IYQA 3Q7ZA 4OOLA 3UY6A 1I2SA 4U0XA 1IKIA 3BECA 3NCKA 3PBSA 4X53A 2Y2NA 3UDFA 5KZHA 2WZXA 4M3KA 4E6WA 4OQ0A 1K55C 5CECA 4C75A 3MZEA 3ZNTA 4X6TA 1Z6FA 4B4ZA 5FI6A 4YINA 3UE1A 3BLSA 1M6KA 4GKUA 4S2NA 5EVLA 2JBFA 3G31A 1JTDA 4R23A 1BLHA 1CEFA 1HZOA 4E3NA 2WGVA 4WZ5A 1LL9A 5TGFA 2ZLYA 1K56A 3VOZA 5A91A 3ZG7B 2ZC6B 2HP5A 4LV3A 3BLMA 5EVIB 5FATA 5TFQA 4OQGA 5FQKA 1E4DA 3FKVA 2WKHA 4GDBA 1KVLA 1ZG6A 5AQBA 4QY5A 3MKEA 1YMXA 1YM1A 4DXCA 2OLVA 3P98A 1Q2QA 1SCWA 2WYXA 3NIAA 1ERQA 1I5QA 4R4SA 5KSCA 2E8IA 1PIOA 3NDEA 3Q07A 2Y2IA 3IF6C 4U3TA 3UO9A 4QB8A 5BOHA 2Y91A 3A3EA 4IEDA 4S2MA 5AQAA 4CJNA 5TR7A 1IELA 3BFEA 4KZ9A 3CJMA 1PW1A 3FZCA 2WAEA 5CERA 1K4EA 2Z2LB 4S2IA 3ZVWA 3ZCZA 4BLMA 1KGGA 1Q2PA 2PU2A 5FAPA 1W8YA 5CEBA 4KZ4A 1L0FA 2ZQCA 3Q7VB 3O87A 2A49A 1LI0A 3UPPA 4OOYA 2EFUA 1WYCA 4DRTA 3FWLA 4Y7PA 4S2PA 5FQIA 5JYOA 3TG9A 1YQSA 3FKWA 3Q81A 1IYOA 5L2FA 2GDNA 1BT5A 2ZQ7A 1ZKJA 1KVMA 3VSLA 1E25A 3ZHHA 4GDNA 1YLTA 5GLAA 3WS0A 2PU4A 4NETA 2WADA 2Y59A 3B3XA 3V5MA 5CTMA 1TDGA 4E3JA 2ZQAA 1FCMA 1MWUA 1XP4A 5DVAA 3V3SA 4DE0A 1GCEA 4OONA 1YMSA 2HDRA 3IHAA 1VM1A 2P74A 1IYSA 4QU3A 2J9PA 1LL5A 5FDHA 3ZG0A 4KZ3A 1XGJA 3PAGA 5GLCA 3RJUA 5HARA 3AGDA 4BJPA 1K57C 1XXMA 1SDNA 2OV5A 2G2UA 4NK3A 3V3RA 4ZDXA 3VMAA 3GVBA 4R0QA 4HEFA 1SKFA 1YLYA 1CI8A 4L0LA 4ZJ2A 4EQIA 5A90A 5M1AA 1ERMA 4BD0A 1L0GA 1XA1A 4BENA 2C5WB 2Y55A 2BG1A 1ESIA 3DTMA 3LEZA 1LI9A 2Y2LA 4OVDA 4EBLA 1NZOA 3C5AA 3N7WA 3A3IA 1H8ZA 4BL2A 3BM6A 4ID4A 2Y4AA 3SH7A 2Y2PA 2XFSA 2IWCA 1BUEA 1ONHA 3GMWA 4MBFA 5CRFA 4Z9QA 5DTTA 3SS5A 1PWDA 3A3FA 2H5SA 2HP9A 3IWIA 4XUXA 4GD6A 3I7JA 5GL9A 3VP3A 1NY0A 2VGJA 4ZJ1A 3W4OA 5CGSA 3GRJA 3W4QA 4OPQA 4LV2A 1L0DA 2WGWB 1ESUA 3DWKA 4S2LA 4OPZA 1SHVA 3Q82A 2ZM0A 2FFFB 2EX6A 5FI2A 1LLBA 3MBZA 1YLPA 4WZ4A 5EPHA 4PM5A 3UPOA 1JWZA 2JC7A 2WAFA 2ZC3B 2WGIA 1PWGA 2IWBA 4QD4A 1L0EA 1FSWA 3Q1FA 3S4XA 3S22A 1TVFA 4RX3A 2B5RA 3WS5A 5F82A 3MKFA 5HFOA 2J8YA 4UA9A 1XPBA 4E3LA 3VP2A 5JYPA 1YT4A 5DF9A 4K0WA 5E2EA 2Q9NA 4CPKA 4E3IA 1MPLA 1BLSA 4WMCD 1PI5A 1DJCA 3CG5A 3HLFA 4HESA 3PBQA 4LCLA 1BULA 4P85A 1FSYA 4N9LA 1LHYA 1W5DA 1E3UA 2XR0A 4KG2A 4JXGA 2Z2MB 5J8XA 2OLUA 3DW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBX A;  4WYY A;  2HP6 A;  3ZDJ A;  3ZVT A;  3DWZ A;  3UDI A;  3TSG A;  2H0T A;  1XA7 A;  3E2K A;  4JLF A;  4X68 A;  4D2O A;  2EX2 A;  2P9V A;  4R1G A;  5HAQ A;  1WE4 A;  1FR6 A;  3WWX A;  4EBP A;  4EV4 A;  3SOI A;  5FAS A;  4Q8I A;  1PW8 A;  1JWV A;  4JPM A;  3LY4 A;  3HLB A;  5AQ9 A;  2ZC7 A;  1GA0 A;  3IH9 A;  5GLD A;  4DKI A;  2J9O A;  1ES3 A;  1GHM A;  5EVI A;  2WUQ A;  4X69 A;  5HW3 A;  4K91 A;  2WKE A;  3PBT A;  3ZFZ A;  4OLG A;  1NZU A;  1I2W A;  4KG6 A;  4DDY A;  4QY6 A;  4KQQ A;  1H5X A;  1MWT A;  3N6I A;  2ZD8 A;  4E3O A;  1JWP A;  4IVI A;  2A3U A;  1ZC2 A;  3GV9 A;  3UE3 A;  5A92 A;  4ZBE A;  1EWZ A;  3G30 A;  4DE3 A;  4JKT A;  2XLN A;  1MWS A;  1NJ4 A;  3N8S A;  3OCN A;  4QJG A;  3MXR A;  3LCE A;  4O7D A;  2Y2H A;  1KDW A;  1XX2 A;  1BZA A;  5A93 A;  5M19 A;  1CEG A;  4MLL A;  4S2K A;  3HLE A;  2Y2K A;  2Q9M A;  3BRM A;  5CTN A;  5AQ7 A;  3ZG8 B;  5EOO A;  1Y54 A;  4U0T A;  5GLB A;  3G34 A;  5EOE A;  3VSK A;  5CHM A;  3BEB A;  5FAO A;  3EQV A;  2EXB A;  1O7E A;  3IT9 A;  3N8L A;  3VP4 A;  1K6R A;  1FCO A;  3HUN A;  5G18 A;  4KZ8 A;  3C4O A;  3BFC A;  3VP0 A;  5HAI A;  1JVJ A;  4RYE A;  3SS3 A;  3M6H A;  4E3K A;  3G2Y A;  4PM8 A;  5FA7 A;  4IVK A;  4KZ7 A;  2OSU A;  2Y2O A;  3MFD A;  1EI5 A;  4MNR A;  4WBG A;  5M18 A;  1N9B A;  2Y2J A;  4IBR A;  3IXG A;  3JYI A;  1NXY A;  5GHX A;  4OOM A;  5E2H A;  4R3B A;  4B4X A;  1DY6 A;  2ZM2 A;  2XD1 A;  3NY4 A;  5DF7 A;  2G2W A;  4Y0T A;  1GHI A;  1S0W A;  2ZC4 B;  3PAE A;  2WZZ A;  1KE3 A;  3WRZ A;  1SDE A;  4DDS A;  3CZD A;  2X71 A;  2QZ6 A;  3IF5 A;  2DCF A;  1RP5 A;  5CGX A;  4C3Q A;  2WK0 A;  1H8Y A;  1W7F A;  4F94 A;  1YLW A;  5EVI C;  3HVF A;  3AGE A;  3RXW A;  1MKI A;  3HLG A;  1K57 A;  3IWQ A;  3HL9 A;  1FR1 A;  1KDS A;  3IXB A;  4BD1 A;  4N92 A;  5FQQ A;  5U47 A;  4XXR A;  4OP8 A;  2ZQD A;  3VP1 A;  2XFT A;  1BLP A;  2EX8 A;  3A3J A;  4S2N C;  3NDG A;  4Y0U A;  3WS1 A;  3IF6 B;  4E3M A;  2ZQ8 A;  4JF6 A;  2J7V A;  3S1Y A;  4BL3 A;  3V39 A;  3ISG A;  3M6B A;  4EUZ A;  3O86 A;  3QNB A;  4KEN B;  5CGW A;  4PPR A;  5E2G A;  3SS4 A;  3O3V A;  1YLZ A;  5D3O A;  3BFF A;  3GSG A;  1W79 A;  2VGK A;  3G32 A;  3OPP A;  2H0Y A;  4UAA A;  4PM9 A;  1GHP A;  2HDQ A;  3HLD A;  5FAQ A;  3VOY A;  4DE1 A;  5FQ9 A;  4ZTK A;  1DJB A;  3ITA A;  1PZO A;  3IWO A;  4OLD A;  2R9X A;  3G4P A;  3P09 A;  4FH4 A;  4WZ5 C;  1FCN A;  4KZB A;  1C3B A;  3A3D A;  3ITB A;  3IXH A;  2Y2G A;  4FH2 A;  4MBH A;  1MXO A;  2XGN A;  4MEZ A;  1G68 A;  4JXV A;  4OH0 A;  2XD5 A;  4JF5 A;  3OPL A;  2HDS A;  3QNC A;  3MZD A;  5EUA A;  3ZG5 A;  3E2L A;  3MZF A;  4LCM A;  4MBK A;  3GR2 A;  1MWR A;  4FD8 A;  3RXX A;  1ES2 A;  2IWD A;  1S6R A;  4C6Y A;  4UHU A;  3UPN A;  4JF4 A;  1PZP A;  4OKP A;  5DTK A;  4KZ6 A;  4N9K A;  4DF6 A;  1CI9 A;  4RVA A;  3PBN A;  3LY3 A;  2WKI A;  2ZMA A;  5E2F A;  5KSH A;  1NYM A;  3GQZ A;  3WS4 A;  3OCL A;  2JE5 A;  5F83 A;  3SH9 A;  2C6W B;  1K56 D;  4FCF A;  1KGF A;  4LEN A;  2HPB A;  4DE2 A;  2EXA A;  4BQM A;  2ZQ9 A;  3OPH A;  4JBF A;  4OPY A;  4KZA A;  4OPR A;  1AXB A;  3IXD A;  3OPR A;  1L2S A;  5I94 A;  1K6S A;  1BSG A;  3VFF A;  3QHY A;  5IHV A;  4K0X A;  3UNW A;  4ZAM A;  4GNU A;  1FQG A;  5HL1 A;  3HLW A;  4PM6 A;  2HDU A;  5HAP A;  2DRW A;  3IHB A;  1HD8 A;  4GB7 A;  2V1Z A;  4R4R A;  4YFM A;  2V2F F;  3ZGA B;  5FQJ A;  3G2Z A;  3V50 A;  3PBO A;  1K55 A;  1K25 A;  4UA6 A;  3D4F A;  1PYY A;  2H10 A;  3NBL A;  5CHU A;  1IYP A;  2XEP A;  5E43 A;  2ZJ9 A;  3TOI A;  1K54 A;  1HVB A;  2BLS A;  2XQZ A;  4FSF A;  4OP5 A;  4S2O A;  1PI4 A;  5DTS A;  3GTC A;  3EQU A;  1KE0 A;  4PMA A;  5F1G A;  2ZC5 B;  3WRT A;  2RL3 A;  1XKZ A;  3HRE A;  5EE8 A;  4GOG A;  3FV7 A;  1JTG A;  1KE4 A;  2XK1 A;  4PM7 A;  3ZG9 B;  2DNS A;  5EVI D;  1HTZ A;  4UA7 A;  2WGW A;  4B88 A;  4GN2 A;  1MY8 A;  2CC1 A;  3BYD A;  1M40 A;  4EBN A;  1O07 A;  4WEL A;  4A5R A;  5GHY A;  3HLC A;  2Y2M A;  1N4O A;  1OME A;  1U60 A;  3PBR A;  3BFD A;  1K4F A;  3OC2 A;  4E6X A;  3Q7V A;  1VQQ A;  2Y2Q A;  2PBY A;  3M2K A;  5FSR A;  3FYZ A;  4KG5 A;  2RCX A;  3BFG A;  1DJA A;  3HUO A;  3IH8 A;  4KQO A;  3C7V A;  4ZJ3 A;  2FFY A;  2EX9 A;  2QPN A;  1G6A A;  2EFX A;  2P9V B;  3MXS A;  1IEM A;  1BLC A;  1XGI A;  4XUZ A;  1ALQ A;  1WYB A;  1NYY A;  3M2J A;  2V20 A;  4KZ5 A;  3AGF A;  1K38 A;  4HBT A;  3HUM A;  3W4P A;  1W8Q A;  1QME A;  3NC8 A;  4WMC A;  1IKG A;  2I72 A;  4WEJ A;  1RGZ A;  1ONG A;  5F1F A;  2X01 A;  3SH8 A;  2ZM8 A;  4GZB A;  4S2J A;  3UN7 A;  4RA7 A;  2QMI A;  5GHZ A;  1ES5 A;  3IQA A;  5DF8 A;  4LV0 A;  3UDX A;  4KQR A;  3OZH A;  3ZNY A;  5CXW A;  1NRF A;  1FOF A;  5FQM A;  2JCH A;  2UWX A;  4Y0O A;  4QHC A;  1YLJ A;  3LO7 A;  2XF3 A;  1QMF A;  4N1H A;  1GA9 A;  1ERO A;  2XDM A;  4DXB A;  4EWF A;  3HBR A;  1J9M A;  5CHJ A;  2XH9 A;  4OQI A;  1TDL A;  1TEM A;  2R9W A;  3PTE A;  1PWC A;  4X56 A;  1RCJ A;  3CMZ A;  3N8R A;  4H8R A;  4P87 A;  3W8K A;  4JXW A;  3C4P A;  4R3J A;  4N1X A;  5KMW A;  3C7U A;  4WEK A;  5FI7 A;  3O88 A;  1MBL A;  4JXS A;  3WS2 A;  3N4I A;  2X02 A;  1KGE A;  5EEC A;  5CED A;  1ES4 A;  1E3U D;  1ZG4 A;  4P6B A;  3VFH A;  1RGY A;  3G35 A;  1CK3 A;  1K54 C;  4OQH A;  4HBU A;  3NI9 A;  3IF6 A;  5HX9 A;  4GD8 A;  4X55 A;  1BTL A;  4LV1 A;  4P0M A;  4RX2 A;  4WM9 A;  3UE0 A;  1IYQ A;  3Q7Z A;  4OOL A;  3UY6 A;  1I2S A;  4U0X A;  1IKI A;  3BEC A;  3NCK A;  3PBS A;  4X53 A;  2Y2N A;  3UDF A;  5KZH A;  2WZX A;  4M3K A;  4E6W A;  4OQ0 A;  1K55 C;  5CEC A;  4C75 A;  3MZE A;  3ZNT A;  4X6T A;  1Z6F A;  4B4Z A;  5FI6 A;  4YIN A;  3UE1 A;  3BLS A;  1M6K A;  4GKU A;  4S2N A;  5EVL A;  2JBF A;  3G31 A;  1JTD A;  4R23 A;  1BLH A;  1CEF A;  1HZO A;  4E3N A;  2WGV A;  4WZ5 A;  1LL9 A;  5TGF A;  2ZLY A;  1K56 A;  3VOZ A;  5A91 A;  3ZG7 B;  2ZC6 B;  2HP5 A;  4LV3 A;  3BLM A;  5EVI B;  5FAT A;  5TFQ A;  4OQG A;  5FQK A;  1E4D A;  3FKV A;  2WKH A;  4GDB A;  1KVL A;  1ZG6 A;  5AQB A;  4QY5 A;  3MKE A;  1YMX A;  1YM1 A;  4DXC A;  2OLV A;  3P98 A;  1Q2Q A;  1SCW A;  2WYX A;  3NIA A;  1ERQ A;  1I5Q A;  4R4S A;  5KSC A;  2E8I A;  1PIO A;  3NDE A;  3Q07 A;  2Y2I A;  3IF6 C;  4U3T A;  3UO9 A;  4QB8 A;  5BOH A;  2Y91 A;  3A3E A;  4IED A;  4S2M A;  5AQA A;  4CJN A;  5TR7 A;  1IEL A;  3BFE A;  4KZ9 A;  3CJM A;  1PW1 A;  3FZC A;  2WAE A;  5CER A;  1K4E A;  2Z2L B;  4S2I A;  3ZVW A;  3ZCZ A;  4BLM A;  1KGG A;  1Q2P A;  2PU2 A;  5FAP A;  1W8Y A;  5CEB A;  4KZ4 A;  1L0F A;  2ZQC A;  3Q7V B;  3O87 A;  2A49 A;  1LI0 A;  3UPP A;  4OOY A;  2EFU A;  1WYC A;  4DRT A;  3FWL A;  4Y7P A;  4S2P A;  5FQI A;  5JYO A;  3TG9 A;  1YQS A;  3FKW A;  3Q81 A;  1IYO A;  5L2F A;  2GDN A;  1BT5 A;  2ZQ7 A;  1ZKJ A;  1KVM A;  3VSL A;  1E25 A;  3ZHH A;  4GDN A;  1YLT A;  5GLA A;  3WS0 A;  2PU4 A;  4NET A;  2WAD A;  2Y59 A;  3B3X A;  3V5M A;  5CTM A;  1TDG A;  4E3J A;  2ZQA A;  1FCM A;  1MWU A;  1XP4 A;  5DVA A;  3V3S A;  4DE0 A;  1GCE A;  4OON A;  1YMS A;  2HDR A;  3IHA A;  1VM1 A;  2P74 A;  1IYS A;  4QU3 A;  2J9P A;  1LL5 A;  5FDH A;  3ZG0 A;  4KZ3 A;  1XGJ A;  3PAG A;  5GLC A;  3RJU A;  5HAR A;  3AGD A;  4BJP A;  1K57 C;  1XXM A;  1SDN A;  2OV5 A;  2G2U A;  4NK3 A;  3V3R A;  4ZDX A;  3VMA A;  3GVB A;  4R0Q A;  4HEF A;  1SKF A;  1YLY A;  1CI8 A;  4L0L A;  4ZJ2 A;  4EQI A;  5A90 A;  5M1A A;  1ERM A;  4BD0 A;  1L0G A;  1XA1 A;  4BEN A;  2C5W B;  2Y55 A;  2BG1 A;  1ESI A;  3DTM A;  3LEZ A;  1LI9 A;  2Y2L A;  4OVD A;  4EBL A;  1NZO A;  3C5A A;  3N7W A;  3A3I A;  1H8Z A;  4BL2 A;  3BM6 A;  4ID4 A;  2Y4A A;  3SH7 A;  2Y2P A;  2XFS A;  2IWC A;  1BUE A;  1ONH A;  3GMW A;  4MBF A;  5CRF A;  4Z9Q A;  5DTT A;  3SS5 A;  1PWD A;  3A3F A;  2H5S A;  2HP9 A;  3IWI A;  4XUX A;  4GD6 A;  3I7J A;  5GL9 A;  3VP3 A;  1NY0 A;  2VGJ A;  4ZJ1 A;  3W4O A;  5CGS A;  3GRJ A;  3W4Q A;  4OPQ A;  4LV2 A;  1L0D A;  2WGW B;  1ESU A;  3DWK A;  4S2L A;  4OPZ A;  1SHV A;  3Q82 A;  2ZM0 A;  2FFF B;  2EX6 A;  5FI2 A;  1LLB A;  3MBZ A;  1YLP A;  4WZ4 A;  5EPH A;  4PM5 A;  3UPO A;  1JWZ A;  2JC7 A;  2WAF A;  2ZC3 B;  2WGI A;  1PWG A;  2IWB A;  4QD4 A;  1L0E A;  1FSW A;  3Q1F A;  3S4X A;  3S22 A;  1TVF A;  4RX3 A;  2B5R A;  3WS5 A;  5F82 A;  3MKF A;  5HFO A;  2J8Y A;  4UA9 A;  1XPB A;  4E3L A;  3VP2 A;  5JYP A;  1YT4 A;  5DF9 A;  4K0W A;  5E2E A;  2Q9N A;  4CPK A;  4E3I A;  1MPL A;  1BLS A;  4WMC D;  1PI5 A;  1DJC A;  3CG5 A;  3HLF A;  4HES A;  3PBQ A;  4LCL A;  1BUL A;  4P85 A;  1FSY A;  4N9L A;  1LHY A;  1W5D A;  1E3U A;  2XR0 A;  4KG2 A;  4JXG A;  2Z2M B;  5J8X A;  2OLU A;  3DW0 A; 
#chains in the Genus database with same CATH topology
 2VV8 A;  3NOP C;  2O9A A;  1GSV A;  3E2K A;  4KQD A;  4EET B;  1WE4 A;  5MC7 A;  4HQA A;  4EV4 A;  3H82 A;  1PW8 A;  3A0V A;  4HP9 A;  3B47 A;  4JPM A;  4WN5 A;  2ZC7 A;  1YKD A;  4XT2 B;  3SZT A;  1GA0 A;  5GLD A;  2J9O A;  1GHM A;  2WUQ A;  2O0Y A;  4OLG A;  1I2W A;  2XRO A;  1H5X A;  1MWT A;  4IVI A;  2A3U A;  1G6O A;  3G30 A;  1MWS A;  1NJ4 A;  2KDK A;  4QJG A;  1KDW A;  4S2K A;  3S7O A;  5AQ7 A;  3ZG8 B;  5EOO A;  4U0T A;  1TS6 A;  3BQA A;  3BEB A;  3RFB A;  3EQV A;  1O7E A;  2W3H A;  5AVE A;  5K5B A;  1T19 A;  3HUN A;  3BFC A;  3F1P B;  4RYE A;  3SS3 A;  1S1Y A;  2Y2O A;  3MFD A;  5IS1 A;  1EI5 A;  4WBG A;  2Y2J A;  2XSS A;  2E8J A;  3OOV A;  4OOM A;  5HWV A;  4EU0 A;  4B4X A;  2XD1 A;  2L4R A;  2WZZ A;  1KE3 A;  4YWZ A;  1SDE A;  2DMW A;  3CZD A;  4DDS A;  2DCF A;  1V9Z A;  1MKI A;  3HLG A;  3F1O B;  2GJ3 A;  4N92 A;  3QP1 A;  3R4K A;  3LIE A;  5EM1 A;  2PYP A;  1Y28 A;  3UME A;  3V39 A;  3M6B A;  3O3V A;  4MN5 A;  4UAA A;  2V1B A;  5FAQ A;  2ZMF A;  5FQ9 A;  5TBM B;  4ZTK A;  3ITA A;  2R9X A;  4WZ5 C;  1FCN A;  1N9N A;  1N9L A;  2ZMV A;  4CLC B;  2XGN A;  3JVV A;  2HDS A;  3QNC A;  3CUE A;  3UPN A;  4JF4 A;  4KZ6 A;  4MDZ A;  4RVA A;  3LY3 A;  5E2F A;  5KSH A;  3KYZ A;  1NYM A;  4LEN A;  1OJG A;  2HPB A;  4JGO A;  1H0M A;  2VLG A;  2ZQ9 A;  4KZA A;  3IXD A;  4WF0 A;  3PYP A;  3VFF A;  5HL1 A;  5HAP A;  2DRW A;  3IHB A;  4R4R A;  5FQJ A;  3G2Z A;  4I38 A;  5HD5 A;  1K25 A;  4HY8 A;  3D4F A;  1PYY A;  2H10 A;  2PAV P;  2XEP A;  3CPT A;  2ZJ9 A;  1HVB A;  4OP5 A;  1KE0 A;  2JKT M;  5FDS A;  2RL3 A;  2V0U A;  2PYR A;  2M7U A;  4PM7 A;  4GN2 A;  3LID A;  5GHY A;  2ZBB A;  2ACG A;  1H3Q A;  1OME A;  5LBR A;  3PBR A;  3BFD A;  4CLC E;  4ZJ3 A;  3IH8 A;  2NUT C;  1PFL A;  5EM0 A;  2FFY A;  1G6A A;  3MXS A;  1BLC A;  4XUZ A;  2FZ0 A;  3M2J A;  3AGF A;  1K38 A;  4HBT A;  2W3E A;  2M7V A;  3B33 A;  2I72 A;  2B95 A;  4GZB A;  4Y17 A;  5HDS A;  2INW A;  3DAV A;  3UN7 A;  2JHE A;  2JKR I;  3G6O A;  2BTF P;  4F3L A;  3ZNY A;  3E4Q A;  2WKP A;  5CXW A;  4RQ9 A;  4Y0O A;  1YLJ A;  2XF3 A;  4N1H A;  4EWF A;  4B9O A;  3PHY A;  1J9M A;  5CHJ A;  2XH9 A;  3BY8 A;  4OQI A;  2R9W A;  5DKL A;  1RCJ A;  4H8R A;  3C4P A;  4R3J A;  4N1X A;  5HPF A;  3O88 A;  2QHK A;  4EER A;  3WS2 A;  2PBD P;  5CED A;  1RGY A;  1K54 C;  5HX9 A;  3IF6 A;  4X55 A;  1S4S A;  4LV1 A;  4P0M A;  3UE0 A;  4NG2 A;  1IKI A;  3NCK A;  2B18 A;  3F1O A;  1K55 C;  5CEC A;  3ZNT A;  4X6T A;  1Z6F A;  1FIK A;  2JBF A;  2V0W A;  4R23 A;  1BLH A;  1LL9 A;  1K56 A;  5A91 A;  2ZC6 B;  3C2W A;  2O9B A;  3BLM A;  4P6Z M;  3VE3 A;  2JKT I;  2WKH A;  1H8M A;  4GDB A;  1ZG6 A;  2GZA A;  2OLV A;  3P98 A;  1Q2Q A;  1SCW A;  2WYX A;  3NIA A;  2XA7 S;  1AWI A;  1SZV A;  5TR7 A;  3S7N A;  3KSG A;  4KZ9 A;  4MN6 A;  3CJM A;  4JGR A;  2WAE A;  4BLM A;  1XJ2 A;  5FAP A;  3T12 B;  2A49 A;  4FUW A;  3UPP A;  2VEA A;  4GLQ A;  5F5Y A;  3TG9 A;  3FKW A;  2LB5 A;  1ZKJ A;  1E25 A;  5GLA A;  2WAD A;  4HP4 A;  2Y59 A;  3B3X A;  1TDG A;  2EA9 A;  4E3J A;  1FCM A;  1T1B A;  4OON A;  1LT0 A;  4HIA A;  1LL5 A;  5FDH A;  3PAG A;  3RJU A;  1K57 C;  2OV5 A;  4X1M A;  3CPT B;  1ZHH B;  1SKF A;  1ERM A;  1L0G A;  4BEN A;  5J4E A;  2C5W B;  3D9Y A;  2BG1 A;  1LI9 A;  2Y2L A;  1WA9 A;  4BL2 A;  1CQA A;  3BM6 A;  3SH7 A;  3GMW A;  4Z9Q A;  1ONH A;  1W63 M;  2W3F A;  4MBF A;  2AVX A;  1PWD A;  2QJ7 A;  4XUX A;  5GL9 A;  1A0K A;  1NY0 A;  3ZYT A;  4GHI A;  4OPQ A;  1F5M A;  2QKP A;  2VGL M;  2ZM0 A;  4R70 A;  2EX6 A;  3MBZ A;  1YLP A;  4WZ4 A;  5EPH A;  3VE4 A;  2GNX A;  2ZC3 B;  4GCZ A;  4NEE D;  3NOU C;  4RX3 A;  2B5R A;  3T4Q A;  5G4Z A;  4GW9 A;  5JYP A;  5E2E A;  2Q9N A;  3CAX A;  3CG5 A;  4Q0J A;  3T1S A;  1G28 A;  3HLF A;  2FH5 A;  4HES A;  2LB9 A;  1LHY A;  4EES A;  3EEH A;  2Z2M B;  2Y8H A;  4EEU A;  5J8X A;  3MMH A;  4IBX A;  1P0Z A;  2HP6 A;  5IU1 A;  2H0T A;  1TS0 A;  1XA7 A;  4JLF A;  4R1G A;  5DJU A;  4EUV A;  4EBP A;  1JWV A;  4CQH A;  5IT5 A;  2PHY A;  4NXG A;  3IH9 A;  5EVI A;  3OBF A;  4K91 A;  3PBT A;  3ZFZ A;  4CLC A;  4KQQ A;  3N6I A;  4HH3 A;  1ZC2 A;  2V9A A;  4JKT A;  3N8S A;  3LCE A;  1XX2 A;  5M19 A;  1CEG A;  1YSQ A;  4MLL A;  1PNE A;  3BRM A;  5TJJ A;  4AFI A;  2Z6C A;  2QJ5 A;  1Y54 A;  3G34 A;  3VSK A;  5CHM A;  2EXB A;  3VP4 A;  1FCO A;  3M6H A;  2W1T A;  1NLY A;  3G2Y A;  4IVK A;  1OJ5 A;  4MNR A;  5M18 A;  3IXG A;  3LIF A;  5GHX A;  3UE6 A;  4Y0T A;  3KYE A;  2ZC4 B;  3PAE A;  1YSP A;  3TE8 A;  3IF5 A;  4C3Q A;  1LSX A;  1YLW A;  1D7E A;  5EVI C;  3IBR A;  3LI8 A;  2HZ5 A;  4EW7 A;  2Z6D A;  5U47 A;  4XXR A;  4OP8 A;  1VB6 A;  1BLP A;  3A3J A;  3NDG A;  3S7Q A;  3WS1 A;  1VHM A;  2J7V A;  4BL3 A;  3ISG A;  3LFV A;  4EUZ A;  5CGW A;  1W63 Q;  1YLZ A;  3GSG A;  1W79 A;  3G32 A;  1EW0 A;  3OPP A;  2H0Y A;  3S7P A;  1DP9 A;  3MXQ A;  1ODV A;  4DE1 A;  1XJ3 A;  3MS6 A;  4OLD A;  4FH4 A;  3G4P A;  1F9I A;  4KZB A;  1FIL A;  3IXH A;  4MBH A;  4NXB A;  1G68 A;  3JVU A;  2XD5 A;  4JF5 A;  3DTK A;  5EUA A;  3ZG5 A;  4BBU A;  3MZF A;  3GR2 A;  1MWR A;  5EFW A;  1ES2 A;  1S6R A;  4UHU A;  4HJ3 A;  1PZP A;  1T18 A;  4OKP A;  1OT6 A;  2WKI A;  3GQZ A;  3MQ0 A;  3SH9 A;  2C6W B;  1KGF A;  4EQ1 A;  1IFQ A;  4JBF A;  4OPR A;  1AXB A;  5L07 A;  3OPR A;  3QHY A;  4GHI B;  4ZAM A;  3HLW A;  1HD8 A;  2V1Z A;  3RTY A;  4Y3I A;  2V2F F;  3ZGA B;  2WKR A;  1G5U A;  1K54 A;  5DTS A;  3GTC A;  4PMA A;  1MC0 A;  2V1A A;  1JTG A;  2P04 A;  1KE4 A;  5CX7 A;  4LRY C;  5EVI D;  3KX0 X;  2CC1 A;  3BYD A;  4HI4 A;  4EBN A;  1O07 A;  2PDR A;  3K2N A;  2Y2M A;  3OC2 A;  4E6X A;  4Y5F A;  2PBY A;  3M2K A;  3FYZ A;  4ESP A;  4KG5 A;  2RCX A;  2HJE A;  4UEY A;  4QPR A;  4YOF A;  2EX9 A;  1GSX A;  3KSF A;  1IEM A;  3PXP A;  4G3W A;  4KZ5 A;  1MZU A;  1VEU A;  3T1X A;  3U2A A;  1IOU A;  3IX4 A;  1ONG A;  5F1F A;  3T4T A;  2QMI A;  1ES5 A;  5F69 A;  4D60 A;  3FPV A;  1FOF A;  2JKG A;  2ZOI A;  3C30 A;  1QMF A;  4DXB A;  1UGU A;  3E0Y A;  1PWC A;  1UWN X;  3N8R A;  3W8K A;  4JXW A;  3MR0 A;  5KMW A;  3K3C A;  1MBL A;  3LYX A;  1ZG4 A;  3UB8 A;  3TW8 A;  3JPU A;  3VFH A;  4OQH A;  3LR4 A;  3Q7Z A;  3BJN A;  4G3K A;  3UY6 A;  5L10 A;  3DTI A;  4X53 A;  3UDF A;  2WZX A;  4M3K A;  4ETX A;  4C75 A;  5FI6 A;  4YIN A;  1BYW A;  3L9K A;  4UQI M;  4DJ2 A;  4WZ5 A;  1YPR A;  4O0P A;  3ZG7 B;  3NOT C;  5FAT A;  1E4D A;  2OAQ 1;  1KVL A;  4QY5 A;  3MKE A;  1YAX A;  1ERQ A;  5KSC A;  2E8I A;  1PIO A;  3IS2 A;  3IF6 C;  4O01 A;  3A3E A;  4S2M A;  5AQA A;  4CJN A;  1IEL A;  1GSW A;  3FZC A;  1PW1 A;  1OTB A;  2Z2L B;  3L7H A;  3LR0 A;  1Q2P A;  2PU2 A;  1DP8 A;  3T50 A;  3U4L P;  3O87 A;  3E98 A;  2ZOH A;  1WYC A;  3RH8 B;  4DRT A;  2QYB A;  1L3L A;  5FQI A;  1NRJ A;  1BT5 A;  3BY9 A;  2VZW A;  4KUO A;  2PU4 A;  3V5M A;  5CTM A;  5DVA A;  1XP4 A;  3V3S A;  2XA7 M;  2J9P A;  2JKR M;  2D01 A;  2MJ6 A;  5L8M A;  1ACF A;  4ZDX A;  4NK3 A;  3GVB A;  4R0Q A;  1YLY A;  4ZJ2 A;  5M1A A;  4BD0 A;  3DTM A;  4EBL A;  3C5A A;  4PKY A;  3A3I A;  1H8Z A;  4NXF A;  3VOL A;  2IWC A;  1BUE A;  1Z09 A;  2PR5 A;  4ZJ1 A;  3W4O A;  5CGS A;  3E4O A;  4Z1W A;  4LV2 A;  4Y2F A;  2WGW B;  1ESU A;  3DWK A;  4P6Z S;  5FI2 A;  2CMN A;  4PM5 A;  2JC7 A;  2WAF A;  3HCY A;  5HSQ A;  2K7S A;  1SKO B;  1FSW A;  4K08 A;  3IX3 A;  4QWO A;  5F82 A;  4F3L B;  5HFO A;  4UA9 A;  1VEU B;  4ME4 A;  3VP2 A;  5DF9 A;  4K0W A;  1MPL A;  2GX5 A;  3NUL A;  1FSY A;  4N9L A;  1W5D A;  4E04 A;  2OLU A;  3T1Q B;  1J3W A;  3ZDJ A;  3DWZ A;  4EEP A;  3TSG A;  3O5Y A;  2L0W A;  3WWX A;  5AVF A;  1TD5 A;  3HLB A;  5AQ9 A;  5DJT A;  1UWP X;  4WLA A;  5DFY A;  4DKI A;  1ES3 A;  4X69 A;  4R6L A;  4DDY A;  4UQI S;  2ZD8 A;  4E3O A;  3UE3 A;  3GV9 A;  4ZBE A;  4DE3 A;  5FEF A;  2Y2H A;  5A93 A;  4PHT A;  2Q9M A;  5DKK A;  4GJ4 A;  5I5L A;  5EOE A;  3VV4 A;  5FAO A;  3IT9 A;  3N8L A;  2JN7 A;  5HZH A;  4KZ8 A;  1DRM A;  3C4O A;  1JVJ A;  3H9W A;  4Q0H A;  3JYI A;  5E2H A;  1JNU A;  1DY6 A;  3T4S A;  3NY4 A;  5DF7 A;  2G2W A;  1GHI A;  2A2L A;  1S0W A;  1S1Z A;  4HHD A;  3T4J A;  1RP5 A;  5CGX A;  2WK0 A;  1W7F A;  4R3A A;  4F94 A;  3HVF A;  3AGE A;  3RXW A;  1K57 A;  3IWQ A;  3HL9 A;  1KDS A;  4KUK A;  3HJI A;  3VP1 A;  3NEC A;  4S2N C;  4Y0U A;  2Y79 A;  2ZQ8 A;  3MQQ A;  4JF6 A;  1OTE A;  2BAS A;  3NHQ A;  5E2G A;  3QNB A;  3SS4 A;  1NLZ A;  3BFF A;  3LI9 A;  2G7U A;  2KOI A;  1X0O A;  1PZO A;  3IWO A;  5KIZ A;  3ITB A;  2Y2G A;  2VK3 A;  4MEZ A;  4JXV A;  4OH0 A;  3FC7 A;  2W3G A;  3OPL A;  3MZD A;  4BMW A;  3IBJ A;  3E2L A;  2VKS A;  4MBK A;  3RXX A;  2A24 B;  1VET A;  5DTK A;  1PRQ A;  4ARZ A;  1CI9 A;  3PBN A;  3WS4 A;  2JE5 A;  5F83 A;  1K56 D;  4FCF A;  4H6J A;  1XJ6 A;  4BQM A;  3LUQ A;  3OPH A;  3KYQ A;  4O8G A;  1L2S A;  1BSG A;  5IHV A;  4K0X A;  3QP8 A;  1T1C A;  3QP4 A;  4GNU A;  4DJ3 A;  2HDU A;  4FTX A;  4YFM A;  3PBO A;  1K55 A;  4UA6 A;  1OPX A;  1KOU A;  1S4R A;  2PR6 A;  4S2O A;  2BLS A;  2ZL1 A;  1SKO A;  3EQU A;  2ZC5 B;  1XKZ A;  5EE8 A;  3FV7 A;  3BQ8 A;  2XK1 A;  3ZG9 B;  2DNS A;  3UB6 A;  2D02 A;  1HTZ A;  1M40 A;  3EOI A;  4R38 A;  4LRZ E;  4HH2 A;  1V9Y A;  4MN7 A;  3NJA A;  1K4F A;  2Y2Q A;  3GDI A;  3A0R A;  4KQO A;  3F1N A;  3C7V A;  1NWZ A;  2QPN A;  1XGI A;  4L9G A;  2V20 A;  2W1T B;  3HUM A;  4L9F A;  3LR5 A;  1W8Q A;  3T4K A;  4WMC A;  4BWI A;  1IKG A;  3MJQ A;  4WEJ A;  1RGZ A;  2ZM8 A;  4I3I A;  4S2J A;  5GHZ A;  3IQA A;  4LV0 A;  3UDX A;  4KQR A;  3SW1 A;  3OZH A;  1NRF A;  2JCH A;  3LEQ A;  4QHC A;  3LO7 A;  4ZRR A;  3KSI A;  3HBR A;  1K0K A;  2PT7 A;  3ZQ5 A;  4MMN A;  1TDL A;  1TEM A;  3PTE A;  2K2N A;  3ULF A;  3TRC A;  3P01 A;  4WEK A;  2OOL A;  5FI7 A;  4DN0 A;  2OWH A;  4IUH A;  3UB5 P;  1KGE A;  5AJG A;  4P6B A;  3H82 B;  3QP2 A;  4GD8 A;  1BTL A;  2JKF A;  3PBS A;  4OQ0 A;  3MZE A;  3UE1 A;  3BLS A;  4GKU A;  4S2N A;  3G31 A;  1JTD A;  1CEF A;  1HZO A;  5EVE A;  3IX8 A;  5TGF A;  3VOZ A;  4OQG A;  5FQK A;  3UB9 A;  3FKV A;  1S66 L;  5AQB A;  1YM1 A;  4I5S A;  5C5K A;  2O99 A;  1I5Q A;  3Q07 A;  2Y2I A;  4U3T A;  3F1P A;  4IED A;  2IA2 A;  4FOF A;  5CER A;  1K4E A;  5TBM A;  4S2I A;  3ZCZ A;  1KGG A;  1W8Y A;  5CEB A;  2W1R A;  4KZ4 A;  2ZQC A;  3P7N A;  4OOY A;  2EFU A;  1LL8 A;  1YQS A;  3Q81 A;  1IYO A;  5L2F A;  1TF1 A;  4BBV A;  1KVM A;  3VSL A;  3WS0 A;  1MWU A;  1VET B;  4GS9 A;  1P9R A;  4DE0 A;  1GCE A;  2NUP C;  1YMS A;  2HDR A;  1VM1 A;  4QU3 A;  1XGJ A;  5GLC A;  4HJ4 A;  1D06 A;  4BJP A;  1SDN A;  1XFQ A;  2G2U A;  3V3R A;  5L09 A;  4HEF A;  4L0L A;  3HJK A;  2P08 A;  1XA1 A;  4OVD A;  2HGV A;  3N7W A;  2XFS A;  5CRF A;  5DTT A;  2VA0 A;  3A3F A;  3K3D A;  2HP9 A;  3FPW A;  4GD6 A;  2VGL S;  3I7J A;  3VP3 A;  2VGJ A;  2XRN A;  1L0D A;  3DTE A;  4S2L A;  4ETZ A;  3H7W B;  1LLB A;  4LPZ A;  2WGI A;  2IWB A;  1PWG A;  2OAP 1;  4LRX C;  4QD4 A;  4M4X A;  3ICY A;  3Q1F A;  3LIA A;  3S22 A;  3UMD A;  3WS5 A;  3MKF A;  3V67 A;  4E3L A;  3OLO A;  4CPK A;  2PRF A;  4E3I A;  3T1R A;  3CWF A;  3MSH A;  2V8F A;  1S67 L;  2K31 A;  3QP6 A;  4JXG A;  3DW0 A;  4WYY A;  3ZVT A;  3UDI A;  4X68 A;  4D2O A;  2KLI A;  2EX2 A;  2P9V A;  5HAQ A;  2KX6 A;  1FR6 A;  1CJF A;  3SOI A;  5FAS A;  4Q8I A;  3LY4 A;  1F2K A;  5HW3 A;  2WKE A;  1NZU A;  4KG6 A;  4QY6 A;  5HPI A;  1JWP A;  5A92 A;  1EWZ A;  4LGW A;  2XLN A;  3OCN A;  3MXR A;  4O7D A;  1BZA A;  2A24 A;  3HLE A;  2Y2K A;  5CTN A;  4MCW A;  5GLB A;  4DMZ A;  3BWL A;  2W3D A;  4H6J B;  1K6R A;  5G18 A;  1T1A A;  3VP0 A;  4E3K A;  5HAI A;  2R78 A;  1STZ A;  4PM8 A;  5FA7 A;  4KZ7 A;  2OSU A;  5F68 A;  1N9B A;  4IBR A;  3MF0 A;  3B42 A;  1NXY A;  4R3B A;  2ZM2 A;  1DP6 A;  3LR3 A;  3QP5 A;  3WRZ A;  2HF6 A;  2X71 A;  2QZ6 A;  1CF0 A;  1H8Y A;  5G4Y A;  3LIB A;  2YKH A;  3CHW P;  2M1C A;  1FR1 A;  4BD1 A;  3IXB A;  5FQQ A;  3H7W A;  3C8C A;  2ZQD A;  3MQO A;  2XFT A;  2EX8 A;  3IF6 B;  4E3M A;  3S1Y A;  3CI6 A;  1F98 A;  3O86 A;  4KEN B;  4PPR A;  4G3V A;  5D3O A;  2P7J A;  2VGK A;  2PD8 A;  2O9C A;  4PM9 A;  3F1N B;  1GHP A;  2HDQ A;  3HLD A;  4L9E A;  3VOY A;  5HD3 A;  1DJB A;  3BW6 A;  3P09 A;  1C3B A;  3A3D A;  2PD7 A;  4FH2 A;  1MXO A;  1XJ4 A;  2QWS A;  4LCM A;  4FD8 A;  2VJW A;  3EEA A;  2IWD A;  4C6Y A;  4N9K A;  4DF6 A;  3MFX A;  2ZMA A;  3OCL A;  4WL9 A;  4HNB A;  4CLC C;  5J3W A;  2H28 A;  4DE2 A;  2EXA A;  4NKP A;  4OPY A;  2L1M A;  4HJ6 A;  3GEC A;  4IHQ A;  5I94 A;  5F6A A;  1K6S A;  3UNW A;  1FQG A;  4PM6 A;  4GB7 A;  4X25 A;  3V50 A;  3KO6 A;  3NBL A;  1P97 A;  5CHU A;  1IYP A;  5E43 A;  3TOI A;  2XQZ A;  4FSF A;  3IS2 B;  3EGX C;  1PI4 A;  5F1G A;  3WRT A;  4YNR A;  3HRE A;  4GOG A;  3D3O A;  1XFN A;  3LGO A;  4GS9 B;  1LSV A;  3T4O A;  1TS7 A;  4UA7 A;  2WGW A;  4B88 A;  1MY8 A;  3T4L A;  1P9W A;  2VV7 A;  4WEL A;  4A5R A;  3HLC A;  1N4O A;  1U60 A;  2W0N A;  3Q7V A;  1VQQ A;  5FSR A;  5J7E A;  3BFG A;  3HUO A;  1DJA A;  2EFX A;  2P9V B;  1ALQ A;  1TS8 A;  5HDC A;  1WYB A;  1D1J A;  1NYY A;  3UB7 A;  4JGP A;  5EV0 A;  4Y13 A;  3W4P A;  1QME A;  4I3J A;  5FL3 A;  3NC8 A;  4HOI A;  2Q0O A;  4PKY G;  2X01 A;  3SH8 A;  3W2Z A;  4RA7 A;  1Y4O A;  1MKM A;  3E4P A;  5DF8 A;  3FG8 A;  5FQM A;  2UWX A;  4NXE A;  1GA9 A;  1ERO A;  2XDM A;  3CUE C;  4CLC D;  1OT9 A;  4XT2 A;  4X56 A;  3CMZ A;  4P87 A;  2ZL1 B;  5FEG A;  3C7U A;  4JGQ A;  4JXS A;  4X1L A;  3N4I A;  2X02 A;  3DBA A;  5EEC A;  2W27 A;  1ES4 A;  1E3U D;  2J3T C;  3G35 A;  1CK3 A;  4HBU A;  3NI9 A;  2B02 A;  2EWV A;  3D72 A;  4IJG A;  4WM9 A;  4RX2 A;  1IYQ A;  4EXO A;  4OOL A;  1I2S A;  2YKF A;  4U0X A;  3BEC A;  1OTA A;  4I3A A;  2Y2N A;  5KZH A;  4Q0I A;  4E6W A;  4B4Z A;  1M6K A;  5EVL A;  1HLU P;  2VX8 A;  3A0S A;  2UV0 E;  4E3N A;  2WGV A;  4I39 A;  3KSH A;  2ZLY A;  5DFX A;  4ARZ B;  2HP5 A;  2I9V A;  4LV3 A;  5TFQ A;  5EVI B;  4LFU A;  2OWJ A;  4WUJ A;  4BBT A;  1YMX A;  4DXC A;  4R4S A;  3TJZ C;  3NDE A;  2J80 A;  4QB8 A;  3UO9 A;  5BOH A;  2Y91 A;  3CLO A;  3BFE A;  3ZVW A;  4PAU A;  1L0F A;  3Q7V B;  1LI0 A;  5HDD A;  3FWL A;  4Y7P A;  4S2P A;  5JYO A;  2GDN A;  2J3W A;  2ZQ7 A;  3ZHH A;  4GDN A;  1YLT A;  4NET A;  3EGD C;  2ZQA A;  2VV6 A;  5HWW A;  3IHA A;  1N9O A;  2P74 A;  1IYS A;  3C38 A;  4LLO B;  3ZG0 A;  4KZ3 A;  4B93 A;  5HAR A;  3AGD A;  1XXM A;  3VMA A;  2WKQ A;  5A8B A;  1CI8 A;  5A90 A;  4EQI A;  3R7W A;  1OTD A;  2J3T D;  2Y55 A;  1ESI A;  3LEZ A;  1NZO A;  4II7 A;  4ID4 A;  2Y4A A;  2Y2P A;  5HWT A;  3R7W B;  3SS5 A;  4Y15 A;  3EWK A;  2H5S A;  3IWI A;  3GRJ A;  3W4Q A;  2HV1 A;  1ZTU A;  4OPZ A;  1SHV A;  3Q82 A;  2EWW A;  2FFF B;  1OTI A;  3UPO A;  1JWZ A;  2V8C A;  1LSW A;  1L0E A;  3S4X A;  3LIC A;  1TVF A;  5HL6 A;  4IUK A;  2J8Y A;  3PR6 A;  1XPB A;  1YT4 A;  1BLS A;  2HJ9 C;  4WMC D;  1PI5 A;  1DJC A;  3CIT A;  3PBQ A;  4LCL A;  1BUL A;  4P85 A;  1E3U A;  2XR0 A;  4KG2 A; 
#chains in the Genus database with same CATH homology
 4IBX A;  4WYY A;  2HP6 A;  3ZDJ A;  3ZVT A;  3DWZ A;  3UDI A;  3TSG A;  2H0T A;  1XA7 A;  3E2K A;  4JLF A;  4X68 A;  4D2O A;  2EX2 A;  2P9V A;  4R1G A;  5HAQ A;  1WE4 A;  1FR6 A;  3WWX A;  4EBP A;  4EV4 A;  3SOI A;  5FAS A;  4Q8I A;  1PW8 A;  1JWV A;  4JPM A;  3LY4 A;  3HLB A;  5AQ9 A;  2ZC7 A;  1GA0 A;  3IH9 A;  5GLD A;  4DKI A;  2J9O A;  1ES3 A;  1GHM A;  5EVI A;  2WUQ A;  4X69 A;  5HW3 A;  4K91 A;  2WKE A;  3PBT A;  3ZFZ A;  4OLG A;  1NZU A;  1I2W A;  4KG6 A;  4DDY A;  4QY6 A;  4KQQ A;  1H5X A;  1MWT A;  3N6I A;  2ZD8 A;  4E3O A;  1JWP A;  4IVI A;  2A3U A;  1ZC2 A;  3GV9 A;  3UE3 A;  5A92 A;  4ZBE A;  1EWZ A;  3G30 A;  4DE3 A;  4JKT A;  2XLN A;  1MWS A;  1NJ4 A;  3N8S A;  3OCN A;  4QJG A;  3MXR A;  3LCE A;  4O7D A;  2Y2H A;  1KDW A;  1XX2 A;  1BZA A;  5A93 A;  5M19 A;  1CEG A;  4MLL A;  4S2K A;  3HLE A;  2Y2K A;  2Q9M A;  3BRM A;  5CTN A;  5AQ7 A;  3ZG8 B;  5EOO A;  1Y54 A;  4U0T A;  5GLB A;  3G34 A;  5EOE A;  3VSK A;  5CHM A;  3BEB A;  5FAO A;  3EQV A;  2EXB A;  1O7E A;  3IT9 A;  3N8L A;  3VP4 A;  1K6R A;  1FCO A;  3HUN A;  5G18 A;  4KZ8 A;  3C4O A;  3BFC A;  3VP0 A;  5HAI A;  1JVJ A;  4RYE A;  3SS3 A;  3M6H A;  4E3K A;  3G2Y A;  4PM8 A;  5FA7 A;  4IVK A;  4KZ7 A;  2OSU A;  2Y2O A;  3MFD A;  1EI5 A;  4MNR A;  4WBG A;  5M18 A;  1N9B A;  2Y2J A;  4IBR A;  3IXG A;  3JYI A;  1NXY A;  5GHX A;  4OOM A;  5E2H A;  4R3B A;  4B4X A;  1DY6 A;  2ZM2 A;  2XD1 A;  3NY4 A;  5DF7 A;  2G2W A;  4Y0T A;  1GHI A;  1S0W A;  2ZC4 B;  3PAE A;  2WZZ A;  1KE3 A;  3WRZ A;  1SDE A;  4DDS A;  3CZD A;  2X71 A;  2QZ6 A;  3IF5 A;  2DCF A;  1RP5 A;  5CGX A;  4C3Q A;  2WK0 A;  1H8Y A;  1W7F A;  4F94 A;  1YLW A;  5EVI C;  3HVF A;  3AGE A;  3RXW A;  1MKI A;  3HLG A;  1K57 A;  3IWQ A;  3HL9 A;  1FR1 A;  1KDS A;  3IXB A;  4BD1 A;  4N92 A;  5FQQ A;  5U47 A;  4XXR A;  4OP8 A;  2ZQD A;  3VP1 A;  2XFT A;  1BLP A;  2EX8 A;  3A3J A;  4S2N C;  3NDG A;  4Y0U A;  3WS1 A;  3IF6 B;  4E3M A;  2ZQ8 A;  4JF6 A;  2J7V A;  3S1Y A;  4BL3 A;  3V39 A;  3ISG A;  3M6B A;  4EUZ A;  3O86 A;  3QNB A;  4KEN B;  5CGW A;  4PPR A;  5E2G A;  3SS4 A;  3O3V A;  1YLZ A;  5D3O A;  3BFF A;  3GSG A;  1W79 A;  2VGK A;  3G32 A;  3OPP A;  2H0Y A;  4UAA A;  4PM9 A;  1GHP A;  2HDQ A;  3HLD A;  5FAQ A;  3VOY A;  4DE1 A;  5FQ9 A;  4ZTK A;  1DJB A;  3ITA A;  1PZO A;  3IWO A;  4OLD A;  2R9X A;  3G4P A;  3P09 A;  4FH4 A;  4WZ5 C;  1FCN A;  4KZB A;  1C3B A;  3A3D A;  3ITB A;  3IXH A;  2Y2G A;  4FH2 A;  4MBH A;  1MXO A;  2XGN A;  4MEZ A;  1G68 A;  4JXV A;  4OH0 A;  2XD5 A;  4JF5 A;  3OPL A;  2HDS A;  3QNC A;  3MZD A;  5EUA A;  3ZG5 A;  3E2L A;  3MZF A;  4LCM A;  4MBK A;  3GR2 A;  1MWR A;  4FD8 A;  3RXX A;  1ES2 A;  2IWD A;  1S6R A;  4C6Y A;  4UHU A;  3UPN A;  4JF4 A;  1PZP A;  4OKP A;  5DTK A;  4KZ6 A;  4N9K A;  4DF6 A;  1CI9 A;  4RVA A;  3PBN A;  3LY3 A;  2WKI A;  2ZMA A;  5E2F A;  5KSH A;  1NYM A;  3GQZ A;  3WS4 A;  3OCL A;  2JE5 A;  5F83 A;  3SH9 A;  2C6W B;  1K56 D;  4FCF A;  1KGF A;  4LEN A;  2HPB A;  4DE2 A;  2EXA A;  4BQM A;  2ZQ9 A;  3OPH A;  4JBF A;  4OPY A;  4KZA A;  4OPR A;  1AXB A;  3IXD A;  3OPR A;  1L2S A;  5I94 A;  1K6S A;  1BSG A;  3VFF A;  3QHY A;  5IHV A;  4K0X A;  3UNW A;  4ZAM A;  4GNU A;  1FQG A;  5HL1 A;  3HLW A;  4PM6 A;  2HDU A;  5HAP A;  2DRW A;  3IHB A;  1HD8 A;  4GB7 A;  2V1Z A;  4R4R A;  4YFM A;  2V2F F;  3ZGA B;  5FQJ A;  3G2Z A;  3V50 A;  3PBO A;  1K55 A;  1K25 A;  4UA6 A;  3D4F A;  1PYY A;  2H10 A;  3NBL A;  5CHU A;  1IYP A;  2XEP A;  5E43 A;  2ZJ9 A;  3TOI A;  1K54 A;  1HVB A;  2BLS A;  2XQZ A;  4FSF A;  4OP5 A;  4S2O A;  1PI4 A;  5DTS A;  3GTC A;  3EQU A;  1KE0 A;  4PMA A;  5F1G A;  2ZC5 B;  3WRT A;  2RL3 A;  1XKZ A;  3HRE A;  5EE8 A;  4GOG A;  3FV7 A;  1JTG A;  1KE4 A;  2XK1 A;  4PM7 A;  3ZG9 B;  2DNS A;  5EVI D;  1HTZ A;  4UA7 A;  2WGW A;  4B88 A;  4GN2 A;  1MY8 A;  2CC1 A;  3BYD A;  1M40 A;  4EBN A;  1O07 A;  4WEL A;  4A5R A;  5GHY A;  3HLC A;  2Y2M A;  1N4O A;  1OME A;  1U60 A;  3PBR A;  3BFD A;  1K4F A;  3OC2 A;  4E6X A;  3Q7V A;  1VQQ A;  2Y2Q A;  2PBY A;  3M2K A;  5FSR A;  3FYZ A;  4KG5 A;  2RCX A;  3BFG A;  1DJA A;  3HUO A;  3IH8 A;  4KQO A;  3C7V A;  4ZJ3 A;  2FFY A;  2EX9 A;  2QPN A;  1G6A A;  2EFX A;  2P9V B;  3MXS A;  1IEM A;  1BLC A;  1XGI A;  4XUZ A;  1ALQ A;  1WYB A;  1NYY A;  3M2J A;  2V20 A;  4KZ5 A;  3AGF A;  1K38 A;  4HBT A;  3HUM A;  3W4P A;  1W8Q A;  1QME A;  3NC8 A;  4WMC A;  1IKG A;  2I72 A;  4WEJ A;  1RGZ A;  1ONG A;  5F1F A;  2X01 A;  3SH8 A;  2ZM8 A;  4GZB A;  4S2J A;  3UN7 A;  4RA7 A;  2QMI A;  5GHZ A;  1ES5 A;  3IQA A;  5DF8 A;  4LV0 A;  3UDX A;  4KQR A;  3OZH A;  3ZNY A;  5CXW A;  1NRF A;  1FOF A;  5FQM A;  2JCH A;  2UWX A;  4Y0O A;  4QHC A;  1YLJ A;  3LO7 A;  2XF3 A;  1QMF A;  4N1H A;  1GA9 A;  1ERO A;  2XDM A;  4DXB A;  4EWF A;  3HBR A;  1J9M A;  5CHJ A;  2XH9 A;  4OQI A;  1TDL A;  1TEM A;  2R9W A;  3PTE A;  1PWC A;  4X56 A;  1RCJ A;  3CMZ A;  3N8R A;  4H8R A;  4P87 A;  3W8K A;  4JXW A;  3C4P A;  4R3J A;  4N1X A;  5KMW A;  3C7U A;  4WEK A;  5FI7 A;  3O88 A;  1MBL A;  4JXS A;  3WS2 A;  3N4I A;  2X02 A;  1KGE A;  5EEC A;  5CED A;  1ES4 A;  1E3U D;  1ZG4 A;  4P6B A;  3VFH A;  1RGY A;  3G35 A;  1CK3 A;  1K54 C;  4OQH A;  4HBU A;  3NI9 A;  3IF6 A;  5HX9 A;  4GD8 A;  4X55 A;  1BTL A;  4LV1 A;  4P0M A;  4RX2 A;  4WM9 A;  3UE0 A;  1IYQ A;  3Q7Z A;  4OOL A;  3UY6 A;  1I2S A;  4U0X A;  1IKI A;  3BEC A;  3NCK A;  3PBS A;  4X53 A;  2Y2N A;  3UDF A;  5KZH A;  2WZX A;  4M3K A;  4E6W A;  4OQ0 A;  1K55 C;  5CEC A;  4C75 A;  3MZE A;  3ZNT A;  4X6T A;  1Z6F A;  4B4Z A;  5FI6 A;  4YIN A;  3UE1 A;  3BLS A;  1M6K A;  4GKU A;  4S2N A;  5EVL A;  2JBF A;  3G31 A;  1JTD A;  4R23 A;  1BLH A;  1CEF A;  1HZO A;  4E3N A;  2WGV A;  4WZ5 A;  1LL9 A;  5TGF A;  2ZLY A;  1K56 A;  3VOZ A;  5A91 A;  3ZG7 B;  2ZC6 B;  2HP5 A;  4LV3 A;  3BLM A;  5EVI B;  5FAT A;  5TFQ A;  4OQG A;  5FQK A;  1E4D A;  3FKV A;  2WKH A;  4GDB A;  1KVL A;  1ZG6 A;  5AQB A;  4QY5 A;  3MKE A;  1YMX A;  1YM1 A;  4DXC A;  2OLV A;  3P98 A;  1Q2Q A;  1SCW A;  2WYX A;  3NIA A;  1ERQ A;  1I5Q A;  4R4S A;  5KSC A;  2E8I A;  1PIO A;  3NDE A;  3Q07 A;  2Y2I A;  3IF6 C;  4U3T A;  3UO9 A;  4QB8 A;  5BOH A;  2Y91 A;  3A3E A;  4IED A;  4S2M A;  5AQA A;  4CJN A;  5TR7 A;  1IEL A;  3BFE A;  4KZ9 A;  3CJM A;  1PW1 A;  3FZC A;  2WAE A;  5CER A;  1K4E A;  2Z2L B;  4S2I A;  3ZVW A;  3ZCZ A;  4BLM A;  1KGG A;  1Q2P A;  2PU2 A;  5FAP A;  1W8Y A;  5CEB A;  4KZ4 A;  1L0F A;  2ZQC A;  3Q7V B;  3O87 A;  2A49 A;  1LI0 A;  3UPP A;  4OOY A;  2EFU A;  1WYC A;  4DRT A;  3FWL A;  4Y7P A;  4S2P A;  5FQI A;  5JYO A;  3TG9 A;  1YQS A;  3FKW A;  3Q81 A;  1IYO A;  5L2F A;  2GDN A;  1BT5 A;  2ZQ7 A;  1ZKJ A;  1KVM A;  3VSL A;  1E25 A;  3ZHH A;  4GDN A;  1YLT A;  5GLA A;  3WS0 A;  2PU4 A;  4NET A;  2WAD A;  2Y59 A;  3B3X A;  3V5M A;  5CTM A;  1TDG A;  4E3J A;  2ZQA A;  1FCM A;  1MWU A;  1XP4 A;  5DVA A;  3V3S A;  4DE0 A;  1GCE A;  4OON A;  1YMS A;  2HDR A;  3IHA A;  1VM1 A;  2P74 A;  1IYS A;  4QU3 A;  2J9P A;  1LL5 A;  5FDH A;  3ZG0 A;  4KZ3 A;  1XGJ A;  3PAG A;  5GLC A;  3RJU A;  5HAR A;  3AGD A;  4BJP A;  1K57 C;  1XXM A;  1SDN A;  2OV5 A;  2G2U A;  4NK3 A;  3V3R A;  4ZDX A;  3VMA A;  3GVB A;  4R0Q A;  4HEF A;  1SKF A;  1YLY A;  1CI8 A;  4L0L A;  4ZJ2 A;  4EQI A;  5A90 A;  5M1A A;  1ERM A;  4BD0 A;  1L0G A;  1XA1 A;  4BEN A;  2C5W B;  2Y55 A;  2BG1 A;  1ESI A;  3DTM A;  3LEZ A;  1LI9 A;  2Y2L A;  4OVD A;  4EBL A;  1NZO A;  3C5A A;  3N7W A;  3A3I A;  1H8Z A;  4BL2 A;  3BM6 A;  4ID4 A;  2Y4A A;  3SH7 A;  2Y2P A;  2XFS A;  2IWC A;  1BUE A;  1ONH A;  3GMW A;  4MBF A;  5CRF A;  4Z9Q A;  5DTT A;  3SS5 A;  1PWD A;  3A3F A;  2H5S A;  2HP9 A;  3IWI A;  4XUX A;  4GD6 A;  3I7J A;  5GL9 A;  3VP3 A;  1NY0 A;  2VGJ A;  4ZJ1 A;  3W4O A;  5CGS A;  3GRJ A;  3W4Q A;  4OPQ A;  4LV2 A;  1L0D A;  2WGW B;  1ESU A;  3DWK A;  4S2L A;  4OPZ A;  1SHV A;  3Q82 A;  2ZM0 A;  2FFF B;  2EX6 A;  5FI2 A;  1LLB A;  3MBZ A;  1YLP A;  4WZ4 A;  5EPH A;  4PM5 A;  3UPO A;  1JWZ A;  2JC7 A;  2WAF A;  2ZC3 B;  2WGI A;  1PWG A;  2IWB A;  4QD4 A;  1L0E A;  1FSW A;  3Q1F A;  3S4X A;  3S22 A;  1TVF A;  4RX3 A;  2B5R A;  3WS5 A;  5F82 A;  3MKF A;  5HFO A;  2J8Y A;  4UA9 A;  1XPB A;  4E3L A;  3VP2 A;  5JYP A;  1YT4 A;  5DF9 A;  4K0W A;  5E2E A;  2Q9N A;  4CPK A;  4E3I A;  1MPL A;  1BLS A;  4WMC D;  1PI5 A;  1DJC A;  3CG5 A;  3HLF A;  4HES A;  3PBQ A;  4LCL A;  1BUL A;  4P85 A;  1FSY A;  4N9L A;  1LHY A;  1W5D A;  1E3U A;  2XR0 A;  4KG2 A;  4JXG A;  2Z2M B;  5J8X A;  2OLU A;  3DW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...