3SH8A

Crystal structure of fluorophore-labeled beta-lactamase penp in complex with cephaloridine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
257
structure length
253
Chain Sequence
KDDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFCPENPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increased structural flexibility at the active site of a fluorophore-conjugated beta-lactamase distinctively impacts its binding toward diverse cephalosporin antibiotics
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase/antibiotic
molecule keywords Beta-lactamase
total genus 84
structure length 253
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3sh8A00
5EE8A 1GA0A 3IWIA 3WS0A 1C3BA 3VOYA 3TSGA 3FKWA 1IKGA 2QPNA 3VMAA 1U60A 1I2SA 1XGJA 2ZQDA 4JF4A 4B88A 4S2NA 3BLSA 4OLGA 1YLYA 3IXBA 3CMZA 3NC8A 4WMCA 5FI7A 1IYOA 1DJBA 3A3JA 4R0QA 1BLSA 4PM8A 3NDEA 5EVIC 4X6TA 3OPPA 3AGFA 1YMXA 5JYOA 4WZ4A 1FCOA 1KE3A 1RGYA 1DJAA 3HLWA 3IH9A 1OMEA 2X71A 3Q7ZA 4MNRA 5FQ9A 1ERMA 5TGFA 4GD8A 4KENB 3SH7A 3FV7A 1N9BA 4KG5A 4IVIA 2XDMA 3WS1A 1L0EA 1MKIA 1NXYA 4R1GA 1E3UA 4HESA 4KG6A 1TDGA 5A91A 5EECA 2V2FF 4KZ8A 1XGIA 1GHMA 4N1XA 1K54A 4LV2A 3ZVWA 3E2LA 1SCWA 2XFSA 2EX2A 3UO9A 5EPHA 2OSUA 5CHMA 2EXBA 4KZ3A 2PU2A 1NZOA 5CECA 4FD8A 2C6WB 3FZCA 3VP2A 5F83A 1K4EA 2ZC6B 4YFMA 2X02A 4NETA 4WEKA 3W8KA 1RGZA 3G30A 1YT4A 4C3QA 4DE0A 1MXOA 1FSYA 1XP4A 3IH8A 3VP0A 1I2WA 2WGWB 3IQAA 5FQMA 3V50A 3OZHA 1H8ZA 3LO7A 3IXGA 1TEMA 1PW1A 3PBOA 5M1AA 1KGGA 5E2EA 1LI0A 1YLPA 4C6YA 2DRWA 3CG5A 2Y91A 4GB7A 1PI5A 4JXGA 1K57C 4BD0A 5KSCA 3M6HA 4O7DA 2VGJA 2IWCA 3S4XA 4DDSA 4GDNA 3TG9A 4QD4A 4ZAMA 5G18A 3OC2A 1E25A 2J7VA 4MBHA 4OONA 4QB8A 4N9LA 1BUEA 4JXVA 2Y59A 4OLDA 3ZG7B 4B4ZA 1BT5A 4KZBA 1LL9A 1M6KA 4GZBA 1MWRA 2I72A 5AQ7A 4JXWA 4E3IA 4EUZA 3NDGA 2FFYA 2J8YA 2WGWA 3A3IA 1IYSA 1FR1A 4S2NC 5HAPA 4U3TA 5HARA 4RVAA 2Y2NA 2ZC7A 2XFTA 3NI9A 2XGNA 2Q9MA 1L0GA 3VFHA 1YQSA 5L2FA 2B5RA 4JKTA 4A5RA 4MEZA 4PPRA 4GN2A 4DE3A 2Y2JA 1HD8A 1K6SA 4F94A 2HPBA 3BFCA 4E6XA 3ZFZA 2HDSA 1PYYA 2WUQA 2Y2LA 4X56A 5GL9A 5IHVA 4E3MA 3N8SA 4R4SA 4WELA 4S2IA 2Y55A 3ISGA 2A3UA 1JTGA 3A3DA 3BRMA 3LY4A 1YLJA 4LV0A 1Q2QA 1E3UD 2ZM0A 3JYIA 2ZQ8A 3HL9A 1DY6A 3GTCA 5FI2A 1K25A 3VOZA 3VP1A 4IBRA 5KZHA 5CHJA 1LHYA 1S0WA 4KZ5A 1KVMA 1HTZA 4OH0A 1MWTA 4M3KA 1MPLA 3W4OA 3ZVTA 3HUOA 5FAOA 3VSKA 1K56D 2QMIA 3HVFA 4B4XA 1K6RA 3M2JA 5DTKA 1HVBA 4D2OA 1MWSA 2WKHA 1TDLA 3W4QA 4BJPA 4K0WA 3IHAA 4QY6A 3B3XA 3G32A 4E6WA 3EQVA 5CTMA 3BM6A 3HLBA 1IYQA 4LENA 3DWZA 3BFGA 4FH2A 1BLHA 2Y2PA 4P6BA 4UHUA 3PBSA 3IF6B 4EQIA 5A90A 4DKIA 2RL3A 2XD5A 3C7VA 5CGWA 5GHXA 2XQZA 3RXWA 3NY4A 5DTTA 5HAIA 2GDNA 1LLBA 2HP5A 4GDBA 2Y2IA 1G6AA 2ZM8A 4DE2A 2HDUA 4JF5A 3EQUA 4OVDA 4XXRA 4KZ6A 3A3EA 5CHUA 5M19A 2ZD8A 3HBRA 1BTLA 1ES2A 4WYYA 2G2UA 5AQAA 3SOIA 4Y7PA 1EROA 3SS3A 3WS2A 3N6IA 3BFDA 3MZFA 5AQBA 5EOOA 2HP9A 3UE1A 2Z2LB 3IWQA 2P74A 3OCLA 3MKFA 1HZOA 4HEFA 3BEBA 4PMAA 2ZQ9A 2WAEA 5DF8A 4LCLA 1BLCA 3GVBA 4FH4A 3Q07A 5F1FA 3WRTA 3Q82A 3BFEA 2H5SA 3MZDA 3MXSA 3PBTA 3MXRA 1M40A 2WAFA 5CGSA 4E3JA 2BG1A 3AGDA 4GD6A 3AGEA 3ZG0A 5DF9A 2R9XA 3V3SA 2CC1A 1KGFA 2Y2GA 1BULA 4UA9A 1MWUA 1W79A 1GCEA 4EBLA 4EBPA 2HDQA 3HUMA 1H5XA 4R3JA 3ZG9B 3GSGA 3SS5A 1YLWA 3IT9A 2WKIA 2ZQAA 3WS5A 4E3LA 4BENA 5CRFA 1IEMA 2EX8A 3N7WA 4Q8IA 4U0TA 3G34A 2Y2MA 3G4PA 1KVLA 4WBGA 4CPKA 1Y54A 2V1ZA 3SH8A 1TVFA 4P0MA 4XUZA 3C5AA 1MY8A 4ZJ1A 4L0LA 2Z2MB 3G35A 1VM1A 4KG2A 1ESUA 3CJMA 3BLMA 2Y2KA 3O88A 1GHPA 3HUNA 1AXBA 2A49A 3N8LA 1DJCA 1SKFA 5HX9A 3BECA 5TFQA 4OQ0A 4PM5A 3WWXA 2XLNA 3VP3A 1ES3A 3GQZA 4KZ4A 1BZAA 5E2HA 2WYXA 3V3RA 4BLMA 4ZJ2A 4E3KA 1FSWA 3IF6C 4DRTA 1IKIA 1ESIA 1LI9A 3GRJA 3QNCA 3SH9A 3HLFA 4RX2A 3M2KA 4P87A 4E3NA 4X55A 1I5QA 2ZQCA 1ONHA 1BLPA 2PBYA 5FQJA 1WYCA 2ZJ9A 3DW0A 3I7JA 4OOLA 1NY0A 5A93A 1KE4A 2WZZA 3Q7VA 4KZ7A 1ALQA 5FI6A 4RA7A 1WE4A 3OPRA 4BD1A 2EFUA 4GNUA 4P85A 4X69A 5HW3A 4ZJ3A 3ZNTA 1L0DA 4LV1A 5F82A 5FSRA 3IXDA 5CERA 3IWOA 2E8IA 2EX9A 5I94A 5GHYA 5KSHA 1PZOA 5HL1A 5DTSA 1CEGA 1MBLA 3S1YA 1EI5A 4PM7A 2EFXA 3CZDA 4OPZA 2V20A 5E2FA 4GOGA 3VP4A 4E3OA 4KQQA 5FAQA 5TR7A 5GLAA 2JE5A 4LCMA 4OKPA 1GA9A 4BL2A 1S6RA 4HBUA 5CEDA 2IWDA 3N8RA 4HBTA 4JXSA 1G68A 1SHVA 3C7UA 4N92A 5E43A 4DE1A 3PBRA 3ITAA 1SDNA 2FFFB 3UE3A 4QU3A 1KGEA 4FCFA 2WZXA 1PIOA 4WM9A 4JF6A 4IVKA 1ZG6A 5EOEA 2XD1A 3S22A 1FOFA 1N4OA 4H8RA 5E2GA 5JYPA 1EWZA 4PM9A 4KZAA 5GLDA 4ZBEA 5DF7A 4N9KA 1YLZA 2Y2QA 1VQQA 1K4FA 1CI8A 1YMSA 2ZQ7A 3UPPA 4EV4A 1PW8A 2H10A 3DTMA 3M6BA 3A3FA 1NZUA 5FDHA 1CEFA 4OQHA 5J8XA 1K55C 4X68A 4RYEA 1W5DA 2XK1A 1FR6A 4Z9QA 2DNSA 4N1HA 1ZC2A 4ZTKA 3VSLA 4IEDA 5AQ9A 1K38A 4JBFA 4OQIA 4WZ5A 3UN7A 4XUXA 4Y0OA 4OP5A 3O3VA 4LV3A 2X01A 2OLUA 3RJUA 1E4DA 4S2KA 4QY5A 3BYDA 2XEPA 2HDRA 2ZM2A 5FQKA 4KQOA 3UDXA 1CI9A 3BFFA 3IF5A 3LY3A 4QJGA 1BSGA 3GV9A 4MBFA 4U0XA 3SS4A 5F1GA 5BOHA 5GLBA 2Y2HA 1ES4A 1K56A 4RX3A 2H0YA 5CXWA 4CJNA 2H0TA 2WADA 4OPRA 1W8QA 5CGXA 2ZLYA 4BQMA 3PAEA 4MLLA 2Q9NA 2P9VA 2WGIA 1GHIA 3GR2A 3MFDA 3P98A 3PAGA 5FQQA 1NRFA 1JTDA 1ERQA 1FCMA 4JPMA 4OP8A 5KMWA 1L0FA 4UA6A 4ZDXA 3HLDA 1W7FA 4DXBA 1XKZA 2RCXA 4DXCA 2WK0A 1NJ4A 4C75A 4IBXA 4WZ5C 3WS4A 3WRZA 3PBQA 4S2LA 5DVAA 5EVIB 3G2ZA 1XPBA 4Y0UA 4S2JA 2VGKA 5FATA 3Q1FA 2PU4A 4QHCA 2UWXA 5U47A 1JVJA 1FQGA 3G2YA 3D4FA 3VFFA 2Y2OA 2P9VB 3N4IA 3HLGA 4NK3A 1W8YA 3UY6A 4JLFA 2ZMAA 4OOYA 3TOIA 1K54C 4R23A 5FASA 1PZPA 5CEBA 4FSFA 1IELA 4DDYA 3RXXA 5GHZA 1ZKJA 3C4PA 4R4RA 1O07A 5D3OA 3UPOA 3NIAA 4OOMA 1PWCA 3LEZA 4S2MA 1PWDA 1K57A 3C4OA 4OPYA 1Q2PA 4BL3A 1PWGA 2IWBA 3W4PA 1KE0A 4S2OA 3O86A 3IF6A 4WMCD 4UAAA 2HP6A 1O7EA 2XF3A 3V39A 2Y4AA 1FCNA 1PI4A 1YLTA 3OPHA 1K55A 1ES5A 4S2PA 5GLCA 1KDWA 1QMEA 3QHYA 5FQIA 4MBKA 3UDFA 1H8YA 4DF6A 1QMFA 1RCJA 2EX6A 2XH9A 4ID4A 1SDEA 3UPNA 2ZC4B 2EXAA 5EVLA 4EWFA 4OPQA 1NYYA 2JC7A 3G31A 3QNBA 1NYMA 4K91A 2J9OA 4Y0TA 2C5WB 3HREA 3ZHHA 3NCKA 2WGVA 3E2KA 3ZNYA 1KDSA 2ZC5B 2BLSA 3ITBA 2QZ6A 2OV5A 4KQRA 3UDIA 1L2SA 4X53A 5EVID 3MZEA 3V5MA 1Z6FA 1YM1A 3P09A 3UNWA 4UA7A 3NBLA 2JBFA 1XXMA 5EUAA 3LCEA 4PM6A 1ONGA 2JCHA 4KZ9A 1IYPA 3OCNA 2J9PA 2XR0A 3FWLA 3PBNA 1CK3A 4YINA 1XA1A 4GKUA 5HFOA 3ZGAB 2OLVA 3MBZA 4EBNA 3UE0A 1J9MA 3ZCZA 3ZG5A 3GMWA 2DCFA 5FAPA 3IHBA 1JWPA 5EVIA 3Q81A 5CTNA 2WKEA 3Q7VB 1JWVA 2R9WA 5A92A 2G2WA 5M18A 4OQGA 3FKVA 3HLEA 4WEJA 1RP5A 3FYZA 3PTEA 4K0XA 1JWZA 5HAQA 3ZDJA 1LL5A 3MKEA 2ZC3B 3OPLA 3IXHA 1ZG4A 1XX2A 4R3BA 1WYBA 1XA7A 3O87A 3HLCA 3ZG8B 3DWKA 5FA7A
chains in the Genus database with same CATH superfamily
3CWFA 2NUPC 3K3CA 3B33A 1XGJA 2AVXA 4IUHA 4LRXC 3LUQA 4WMCA 1TS7A 1XJ6A 1JNUA 4FUWA 3F1OA 4WZ4A 2X71A 5FQ9A 1ERMA 2HJ9C 3QP8A 2KLIA 3F1NB 4GD8A 4HIAA 4KG5A 4IVIA 1OTBA 3MSHA 4HESA 4KG6A 2ZOIA 2XRNA 5EECA 1GHMA 4LV2A 3ZVWA 3E2LA 4JGPA 2EX2A 3CUEA 2OSUA 5CHMA 2EXBA 2PU2A 3BY8A 3JVUA 3LIBA 5F83A 1K4EA 3G6OA 3W8KA 1RGZA 3E4QA 1YT4A 4C3QA 1FSYA 2ZMFA 2JKTM 2O0YA 5TJJA 3OZHA 1KGGA 2Q0OA 2DRWA 3CG5A 4GB7A 2Y79A 3BQ8A 3M6HA 2IWCA 3TG9A 4QD4A 5G18A 1E25A 4N9LA 4B4ZA 1M6KA 4GZBA 1MWRA 2I72A 4JXWA 3MQQA 4RVAA 4IJGA 2ZC7A 4WL9A 2XGNA 3T4QA 1NLZA 5L2FA 2B5RA 4QWOA 5FL3A 2Y2JA 1K6SA 4R38A 2Y2LA 1G28A 4WELA 3FG8A 3QP5A 1JTGA 3LY4A 5L8MA 2LB9A 2ZQ8A 3HL9A 1DY6A 4G3WA 5FI2A 1LHYA 1S0WA 3T4OA 1MWTA 3NOTC 3ZVTA 3RTYA 2QMIA 3HVFA 1K6RA 2Z6DA 1TDLA 3W4QA 2G7UA 3IHAA 4NXEA 3B3XA 4HH2A 3BM6A 1A0KA 3DWZA 3R7WB 3BFGA 2Y2PA 2O9BA 3KSGA 3VV4A 4DKIA 2DMWA 2RL3A 2QKPA 4KUOA 3A0RA 3KYQA 3H7WB 1H3QA 1YSQA 3A3EA 4B93A 1EROA 3UE1A 3MZFA 5AQBA 4ZRRA 3MKFA 2ZQ9A 1BLCA 3EGDC 3WRTA 3Q82A 3BFEA 3MXSA 4NXGA 2WAFA 4H6JA 2VV8A 1BULA 1MZUA 4UA9A 1GCEA 4O01A 3HUMA 4R3JA 3GSGA 3KSHA 4E3LA 1IEMA 2Y8HA 3G34A 2JKRM 2Y2MA 3G4PA 1H0MA 3FPWA 2EA9A 4PHTA 4ETZA 2H28A 3G35A 3MMHA 5J3WA 3HUNA 3N8LA 5HX9A 4OQ0A 3WWXA 3TE8A 3GQZA 4HNBA 3HCYA 1AWIA 1GSXA 2V8CA 4GLQA 2V1AA 4KQDA 4DRTA 4P6ZM 1H8MA 5TBMB 4X55A 3ICYA 1ONHA 3E4PA 3DW0A 3DTIA 1KE4A 1T19A 4RA7A 4BD1A 1N9OA 1OTEA 3ZNTA 1L3LA 4JGOA 5GHYA 5HL1A 4JGQA 4XT2A 2W0NA 4OPZA 2V20A 2VEAA 1LSVA 4R6LA 1PFLA 2JE5A 4BL2A 4E04A 5K5BA 5CEDA 2IWDA 1P9RA 4JXSA 4N92A 2FFFB 4QU3A 3DTKA 2XD1A 3IX3A 5JYPA 4H8RA 4HH3A 5E2GA 5GLDA 4KZAA 4ZBEA 5DF7A 4N9KA 1YLZA 1CI8A 1PW8A 3DTMA 4O0PA 4GS9A 4OQHA 3CI6A 2JN7A 4Z9QA 4IEDA 3UN7A 5EVEA 4OP5A 2X01A 5DFYA 3LR4A 1OTAA 2O99A 4S2KA 4QY5A 4CLCB 4CLCC 4Y13A 4MBFA 3SS4A 5GLBA 1ZTUA 2W27A 1ES4A 3K3DA 1NRFA 4BBUA 1ERQA 1FCMA 3B47A 2W1RA 3HLDA 3B42A 4HHDA 3WRZA 3PBQA 4S2LA 2VGKA 4QHCA 2UWXA 3G2YA 1FQGA 3D4FA 2P9VB 5LBRA 3HLGA 2M7VA 4JLFA 4R23A 1PZPA 3H7WA 4GW9A 2PD7A 1ZKJA 2P08A 3UPOA 3NIAA 4OOMA 3LEZA 2QJ7A 1PWDA 4BL3A 2GJ3A 3NULA 3O86A 4UAAA 3TRCA 1PI4A 3OPHA 1K55A 5EV0A 3LI8A 2E8JA 1ODVA 1QMFA 4Y15A 4ID4A 3UPNA 2EXAA 4MMNA 1NYYA 4K91A 1SKOB 2J9OA 4Y0TA 2C5WB 3HREA 4MN6A 1SKOA 3P09A 4UA7A 3LCEA 1IYPA 2XR0A 4L9EA 4EU0A 1CK3A 1UGUA 3LIFA 4YINA 4HJ4A 4EBNA 2KOIA 1T1CA 3GMWA 2DCFA 3Q81A 2WKEA 3Q7VB 3MJQA 2VGLM 1GSVA 4WEJA 5HWWA 5HAQA 3ZDJA 1LL5A 3OPLA 4WUJA 2XSSA 4R3BA 4DJ3A 4NG2A 2VV7A 5FA7A 4I39A 2D02A 2QPNA 1U60A 1I2SA 2ZQDA 4S2NA 3BLSA 4OLGA 3IXBA 3CMZA 1IYOA 1DJBA 4R0QA 4WLAA 5EVIC 4X6TA 1YMXA 5JYOA 1FCOA 3Q7ZA 5TGFA 4IHQA 3C8CA 1OTDA 1N9BA 1L0EA 5A91A 1XGIA 3D72A 3RH8B 3OBFA 3UO9A 3C38A 3EEAA 1NZOA 4PAUA 4GCZA 2X02A 3NOPC 3G30A 3HJIA 1TEMA 3PBOA 1T1BA 3P01A 5E2EA 3BQAA 1YLPA 4C6YA 5IT5A 1P9WA 1K57C 4BD0A 2VGJA 4DDSA 1F2KA 3UB8A 4ZAMA 2HJEA 2J7VA 5F68A 4QB8A 4KZBA 2HGVA 1S1ZA 1BYWA 4PKYA 4LRZE 1G6OA 5HAPA 4U3TA 2XFTA 3KO6A 5TBMA 4A5RA 1XFQA 4F94A 2HPBA 5CEBA 4E6XA 5IHVA 4X56A 5GL9A 3N8SA 4R4SA 4EQ1A 2Y55A 2K7SA 1YLJA 4LV0A 5EFWA 1Q2QA 1E3UD 1EW0A 1K25A 3VOZA 3VP1A 5KZHA 4DJ2A 3E0YA 4KZ5A 1HTZA 2B95A 3W4OA 3PYPA 3UB9A 1S4RA 3VSKA 4D2OA 5DTKA 2R78A 1MWSA 2WKHA 1OJ5A 4I3IA 4K0WA 4QY6A 1F5MA 2LB5A 4E6WA 3EQVA 3HLBA 1IYQA 2GZAA 4DMZA 3C2WA 3IS2B 2PDRA 3LR5A 4UHUA 3PBSA 1Z09A 3TJZC 2XD5A 1KOUA 3IBJA 3C7VA 1VB6A 5HD3A 2XQZA 5HAIA 5DTTA 2GDNA 1LLBA 1G6AA 1TF1A 4JF5A 4OVDA 4KZ6A 4WYYA 3SS3A 3WS2A 3N6IA 2HP9A 3CHWP 3IWQA 2P74A 1LSXA 3OCLA 4PMAA 2WAEA 5DF8A 3Q07A 3PBTA 3L7HA 3MXRA 4ESPA 3IX4A 4YWZA 4GD6A 3AGEA 1T1AA 2R9XA 3V3SA 1KGFA 3LEQA 1F9IA 3ZG9B 1YLWA 3IT9A 2WKIA 2PR5A 2ZQAA 4YOFA 2EX8A 4CPKA 2V1ZA 3SH8A 4P0MA 1OT6A 2Z2MB 2P04A 1ESUA 4WN5A 4ARZB 1DJCA 1D7EA 2VX8A 3R7WA 3VP3A 1BZAA 4BLMA 2OAQ1 4NEED 1OJGA 1IKIA 1LI9A 4B9OA 4RX2A 2ZQCA 3I7JA 1Y4OA 4Y5FA 1XJ4A 1ACFA 4KZ7A 3OPRA 1N9NA 4P85A 5FDSA 4Q0JA 3K2NA 5FSRA 5HPFA 2E8IA 2EX9A 4F3LA 5KSHA 2V8FA 1XFNA 1MBLA 2PHYA 4KQQA 5TR7A 5MC7A 2O9CA 4OKPA 1GA9A 2JKFA 2EWWA 3DAVA 1SDNA 3OLOA 1KGEA 4FCFA 2OAP1 4IVKA 4EEUA 1FOFA 1N4OA 1XJ3A 1VQQA 2H10A 1NZUA 1N9LA 4GHIB 2XK1A 3T1RA 4N1HA 3U4LP 2BTFP 4OQIA 1DRMA 4XUXA 1NLYA 1ZHHB 1UWPX 5HWTA 1E4DA 3BYDA 2HDRA 2P7JA 3CAXA 3UDXA 3DTEA 3BFFA 3IF5A 3LY3A 5FEGA 5BOHA 3BJNA 4E3MA 4RX3A 2H0YA 5CXWA 4CJNA 2H0TA 2WADA 2ZLYA 3IBRA 2L0WA 2WGIA 5FQQA 2QJ5A 3A0SA 1JTDA 2V0UA 4UA6A 4WZ5C 3T1SA 5DVAA 3G2ZA 1OPXA 2ACGA 4S2JA 4EERA 3KX0X 2PU4A 3VFFA 4CQHA 3UY6A 5FASA 1VEUB 1MC0A 2HF6A 5D3OA 4X1LA 4S2MA 3C4OA 2VLGA 4OPYA 1Q2PA 1KE0A 4S2OA 1XJ2A 3L9KA 1P97A 1FCNA 4S2PA 1KDWA 3QHYA 2FH5A 4ETXA 1H8YA 4DF6A 4I3AA 1RCJA 2EX6A 4GHIA 3EOIA 4OPQA 4EESA 4YNRA 1NYMA 4EW7A 3ZHHA 3NCKA 4Q0IA 2BLSA 2OV5A 1L2SA 3E98A 5EVID 3V5MA 1Z6FA 3R4KA 3UNWA 2UV0E 3KYZA 2L4RA 1ONGA 2JCHA 1TS6A 3OCNA 3UB6A 4GKUA 3ZGAB 2K31A 2V0WA 1TS8A 4MN7A 1JWPA 2A24B 1JWVA 2G2WA 2CMNA 3FKVA 3UMEA 2ZC3B 1XA7A 3O87A 1GA0A 1PRQA 1C3BA 3VOYA 3TSGA 3FKWA 1IKGA 3T4KA 3S7OA 4JF4A 5IS1A 4L9FA 1VHMA 1YLYA 3NC8A 1DP9A 3OPPA 3AGFA 1OMEA 4HJ3A 4ARZA 1MKIA 4R1GA 1E3UA 1TDGA 2I9VA 1K54A 4LPZA 4BMWA 2XFSA 5EM0A 4GJ4A 5CECA 2C6WB 3FZCA 1D1JA 3VP2A 2ZC6B 4NETA 4WEKA 1V9YA 3IX8A 1XP4A 3IH8A 3VP0A 3P7NA 2OOLA 1YPRA 3V50A 3IXGA 2B02A 1PW1A 3CUEC 1LI0A 4Y2FA 2YKFA 2YKHA 2PBDP 5KSCA 1F98A 3S4XA 3E4OA 4OONA 1OT9A 1BUEA 4JXVA 2Y59A 4OLDA 3ZG7B 1P0ZA 5AQ7A 3NDGA 2FFYA 1IYSA 1FR1A 4S2NC 2Y2NA 5HZHA 5HDSA 2JKRI 5HSQA 1L0GA 3VFHA 3QP6A 4MEZA 4PPRA 4GN2A 4DE3A 2A24A 3F1PB 1HD8A 3ZFZA 2HDSA 1CF0A 4NXBA 2ZM0A 4IBRA 4OH0A 4LLOB 3HUOA 5FAOA 3F1PA 3M2JA 1HVBA 2V1BA 4HI4A 3G32A 3IS2A 4LGWA 3CITA 5CTMA 2ZOHA 4FH2A 1BLHA 4P6BA 3IF6B 1S67L 2W3GA 1S1YA 2OWJA 2VA0A 5GHXA 4HY8A 3RXWA 3NY4A 2GNXA 2J80A 2Y2IA 2ZM8A 4DE2A 2HDUA 1OTIA 5HPIA 4XXRA 5CHUA 5M19A 2ZD8A 2G2UA 4Y7PA 4BBVA 3BFDA 3EEHA 1HZOA 1S66L 2O9AA 4FH4A 5F1FA 4EEPA 2H5SA 2W3HA 4CLCE 1M40A 3AGDA 5HD5A 2CC1A 3BWLA 4EBLA 2WKPA 3NECA 3MF0A 1T18A 2J3TC 4CLCD 3N7WA 5DKKA 1KVLA 4WBGA 4WF0A 4XUZA 2WKRA 1MY8A 2ZL1A 4KG2A 3O88A 3BLMA 2Y2KA 4PKYG 1GHPA 1GSWA 2A49A 3BECA 4PM5A 2XLNA 1ES3A 2D01A 3GECA 4ZJ2A 4E3KA 4NKPA 3IF6C 1ESIA 3GRJA 3QNCA 1PNEA 3SH9A 3M2KA 4P87A 4E3NA 1I5QA 3LIDA 3KYEA 2V9AA 1BLPA 2PBYA 5FQJA 2ZJ9A 1NY0A 3MQOA 4I3JA 1WE4A 1J3WA 4GNUA 4X69A 4I38A 4LV1A 4AFIA 3IXDA 2M1CA 3IWOA 3D9YA 5I94A 1K0KA 1PZOA 5DTSA 1CEGA 3S1YA 1EI5A 4PM7A 2EFXA 3CZDA 5F6AA 2EWVA 2IA2A 5E2FA 4GOGA 3VP4A 3QP2A 3FC7A 3V67A 4HBTA 4DE1A 1SHVA 5E43A 3C7UA 3PBRA 3ITAA 4Y17A 3UE3A 3LR3A 5F5YA 1PIOA 5KIZA 4JF6A 5HDDA 1ZG6A 5EOEA 3S22A 2W1TA 4EXOA 4CLCA 1EWZA 4PM9A 5C5KA 3OOVA 5CX7A 2Z6CA 2ZQ7A 4EV4A 3M6BA 3S7QA 3A3FA 5FDHA 5J8XA 1K55C 1W5DA 4ZTKA 4KUKA 4JBFA 2VV6A 5HWVA 4Y0OA 3O3VA 3QP1A 3PXPA 1D06A 5AJGA 2XA7M 5FQKA 2ZM2A 4Q0HA 4QJGA 1YSPA 5F1GA 3TW8A 2W3FA 4OPRA 5CGXA 4BQMA 4MLLA 2P9VA 2Q9NA 3MFDA 1GHIA 3P98A 5KMWA 2RCXA 2WK0A 1NJ4A 1VEUA 4C75A 3WS4A 5EVIB 1XPBA 4Y0UA 3MR0A 5U47A 1JVJA 2Y2OA 5G4YA 2PR6A 1CJFA 4FTXA 4NK3A 1W8YA 4OOYA 2ZMAA 2VZWA 4FSFA 3CPTB 4FOFA 4DDYA 3RXXA 3EGXC 4HP4A 5DJUA 1O07A 1PWCA 4UQIS 2IWBA 3IF6A 4WMCD 5IU1A 1WA9A 3V39A 2XF3A 5GLCA 1ES5A 3O5YA 5FQIA 3T4TA 3UDFA 3MS6A 5A8BA 2XH9A 1SDEA 2ZMVA 2L1MA 2ZC4B 5EVLA 4R3AA 4IUKA 5I5LA 1LL8A 3SZTA 4O8GA 1TS0A 2QZ6A 2QYBA 4KQRA 3UB5P 3MZEA 3CPTA 1YM1A 3NBLA 4KZ9A 2J3TD 4HQAA 2J9PA 3LGOA 3PBNA 2OLVA 3MBZA 1J9MA 3ZCZA 3ZG5A 2MJ6A 4GS9B 5EVIA 1S4SA 4HP9A 2R9WA 5G4ZA 5AVFA 3S7NA 1RP5A 3FYZA 3PTEA 4K0XA 3BW6A 2KX6A 4HJ6A 3JVVA 5L07A 1XX2A 1WYBA 1W63M 3QP4A 3HLCA 3VE3A 5EE8A 3IWIA 3ZYTA 1VETB 3WS0A 4F3LB 3VMAA 4B88A 5FI7A 3A3JA 1BLSA 4PM8A 3NDEA 1KE3A 1RGYA 1DJAA 3HLWA 3IH9A 4MNRA 4UQIM 1DP8A 4KENB 3ULFA 3ZQ5A 3SH7A 3FV7A 2XDMA 3WS1A 3T1XA 4Z1WA 1NXYA 1YAXA 5J4EA 2V2FF 5L09A 3FPVA 4KZ8A 4N1XA 4BBTA 1SCWA 1IOUA 1V9ZA 3NOUC 5EPHA 4KZ3A 4FD8A 4YFMA 1MKMA 4DE0A 1MXOA 3LYXA 1I2WA 2WGWB 2JHEA 3IQAA 5FQMA 1H8ZA 3LO7A 2A2LA 5M1AA 3H9WA 3LR0A 4UEYA 1X0OA 2Y91A 1PI5A 2JKTI 4JXGA 4O7DA 5HL6A 4GDNA 4R70A 3OC2A 4MBHA 3H82A 1BT5A 1LL9A 4E3IA 4EUZA 4BWIA 2WGWA 2J8YA 3A3IA 3BY9A 3DBAA 2VK3A 5HARA 4HOIA 3NI9A 2Q9MA 2PYPA 4H6JB 1YQSA 4JKTA 1CQAA 4LFUA 3BFCA 2WUQA 1PYYA 4S2IA 1UWNX 3ISGA 5DKLA 2A3UA 3A3DA 3BRMA 3JYIA 3GTCA 2QWSA 5J7EA 3S7PA 5CHJA 2KDKA 3LFVA 1KVMA 1LSWA 2BASA 4EETB 1FILA 4M3KA 3NHQA 2VKSA 1MPLA 1K56D 2VJWA 4B4XA 2HZ5A 4BJPA 3LIEA 4LENA 1VETA 4RQ9A 1NRJA 4K08A 4EQIA 5A90A 5CGWA 4G3KA 2HP5A 4GDBA 2GX5A 3EQUA 3HBRA 1BTLA 1ES2A 5AQAA 4ME4A 3SOIA 3KSIA 5EOOA 2Z2LB 4HEFA 3BEBA 4I5SA 3RFBA 2PRFA 4LCLA 3GVBA 3LI9A 1FIKA 3MZDA 5CGSA 4E3JA 2BG1A 5HDCA 2J3WA 3ZG0A 4X1MA 3PR6A 5DF9A 2INWA 2QHKA 2Y2GA 3KSFA 2XROA 1MWUA 1W79A 4EBPA 2HDQA 1H5XA 2M7UA 3SS5A 3WS5A 4BENA 5CRFA 4Q8IA 4U0TA 1Y54A 1TVFA 1SZVA 3VOLA 3C5AA 4ZJ1A 4L0LA 1NWZA 1VM1A 3CJMA 1AXBA 1SKFA 3C30A 4L9GA 5TFQA 3F1NA 3MFXA 2HV1A 3W2ZA 4KZ4A 4X25A 3F1OB 5E2HA 2WYXA 3V3RA 3PHYA 1FSWA 4M4XA 2ZBBA 3HLFA 2ZL1B 1WYCA 4OOLA 5A93A 2WZZA 3Q7VA 1ALQA 5FI6A 2EFUA 5HW3A 4ZJ3A 1L0DA 5F82A 5CERA 3UB7A 1Y28A 1G5UA 4E3OA 3T4JA 5FAQA 5GLAA 5L10A 4LCMA 2VGLS 1STZA 1S6RA 3UMDA 4HBUA 1LT0A 3N8RA 1G68A 2W3DA 1W63Q 2WZXA 4WM9A 1HLUP 2PD8A 2Y2QA 1K4FA 1YMSA 3UPPA 3LIAA 1CEFA 4P6ZS 2B18A 4X68A 4RYEA 1FR6A 2DNSA 1ZC2A 3VSLA 5AQ9A 1K38A 2W1TB 4WZ5A 5F69A 1TD5A 4D60A 4LV3A 2OLUA 3T4SA 3RJUA 2XEPA 4KQOA 1YKDA 4MDZA 1CI9A 1BSGA 3GV9A 4U0XA 5EM1A 2Y2HA 1K56A 3U2AA 5DFXA 1W8QA 3PAEA 3GR2A 3PAGA 3UE6A 4JPMA 4OP8A 1L0FA 3LICA 4ZDXA 1W7FA 4DXBA 3T50A 1XKZA 4DXCA 4IBXA 2JKGA 4NXFA 3T1QB 3VE4A 5FATA 3Q1FA 5DJTA 3MXQA 3N4IA 3GDIA 4JGRA 3TOIA 1K54C 3EWKA 1IELA 2W3EA 3T4LA 5GHZA 2OWHA 3C4PA 4R4RA 1K57A 1PWGA 3W4PA 2HP6A 1O7EA 2PYRA 2Y4AA 1YLTA 3H82B 4QPRA 1QMEA 2K2NA 5FEFA 4MBKA 3JPUA 2PT7A 4DN0A 3D3OA 1DP6A 2FZ0A 4EWFA 2XA7S 3G31A 2JC7A 3HJKA 3QNBA 3CLOA 2WGVA 3E2KA 3ZNYA 4LRYC 1KDSA 2ZC5B 3ITBA 3UDIA 4X53A 4G3VA 5EUAA 2JBFA 1XXMA 4PM6A 3SW1A 3FWLA 3NJAA 4EUVA 1XA1A 5HFOA 2NUTC 3UE0A 5AVEA 5FAPA 2WKQA 3IHBA 5CTNA 1IFQA 4Y3IA 5A92A 4II7A 3T12B 5M18A 3A0VA 4OQGA 3HLEA 1JWZA 4MCWA 3MKEA 3MQ0A 4MN5A 3IXHA 1ZG4A 2PAVP 3ZG8B 4XT2B 3DWKA
chains in the Genus database with same CATH topology
5EE8A 1GA0A 3IWIA 3WS0A 1C3BA 3VOYA 3TSGA 3FKWA 1IKGA 2QPNA 3VMAA 1U60A 1I2SA 1XGJA 2ZQDA 4JF4A 4B88A 4S2NA 3BLSA 4OLGA 1YLYA 3IXBA 3CMZA 3NC8A 4WMCA 5FI7A 1IYOA 1DJBA 3A3JA 4R0QA 1BLSA 4PM8A 3NDEA 5EVIC 4X6TA 3OPPA 3AGFA 1YMXA 5JYOA 4WZ4A 1FCOA 1KE3A 1RGYA 1DJAA 3HLWA 3IH9A 1OMEA 2X71A 3Q7ZA 4MNRA 5FQ9A 1ERMA 5TGFA 4GD8A 4KENB 3SH7A 3FV7A 1N9BA 4KG5A 4IVIA 2XDMA 3WS1A 1L0EA 1MKIA 1NXYA 4R1GA 1E3UA 4HESA 4KG6A 1TDGA 5A91A 5EECA 2V2FF 4KZ8A 1XGIA 1GHMA 4N1XA 1K54A 4LV2A 3ZVWA 3E2LA 1SCWA 2XFSA 2EX2A 3UO9A 5EPHA 2OSUA 5CHMA 2EXBA 4KZ3A 2PU2A 1NZOA 5CECA 4FD8A 2C6WB 3FZCA 3VP2A 5F83A 1K4EA 2ZC6B 4YFMA 2X02A 4NETA 4WEKA 3W8KA 1RGZA 3G30A 1YT4A 4C3QA 4DE0A 1MXOA 1FSYA 1XP4A 3IH8A 3VP0A 1I2WA 2WGWB 3IQAA 5FQMA 3V50A 3OZHA 1H8ZA 3LO7A 3IXGA 1TEMA 1PW1A 3PBOA 5M1AA 1KGGA 5E2EA 1LI0A 1YLPA 4C6YA 2DRWA 3CG5A 2Y91A 4GB7A 1PI5A 4JXGA 1K57C 4BD0A 5KSCA 3M6HA 4O7DA 2VGJA 2IWCA 3S4XA 4DDSA 4GDNA 3TG9A 4QD4A 4ZAMA 5G18A 3OC2A 1E25A 2J7VA 4MBHA 4OONA 4QB8A 4N9LA 1BUEA 4JXVA 2Y59A 4OLDA 3ZG7B 4B4ZA 1BT5A 4KZBA 1LL9A 1M6KA 4GZBA 1MWRA 2I72A 5AQ7A 4JXWA 4E3IA 4EUZA 3NDGA 2FFYA 2J8YA 2WGWA 3A3IA 1IYSA 1FR1A 4S2NC 5HAPA 4U3TA 5HARA 4RVAA 2Y2NA 2ZC7A 2XFTA 3NI9A 2XGNA 2Q9MA 1L0GA 3VFHA 1YQSA 5L2FA 2B5RA 4JKTA 4A5RA 4MEZA 4PPRA 4GN2A 4DE3A 2Y2JA 1HD8A 1K6SA 4F94A 2HPBA 3BFCA 4E6XA 3ZFZA 2HDSA 1PYYA 2WUQA 2Y2LA 4X56A 5GL9A 5IHVA 4E3MA 3N8SA 4R4SA 4WELA 4S2IA 2Y55A 3ISGA 2A3UA 1JTGA 3A3DA 3BRMA 3LY4A 1YLJA 4LV0A 1Q2QA 1E3UD 2ZM0A 3JYIA 2ZQ8A 3HL9A 1DY6A 3GTCA 5FI2A 1K25A 3VOZA 3VP1A 4IBRA 5KZHA 5CHJA 1LHYA 1S0WA 4KZ5A 1KVMA 1HTZA 4OH0A 1MWTA 4M3KA 1MPLA 3W4OA 3ZVTA 3HUOA 5FAOA 3VSKA 1K56D 2QMIA 3HVFA 4B4XA 1K6RA 3M2JA 5DTKA 1HVBA 4D2OA 1MWSA 2WKHA 1TDLA 3W4QA 4BJPA 4K0WA 3IHAA 4QY6A 3B3XA 3G32A 4E6WA 3EQVA 5CTMA 3BM6A 3HLBA 1IYQA 4LENA 3DWZA 3BFGA 4FH2A 1BLHA 2Y2PA 4P6BA 4UHUA 3PBSA 3IF6B 4EQIA 5A90A 4DKIA 2RL3A 2XD5A 3C7VA 5CGWA 5GHXA 2XQZA 3RXWA 3NY4A 5DTTA 5HAIA 2GDNA 1LLBA 2HP5A 4GDBA 2Y2IA 1G6AA 2ZM8A 4DE2A 2HDUA 4JF5A 3EQUA 4OVDA 4XXRA 4KZ6A 3A3EA 5CHUA 5M19A 2ZD8A 3HBRA 1BTLA 1ES2A 4WYYA 2G2UA 5AQAA 3SOIA 4Y7PA 1EROA 3SS3A 3WS2A 3N6IA 3BFDA 3MZFA 5AQBA 5EOOA 2HP9A 3UE1A 2Z2LB 3IWQA 2P74A 3OCLA 3MKFA 1HZOA 4HEFA 3BEBA 4PMAA 2ZQ9A 2WAEA 5DF8A 4LCLA 1BLCA 3GVBA 4FH4A 3Q07A 5F1FA 3WRTA 3Q82A 3BFEA 2H5SA 3MZDA 3MXSA 3PBTA 3MXRA 1M40A 2WAFA 5CGSA 4E3JA 2BG1A 3AGDA 4GD6A 3AGEA 3ZG0A 5DF9A 2R9XA 3V3SA 2CC1A 1KGFA 2Y2GA 1BULA 4UA9A 1MWUA 1W79A 1GCEA 4EBLA 4EBPA 2HDQA 3HUMA 1H5XA 4R3JA 3ZG9B 3GSGA 3SS5A 1YLWA 3IT9A 2WKIA 2ZQAA 3WS5A 4E3LA 4BENA 5CRFA 1IEMA 2EX8A 3N7WA 4Q8IA 4U0TA 3G34A 2Y2MA 3G4PA 1KVLA 4WBGA 4CPKA 1Y54A 2V1ZA 3SH8A 1TVFA 4P0MA 4XUZA 3C5AA 1MY8A 4ZJ1A 4L0LA 2Z2MB 3G35A 1VM1A 4KG2A 1ESUA 3CJMA 3BLMA 2Y2KA 3O88A 1GHPA 3HUNA 1AXBA 2A49A 3N8LA 1DJCA 1SKFA 5HX9A 3BECA 5TFQA 4OQ0A 4PM5A 3WWXA 2XLNA 3VP3A 1ES3A 3GQZA 4KZ4A 1BZAA 5E2HA 2WYXA 3V3RA 4BLMA 4ZJ2A 4E3KA 1FSWA 3IF6C 4DRTA 1IKIA 1ESIA 1LI9A 3GRJA 3QNCA 3SH9A 3HLFA 4RX2A 3M2KA 4P87A 4E3NA 4X55A 1I5QA 2ZQCA 1ONHA 1BLPA 2PBYA 5FQJA 1WYCA 2ZJ9A 3DW0A 3I7JA 4OOLA 1NY0A 5A93A 1KE4A 2WZZA 3Q7VA 4KZ7A 1ALQA 5FI6A 4RA7A 1WE4A 3OPRA 4BD1A 2EFUA 4GNUA 4P85A 4X69A 5HW3A 4ZJ3A 3ZNTA 1L0DA 4LV1A 5F82A 5FSRA 3IXDA 5CERA 3IWOA 2E8IA 2EX9A 5I94A 5GHYA 5KSHA 1PZOA 5HL1A 5DTSA 1CEGA 1MBLA 3S1YA 1EI5A 4PM7A 2EFXA 3CZDA 4OPZA 2V20A 5E2FA 4GOGA 3VP4A 4E3OA 4KQQA 5FAQA 5TR7A 5GLAA 2JE5A 4LCMA 4OKPA 1GA9A 4BL2A 1S6RA 4HBUA 5CEDA 2IWDA 3N8RA 4HBTA 4JXSA 1G68A 1SHVA 3C7UA 4N92A 5E43A 4DE1A 3PBRA 3ITAA 1SDNA 2FFFB 3UE3A 4QU3A 1KGEA 4FCFA 2WZXA 1PIOA 4WM9A 4JF6A 4IVKA 1ZG6A 5EOEA 2XD1A 3S22A 1FOFA 1N4OA 4H8RA 5E2GA 5JYPA 1EWZA 4PM9A 4KZAA 5GLDA 4ZBEA 5DF7A 4N9KA 1YLZA 2Y2QA 1VQQA 1K4FA 1CI8A 1YMSA 2ZQ7A 3UPPA 4EV4A 1PW8A 2H10A 3DTMA 3M6BA 3A3FA 1NZUA 5FDHA 1CEFA 4OQHA 5J8XA 1K55C 4X68A 4RYEA 1W5DA 2XK1A 1FR6A 4Z9QA 2DNSA 4N1HA 1ZC2A 4ZTKA 3VSLA 4IEDA 5AQ9A 1K38A 4JBFA 4OQIA 4WZ5A 3UN7A 4XUXA 4Y0OA 4OP5A 3O3VA 4LV3A 2X01A 2OLUA 3RJUA 1E4DA 4S2KA 4QY5A 3BYDA 2XEPA 2HDRA 2ZM2A 5FQKA 4KQOA 3UDXA 1CI9A 3BFFA 3IF5A 3LY3A 4QJGA 1BSGA 3GV9A 4MBFA 4U0XA 3SS4A 5F1GA 5BOHA 5GLBA 2Y2HA 1ES4A 1K56A 4RX3A 2H0YA 5CXWA 4CJNA 2H0TA 2WADA 4OPRA 1W8QA 5CGXA 2ZLYA 4BQMA 3PAEA 4MLLA 2Q9NA 2P9VA 2WGIA 1GHIA 3GR2A 3MFDA 3P98A 3PAGA 5FQQA 1NRFA 1JTDA 1ERQA 1FCMA 4JPMA 4OP8A 5KMWA 1L0FA 4UA6A 4ZDXA 3HLDA 1W7FA 4DXBA 1XKZA 2RCXA 4DXCA 2WK0A 1NJ4A 4C75A 4IBXA 4WZ5C 3WS4A 3WRZA 3PBQA 4S2LA 5DVAA 5EVIB 3G2ZA 1XPBA 4Y0UA 4S2JA 2VGKA 5FATA 3Q1FA 2PU4A 4QHCA 2UWXA 5U47A 1JVJA 1FQGA 3G2YA 3D4FA 3VFFA 2Y2OA 2P9VB 3N4IA 3HLGA 4NK3A 1W8YA 3UY6A 4JLFA 2ZMAA 4OOYA 3TOIA 1K54C 4R23A 5FASA 1PZPA 5CEBA 4FSFA 1IELA 4DDYA 3RXXA 5GHZA 1ZKJA 3C4PA 4R4RA 1O07A 5D3OA 3UPOA 3NIAA 4OOMA 1PWCA 3LEZA 4S2MA 1PWDA 1K57A 3C4OA 4OPYA 1Q2PA 4BL3A 1PWGA 2IWBA 3W4PA 1KE0A 4S2OA 3O86A 3IF6A 4WMCD 4UAAA 2HP6A 1O7EA 2XF3A 3V39A 2Y4AA 1FCNA 1PI4A 1YLTA 3OPHA 1K55A 1ES5A 4S2PA 5GLCA 1KDWA 1QMEA 3QHYA 5FQIA 4MBKA 3UDFA 1H8YA 4DF6A 1QMFA 1RCJA 2EX6A 2XH9A 4ID4A 1SDEA 3UPNA 2ZC4B 2EXAA 5EVLA 4EWFA 4OPQA 1NYYA 2JC7A 3G31A 3QNBA 1NYMA 4K91A 2J9OA 4Y0TA 2C5WB 3HREA 3ZHHA 3NCKA 2WGVA 3E2KA 3ZNYA 1KDSA 2ZC5B 2BLSA 3ITBA 2QZ6A 2OV5A 4KQRA 3UDIA 1L2SA 4X53A 5EVID 3MZEA 3V5MA 1Z6FA 1YM1A 3P09A 3UNWA 4UA7A 3NBLA 2JBFA 1XXMA 5EUAA 3LCEA 4PM6A 1ONGA 2JCHA 4KZ9A 1IYPA 3OCNA 2J9PA 2XR0A 3FWLA 3PBNA 1CK3A 4YINA 1XA1A 4GKUA 5HFOA 3ZGAB 2OLVA 3MBZA 4EBNA 3UE0A 1J9MA 3ZCZA 3ZG5A 3GMWA 2DCFA 5FAPA 3IHBA 1JWPA 5EVIA 3Q81A 5CTNA 2WKEA 3Q7VB 1JWVA 2R9WA 5A92A 2G2WA 5M18A 4OQGA 3FKVA 3HLEA 4WEJA 1RP5A 3FYZA 3PTEA 4K0XA 1JWZA 5HAQA 3ZDJA 1LL5A 3MKEA 2ZC3B 3OPLA 3IXHA 1ZG4A 1XX2A 4R3BA 1WYBA 1XA7A 3O87A 3HLCA 3ZG8B 3DWKA 5FA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EE8 A;  1GA0 A;  3IWI A;  3WS0 A;  1C3B A;  3VOY A;  3TSG A;  3FKW A;  1IKG A;  2QPN A;  3VMA A;  1U60 A;  1I2S A;  1XGJ A;  2ZQD A;  4JF4 A;  4B88 A;  4S2N A;  3BLS A;  4OLG A;  1YLY A;  3IXB A;  3CMZ A;  3NC8 A;  4WMC A;  5FI7 A;  1IYO A;  1DJB A;  3A3J A;  4R0Q A;  1BLS A;  4PM8 A;  3NDE A;  5EVI C;  4X6T A;  3OPP A;  3AGF A;  1YMX A;  5JYO A;  4WZ4 A;  1FCO A;  1KE3 A;  1RGY A;  1DJA A;  3HLW A;  3IH9 A;  1OME A;  2X71 A;  3Q7Z A;  4MNR A;  5FQ9 A;  1ERM A;  5TGF A;  4GD8 A;  4KEN B;  3SH7 A;  3FV7 A;  1N9B A;  4KG5 A;  4IVI A;  2XDM A;  3WS1 A;  1L0E A;  1MKI A;  1NXY A;  4R1G A;  1E3U A;  4HES A;  4KG6 A;  1TDG A;  5A91 A;  5EEC A;  2V2F F;  4KZ8 A;  1XGI A;  1GHM A;  4N1X A;  1K54 A;  4LV2 A;  3ZVW A;  3E2L A;  1SCW A;  2XFS A;  2EX2 A;  3UO9 A;  5EPH A;  2OSU A;  5CHM A;  2EXB A;  4KZ3 A;  2PU2 A;  1NZO A;  5CEC A;  4FD8 A;  2C6W B;  3FZC A;  3VP2 A;  5F83 A;  1K4E A;  2ZC6 B;  4YFM A;  2X02 A;  4NET A;  4WEK A;  3W8K A;  1RGZ A;  3G30 A;  1YT4 A;  4C3Q A;  4DE0 A;  1MXO A;  1FSY A;  1XP4 A;  3IH8 A;  3VP0 A;  1I2W A;  2WGW B;  3IQA A;  5FQM A;  3V50 A;  3OZH A;  1H8Z A;  3LO7 A;  3IXG A;  1TEM A;  1PW1 A;  3PBO A;  5M1A A;  1KGG A;  5E2E A;  1LI0 A;  1YLP A;  4C6Y A;  2DRW A;  3CG5 A;  2Y91 A;  4GB7 A;  1PI5 A;  4JXG A;  1K57 C;  4BD0 A;  5KSC A;  3M6H A;  4O7D A;  2VGJ A;  2IWC A;  3S4X A;  4DDS A;  4GDN A;  3TG9 A;  4QD4 A;  4ZAM A;  5G18 A;  3OC2 A;  1E25 A;  2J7V A;  4MBH A;  4OON A;  4QB8 A;  4N9L A;  1BUE A;  4JXV A;  2Y59 A;  4OLD A;  3ZG7 B;  4B4Z A;  1BT5 A;  4KZB A;  1LL9 A;  1M6K A;  4GZB A;  1MWR A;  2I72 A;  5AQ7 A;  4JXW A;  4E3I A;  4EUZ A;  3NDG A;  2FFY A;  2J8Y A;  2WGW A;  3A3I A;  1IYS A;  1FR1 A;  4S2N C;  5HAP A;  4U3T A;  5HAR A;  4RVA A;  2Y2N A;  2ZC7 A;  2XFT A;  3NI9 A;  2XGN A;  2Q9M A;  1L0G A;  3VFH A;  1YQS A;  5L2F A;  2B5R A;  4JKT A;  4A5R A;  4MEZ A;  4PPR A;  4GN2 A;  4DE3 A;  2Y2J A;  1HD8 A;  1K6S A;  4F94 A;  2HPB A;  3BFC A;  4E6X A;  3ZFZ A;  2HDS A;  1PYY A;  2WUQ A;  2Y2L A;  4X56 A;  5GL9 A;  5IHV A;  4E3M A;  3N8S A;  4R4S A;  4WEL A;  4S2I A;  2Y55 A;  3ISG A;  2A3U A;  1JTG A;  3A3D A;  3BRM A;  3LY4 A;  1YLJ A;  4LV0 A;  1Q2Q A;  1E3U D;  2ZM0 A;  3JYI A;  2ZQ8 A;  3HL9 A;  1DY6 A;  3GTC A;  5FI2 A;  1K25 A;  3VOZ A;  3VP1 A;  4IBR A;  5KZH A;  5CHJ A;  1LHY A;  1S0W A;  4KZ5 A;  1KVM A;  1HTZ A;  4OH0 A;  1MWT A;  4M3K A;  1MPL A;  3W4O A;  3ZVT A;  3HUO A;  5FAO A;  3VSK A;  1K56 D;  2QMI A;  3HVF A;  4B4X A;  1K6R A;  3M2J A;  5DTK A;  1HVB A;  4D2O A;  1MWS A;  2WKH A;  1TDL A;  3W4Q A;  4BJP A;  4K0W A;  3IHA A;  4QY6 A;  3B3X A;  3G32 A;  4E6W A;  3EQV A;  5CTM A;  3BM6 A;  3HLB A;  1IYQ A;  4LEN A;  3DWZ A;  3BFG A;  4FH2 A;  1BLH A;  2Y2P A;  4P6B A;  4UHU A;  3PBS A;  3IF6 B;  4EQI A;  5A90 A;  4DKI A;  2RL3 A;  2XD5 A;  3C7V A;  5CGW A;  5GHX A;  2XQZ A;  3RXW A;  3NY4 A;  5DTT A;  5HAI A;  2GDN A;  1LLB A;  2HP5 A;  4GDB A;  2Y2I A;  1G6A A;  2ZM8 A;  4DE2 A;  2HDU A;  4JF5 A;  3EQU A;  4OVD A;  4XXR A;  4KZ6 A;  3A3E A;  5CHU A;  5M19 A;  2ZD8 A;  3HBR A;  1BTL A;  1ES2 A;  4WYY A;  2G2U A;  5AQA A;  3SOI A;  4Y7P A;  1ERO A;  3SS3 A;  3WS2 A;  3N6I A;  3BFD A;  3MZF A;  5AQB A;  5EOO A;  2HP9 A;  3UE1 A;  2Z2L B;  3IWQ A;  2P74 A;  3OCL A;  3MKF A;  1HZO A;  4HEF A;  3BEB A;  4PMA A;  2ZQ9 A;  2WAE A;  5DF8 A;  4LCL A;  1BLC A;  3GVB A;  4FH4 A;  3Q07 A;  5F1F A;  3WRT A;  3Q82 A;  3BFE A;  2H5S A;  3MZD A;  3MXS A;  3PBT A;  3MXR A;  1M40 A;  2WAF A;  5CGS A;  4E3J A;  2BG1 A;  3AGD A;  4GD6 A;  3AGE A;  3ZG0 A;  5DF9 A;  2R9X A;  3V3S A;  2CC1 A;  1KGF A;  2Y2G A;  1BUL A;  4UA9 A;  1MWU A;  1W79 A;  1GCE A;  4EBL A;  4EBP A;  2HDQ A;  3HUM A;  1H5X A;  4R3J A;  3ZG9 B;  3GSG A;  3SS5 A;  1YLW A;  3IT9 A;  2WKI A;  2ZQA A;  3WS5 A;  4E3L A;  4BEN A;  5CRF A;  1IEM A;  2EX8 A;  3N7W A;  4Q8I A;  4U0T A;  3G34 A;  2Y2M A;  3G4P A;  1KVL A;  4WBG A;  4CPK A;  1Y54 A;  2V1Z A;  3SH8 A;  1TVF A;  4P0M A;  4XUZ A;  3C5A A;  1MY8 A;  4ZJ1 A;  4L0L A;  2Z2M B;  3G35 A;  1VM1 A;  4KG2 A;  1ESU A;  3CJM A;  3BLM A;  2Y2K A;  3O88 A;  1GHP A;  3HUN A;  1AXB A;  2A49 A;  3N8L A;  1DJC A;  1SKF A;  5HX9 A;  3BEC A;  5TFQ A;  4OQ0 A;  4PM5 A;  3WWX A;  2XLN A;  3VP3 A;  1ES3 A;  3GQZ A;  4KZ4 A;  1BZA A;  5E2H A;  2WYX A;  3V3R A;  4BLM A;  4ZJ2 A;  4E3K A;  1FSW A;  3IF6 C;  4DRT A;  1IKI A;  1ESI A;  1LI9 A;  3GRJ A;  3QNC A;  3SH9 A;  3HLF A;  4RX2 A;  3M2K A;  4P87 A;  4E3N A;  4X55 A;  1I5Q A;  2ZQC A;  1ONH A;  1BLP A;  2PBY A;  5FQJ A;  1WYC A;  2ZJ9 A;  3DW0 A;  3I7J A;  4OOL A;  1NY0 A;  5A93 A;  1KE4 A;  2WZZ A;  3Q7V A;  4KZ7 A;  1ALQ A;  5FI6 A;  4RA7 A;  1WE4 A;  3OPR A;  4BD1 A;  2EFU A;  4GNU A;  4P85 A;  4X69 A;  5HW3 A;  4ZJ3 A;  3ZNT A;  1L0D A;  4LV1 A;  5F82 A;  5FSR A;  3IXD A;  5CER A;  3IWO A;  2E8I A;  2EX9 A;  5I94 A;  5GHY A;  5KSH A;  1PZO A;  5HL1 A;  5DTS A;  1CEG A;  1MBL A;  3S1Y A;  1EI5 A;  4PM7 A;  2EFX A;  3CZD A;  4OPZ A;  2V20 A;  5E2F A;  4GOG A;  3VP4 A;  4E3O A;  4KQQ A;  5FAQ A;  5TR7 A;  5GLA A;  2JE5 A;  4LCM A;  4OKP A;  1GA9 A;  4BL2 A;  1S6R A;  4HBU A;  5CED A;  2IWD A;  3N8R A;  4HBT A;  4JXS A;  1G68 A;  1SHV A;  3C7U A;  4N92 A;  5E43 A;  4DE1 A;  3PBR A;  3ITA A;  1SDN A;  2FFF B;  3UE3 A;  4QU3 A;  1KGE A;  4FCF A;  2WZX A;  1PIO A;  4WM9 A;  4JF6 A;  4IVK A;  1ZG6 A;  5EOE A;  2XD1 A;  3S22 A;  1FOF A;  1N4O A;  4H8R A;  5E2G A;  5JYP A;  1EWZ A;  4PM9 A;  4KZA A;  5GLD A;  4ZBE A;  5DF7 A;  4N9K A;  1YLZ A;  2Y2Q A;  1VQQ A;  1K4F A;  1CI8 A;  1YMS A;  2ZQ7 A;  3UPP A;  4EV4 A;  1PW8 A;  2H10 A;  3DTM A;  3M6B A;  3A3F A;  1NZU A;  5FDH A;  1CEF A;  4OQH A;  5J8X A;  1K55 C;  4X68 A;  4RYE A;  1W5D A;  2XK1 A;  1FR6 A;  4Z9Q A;  2DNS A;  4N1H A;  1ZC2 A;  4ZTK A;  3VSL A;  4IED A;  5AQ9 A;  1K38 A;  4JBF A;  4OQI A;  4WZ5 A;  3UN7 A;  4XUX A;  4Y0O A;  4OP5 A;  3O3V A;  4LV3 A;  2X01 A;  2OLU A;  3RJU A;  1E4D A;  4S2K A;  4QY5 A;  3BYD A;  2XEP A;  2HDR A;  2ZM2 A;  5FQK A;  4KQO A;  3UDX A;  1CI9 A;  3BFF A;  3IF5 A;  3LY3 A;  4QJG A;  1BSG A;  3GV9 A;  4MBF A;  4U0X A;  3SS4 A;  5F1G A;  5BOH A;  5GLB A;  2Y2H A;  1ES4 A;  1K56 A;  4RX3 A;  2H0Y A;  5CXW A;  4CJN A;  2H0T A;  2WAD A;  4OPR A;  1W8Q A;  5CGX A;  2ZLY A;  4BQM A;  3PAE A;  4MLL A;  2Q9N A;  2P9V A;  2WGI A;  1GHI A;  3GR2 A;  3MFD A;  3P98 A;  3PAG A;  5FQQ A;  1NRF A;  1JTD A;  1ERQ A;  1FCM A;  4JPM A;  4OP8 A;  5KMW A;  1L0F A;  4UA6 A;  4ZDX A;  3HLD A;  1W7F A;  4DXB A;  1XKZ A;  2RCX A;  4DXC A;  2WK0 A;  1NJ4 A;  4C75 A;  4IBX A;  4WZ5 C;  3WS4 A;  3WRZ A;  3PBQ A;  4S2L A;  5DVA A;  5EVI B;  3G2Z A;  1XPB A;  4Y0U A;  4S2J A;  2VGK A;  5FAT A;  3Q1F A;  2PU4 A;  4QHC A;  2UWX A;  5U47 A;  1JVJ A;  1FQG A;  3G2Y A;  3D4F A;  3VFF A;  2Y2O A;  2P9V B;  3N4I A;  3HLG A;  4NK3 A;  1W8Y A;  3UY6 A;  4JLF A;  2ZMA A;  4OOY A;  3TOI A;  1K54 C;  4R23 A;  5FAS A;  1PZP A;  5CEB A;  4FSF A;  1IEL A;  4DDY A;  3RXX A;  5GHZ A;  1ZKJ A;  3C4P A;  4R4R A;  1O07 A;  5D3O A;  3UPO A;  3NIA A;  4OOM A;  1PWC A;  3LEZ A;  4S2M A;  1PWD A;  1K57 A;  3C4O A;  4OPY A;  1Q2P A;  4BL3 A;  1PWG A;  2IWB A;  3W4P A;  1KE0 A;  4S2O A;  3O86 A;  3IF6 A;  4WMC D;  4UAA A;  2HP6 A;  1O7E A;  2XF3 A;  3V39 A;  2Y4A A;  1FCN A;  1PI4 A;  1YLT A;  3OPH A;  1K55 A;  1ES5 A;  4S2P A;  5GLC A;  1KDW A;  1QME A;  3QHY A;  5FQI A;  4MBK A;  3UDF A;  1H8Y A;  4DF6 A;  1QMF A;  1RCJ A;  2EX6 A;  2XH9 A;  4ID4 A;  1SDE A;  3UPN A;  2ZC4 B;  2EXA A;  5EVL A;  4EWF A;  4OPQ A;  1NYY A;  2JC7 A;  3G31 A;  3QNB A;  1NYM A;  4K91 A;  2J9O A;  4Y0T A;  2C5W B;  3HRE A;  3ZHH A;  3NCK A;  2WGV A;  3E2K A;  3ZNY A;  1KDS A;  2ZC5 B;  2BLS A;  3ITB A;  2QZ6 A;  2OV5 A;  4KQR A;  3UDI A;  1L2S A;  4X53 A;  5EVI D;  3MZE A;  3V5M A;  1Z6F A;  1YM1 A;  3P09 A;  3UNW A;  4UA7 A;  3NBL A;  2JBF A;  1XXM A;  5EUA A;  3LCE A;  4PM6 A;  1ONG A;  2JCH A;  4KZ9 A;  1IYP A;  3OCN A;  2J9P A;  2XR0 A;  3FWL A;  3PBN A;  1CK3 A;  4YIN A;  1XA1 A;  4GKU A;  5HFO A;  3ZGA B;  2OLV A;  3MBZ A;  4EBN A;  3UE0 A;  1J9M A;  3ZCZ A;  3ZG5 A;  3GMW A;  2DCF A;  5FAP A;  3IHB A;  1JWP A;  5EVI A;  3Q81 A;  5CTN A;  2WKE A;  3Q7V B;  1JWV A;  2R9W A;  5A92 A;  2G2W A;  5M18 A;  4OQG A;  3FKV A;  3HLE A;  4WEJ A;  1RP5 A;  3FYZ A;  3PTE A;  4K0X A;  1JWZ A;  5HAQ A;  3ZDJ A;  1LL5 A;  3MKE A;  2ZC3 B;  3OPL A;  3IXH A;  1ZG4 A;  1XX2 A;  4R3B A;  1WYB A;  1XA7 A;  3O87 A;  3HLC A;  3ZG8 B;  3DWK A;  5FA7 A; 
#chains in the Genus database with same CATH topology
 3CWF A;  2NUP C;  3K3C A;  3B33 A;  1XGJ A;  2AVX A;  4IUH A;  4LRX C;  3LUQ A;  4WMC A;  1TS7 A;  1XJ6 A;  1JNU A;  4FUW A;  3F1O A;  4WZ4 A;  2X71 A;  5FQ9 A;  1ERM A;  2HJ9 C;  3QP8 A;  2KLI A;  3F1N B;  4GD8 A;  4HIA A;  4KG5 A;  4IVI A;  1OTB A;  3MSH A;  4HES A;  4KG6 A;  2ZOI A;  2XRN A;  5EEC A;  1GHM A;  4LV2 A;  3ZVW A;  3E2L A;  4JGP A;  2EX2 A;  3CUE A;  2OSU A;  5CHM A;  2EXB A;  2PU2 A;  3BY8 A;  3JVU A;  3LIB A;  5F83 A;  1K4E A;  3G6O A;  3W8K A;  1RGZ A;  3E4Q A;  1YT4 A;  4C3Q A;  1FSY A;  2ZMF A;  2JKT M;  2O0Y A;  5TJJ A;  3OZH A;  1KGG A;  2Q0O A;  2DRW A;  3CG5 A;  4GB7 A;  2Y79 A;  3BQ8 A;  3M6H A;  2IWC A;  3TG9 A;  4QD4 A;  5G18 A;  1E25 A;  4N9L A;  4B4Z A;  1M6K A;  4GZB A;  1MWR A;  2I72 A;  4JXW A;  3MQQ A;  4RVA A;  4IJG A;  2ZC7 A;  4WL9 A;  2XGN A;  3T4Q A;  1NLZ A;  5L2F A;  2B5R A;  4QWO A;  5FL3 A;  2Y2J A;  1K6S A;  4R38 A;  2Y2L A;  1G28 A;  4WEL A;  3FG8 A;  3QP5 A;  1JTG A;  3LY4 A;  5L8M A;  2LB9 A;  2ZQ8 A;  3HL9 A;  1DY6 A;  4G3W A;  5FI2 A;  1LHY A;  1S0W A;  3T4O A;  1MWT A;  3NOT C;  3ZVT A;  3RTY A;  2QMI A;  3HVF A;  1K6R A;  2Z6D A;  1TDL A;  3W4Q A;  2G7U A;  3IHA A;  4NXE A;  3B3X A;  4HH2 A;  3BM6 A;  1A0K A;  3DWZ A;  3R7W B;  3BFG A;  2Y2P A;  2O9B A;  3KSG A;  3VV4 A;  4DKI A;  2DMW A;  2RL3 A;  2QKP A;  4KUO A;  3A0R A;  3KYQ A;  3H7W B;  1H3Q A;  1YSQ A;  3A3E A;  4B93 A;  1ERO A;  3UE1 A;  3MZF A;  5AQB A;  4ZRR A;  3MKF A;  2ZQ9 A;  1BLC A;  3EGD C;  3WRT A;  3Q82 A;  3BFE A;  3MXS A;  4NXG A;  2WAF A;  4H6J A;  2VV8 A;  1BUL A;  1MZU A;  4UA9 A;  1GCE A;  4O01 A;  3HUM A;  4R3J A;  3GSG A;  3KSH A;  4E3L A;  1IEM A;  2Y8H A;  3G34 A;  2JKR M;  2Y2M A;  3G4P A;  1H0M A;  3FPW A;  2EA9 A;  4PHT A;  4ETZ A;  2H28 A;  3G35 A;  3MMH A;  5J3W A;  3HUN A;  3N8L A;  5HX9 A;  4OQ0 A;  3WWX A;  3TE8 A;  3GQZ A;  4HNB A;  3HCY A;  1AWI A;  1GSX A;  2V8C A;  4GLQ A;  2V1A A;  4KQD A;  4DRT A;  4P6Z M;  1H8M A;  5TBM B;  4X55 A;  3ICY A;  1ONH A;  3E4P A;  3DW0 A;  3DTI A;  1KE4 A;  1T19 A;  4RA7 A;  4BD1 A;  1N9O A;  1OTE A;  3ZNT A;  1L3L A;  4JGO A;  5GHY A;  5HL1 A;  4JGQ A;  4XT2 A;  2W0N A;  4OPZ A;  2V20 A;  2VEA A;  1LSV A;  4R6L A;  1PFL A;  2JE5 A;  4BL2 A;  4E04 A;  5K5B A;  5CED A;  2IWD A;  1P9R A;  4JXS A;  4N92 A;  2FFF B;  4QU3 A;  3DTK A;  2XD1 A;  3IX3 A;  5JYP A;  4H8R A;  4HH3 A;  5E2G A;  5GLD A;  4KZA A;  4ZBE A;  5DF7 A;  4N9K A;  1YLZ A;  1CI8 A;  1PW8 A;  3DTM A;  4O0P A;  4GS9 A;  4OQH A;  3CI6 A;  2JN7 A;  4Z9Q A;  4IED A;  3UN7 A;  5EVE A;  4OP5 A;  2X01 A;  5DFY A;  3LR4 A;  1OTA A;  2O99 A;  4S2K A;  4QY5 A;  4CLC B;  4CLC C;  4Y13 A;  4MBF A;  3SS4 A;  5GLB A;  1ZTU A;  2W27 A;  1ES4 A;  3K3D A;  1NRF A;  4BBU A;  1ERQ A;  1FCM A;  3B47 A;  2W1R A;  3HLD A;  3B42 A;  4HHD A;  3WRZ A;  3PBQ A;  4S2L A;  2VGK A;  4QHC A;  2UWX A;  3G2Y A;  1FQG A;  3D4F A;  2P9V B;  5LBR A;  3HLG A;  2M7V A;  4JLF A;  4R23 A;  1PZP A;  3H7W A;  4GW9 A;  2PD7 A;  1ZKJ A;  2P08 A;  3UPO A;  3NIA A;  4OOM A;  3LEZ A;  2QJ7 A;  1PWD A;  4BL3 A;  2GJ3 A;  3NUL A;  3O86 A;  4UAA A;  3TRC A;  1PI4 A;  3OPH A;  1K55 A;  5EV0 A;  3LI8 A;  2E8J A;  1ODV A;  1QMF A;  4Y15 A;  4ID4 A;  3UPN A;  2EXA A;  4MMN A;  1NYY A;  4K91 A;  1SKO B;  2J9O A;  4Y0T A;  2C5W B;  3HRE A;  4MN6 A;  1SKO A;  3P09 A;  4UA7 A;  3LCE A;  1IYP A;  2XR0 A;  4L9E A;  4EU0 A;  1CK3 A;  1UGU A;  3LIF A;  4YIN A;  4HJ4 A;  4EBN A;  2KOI A;  1T1C A;  3GMW A;  2DCF A;  3Q81 A;  2WKE A;  3Q7V B;  3MJQ A;  2VGL M;  1GSV A;  4WEJ A;  5HWW A;  5HAQ A;  3ZDJ A;  1LL5 A;  3OPL A;  4WUJ A;  2XSS A;  4R3B A;  4DJ3 A;  4NG2 A;  2VV7 A;  5FA7 A;  4I39 A;  2D02 A;  2QPN A;  1U60 A;  1I2S A;  2ZQD A;  4S2N A;  3BLS A;  4OLG A;  3IXB A;  3CMZ A;  1IYO A;  1DJB A;  4R0Q A;  4WLA A;  5EVI C;  4X6T A;  1YMX A;  5JYO A;  1FCO A;  3Q7Z A;  5TGF A;  4IHQ A;  3C8C A;  1OTD A;  1N9B A;  1L0E A;  5A91 A;  1XGI A;  3D72 A;  3RH8 B;  3OBF A;  3UO9 A;  3C38 A;  3EEA A;  1NZO A;  4PAU A;  4GCZ A;  2X02 A;  3NOP C;  3G30 A;  3HJI A;  1TEM A;  3PBO A;  1T1B A;  3P01 A;  5E2E A;  3BQA A;  1YLP A;  4C6Y A;  5IT5 A;  1P9W A;  1K57 C;  4BD0 A;  2VGJ A;  4DDS A;  1F2K A;  3UB8 A;  4ZAM A;  2HJE A;  2J7V A;  5F68 A;  4QB8 A;  4KZB A;  2HGV A;  1S1Z A;  1BYW A;  4PKY A;  4LRZ E;  1G6O A;  5HAP A;  4U3T A;  2XFT A;  3KO6 A;  5TBM A;  4A5R A;  1XFQ A;  4F94 A;  2HPB A;  5CEB A;  4E6X A;  5IHV A;  4X56 A;  5GL9 A;  3N8S A;  4R4S A;  4EQ1 A;  2Y55 A;  2K7S A;  1YLJ A;  4LV0 A;  5EFW A;  1Q2Q A;  1E3U D;  1EW0 A;  1K25 A;  3VOZ A;  3VP1 A;  5KZH A;  4DJ2 A;  3E0Y A;  4KZ5 A;  1HTZ A;  2B95 A;  3W4O A;  3PYP A;  3UB9 A;  1S4R A;  3VSK A;  4D2O A;  5DTK A;  2R78 A;  1MWS A;  2WKH A;  1OJ5 A;  4I3I A;  4K0W A;  4QY6 A;  1F5M A;  2LB5 A;  4E6W A;  3EQV A;  3HLB A;  1IYQ A;  2GZA A;  4DMZ A;  3C2W A;  3IS2 B;  2PDR A;  3LR5 A;  4UHU A;  3PBS A;  1Z09 A;  3TJZ C;  2XD5 A;  1KOU A;  3IBJ A;  3C7V A;  1VB6 A;  5HD3 A;  2XQZ A;  5HAI A;  5DTT A;  2GDN A;  1LLB A;  1G6A A;  1TF1 A;  4JF5 A;  4OVD A;  4KZ6 A;  4WYY A;  3SS3 A;  3WS2 A;  3N6I A;  2HP9 A;  3CHW P;  3IWQ A;  2P74 A;  1LSX A;  3OCL A;  4PMA A;  2WAE A;  5DF8 A;  3Q07 A;  3PBT A;  3L7H A;  3MXR A;  4ESP A;  3IX4 A;  4YWZ A;  4GD6 A;  3AGE A;  1T1A A;  2R9X A;  3V3S A;  1KGF A;  3LEQ A;  1F9I A;  3ZG9 B;  1YLW A;  3IT9 A;  2WKI A;  2PR5 A;  2ZQA A;  4YOF A;  2EX8 A;  4CPK A;  2V1Z A;  3SH8 A;  4P0M A;  1OT6 A;  2Z2M B;  2P04 A;  1ESU A;  4WN5 A;  4ARZ B;  1DJC A;  1D7E A;  2VX8 A;  3R7W A;  3VP3 A;  1BZA A;  4BLM A;  2OAQ 1;  4NEE D;  1OJG A;  1IKI A;  1LI9 A;  4B9O A;  4RX2 A;  2ZQC A;  3I7J A;  1Y4O A;  4Y5F A;  1XJ4 A;  1ACF A;  4KZ7 A;  3OPR A;  1N9N A;  4P85 A;  5FDS A;  4Q0J A;  3K2N A;  5FSR A;  5HPF A;  2E8I A;  2EX9 A;  4F3L A;  5KSH A;  2V8F A;  1XFN A;  1MBL A;  2PHY A;  4KQQ A;  5TR7 A;  5MC7 A;  2O9C A;  4OKP A;  1GA9 A;  2JKF A;  2EWW A;  3DAV A;  1SDN A;  3OLO A;  1KGE A;  4FCF A;  2OAP 1;  4IVK A;  4EEU A;  1FOF A;  1N4O A;  1XJ3 A;  1VQQ A;  2H10 A;  1NZU A;  1N9L A;  4GHI B;  2XK1 A;  3T1R A;  4N1H A;  3U4L P;  2BTF P;  4OQI A;  1DRM A;  4XUX A;  1NLY A;  1ZHH B;  1UWP X;  5HWT A;  1E4D A;  3BYD A;  2HDR A;  2P7J A;  3CAX A;  3UDX A;  3DTE A;  3BFF A;  3IF5 A;  3LY3 A;  5FEG A;  5BOH A;  3BJN A;  4E3M A;  4RX3 A;  2H0Y A;  5CXW A;  4CJN A;  2H0T A;  2WAD A;  2ZLY A;  3IBR A;  2L0W A;  2WGI A;  5FQQ A;  2QJ5 A;  3A0S A;  1JTD A;  2V0U A;  4UA6 A;  4WZ5 C;  3T1S A;  5DVA A;  3G2Z A;  1OPX A;  2ACG A;  4S2J A;  4EER A;  3KX0 X;  2PU4 A;  3VFF A;  4CQH A;  3UY6 A;  5FAS A;  1VEU B;  1MC0 A;  2HF6 A;  5D3O A;  4X1L A;  4S2M A;  3C4O A;  2VLG A;  4OPY A;  1Q2P A;  1KE0 A;  4S2O A;  1XJ2 A;  3L9K A;  1P97 A;  1FCN A;  4S2P A;  1KDW A;  3QHY A;  2FH5 A;  4ETX A;  1H8Y A;  4DF6 A;  4I3A A;  1RCJ A;  2EX6 A;  4GHI A;  3EOI A;  4OPQ A;  4EES A;  4YNR A;  1NYM A;  4EW7 A;  3ZHH A;  3NCK A;  4Q0I A;  2BLS A;  2OV5 A;  1L2S A;  3E98 A;  5EVI D;  3V5M A;  1Z6F A;  3R4K A;  3UNW A;  2UV0 E;  3KYZ A;  2L4R A;  1ONG A;  2JCH A;  1TS6 A;  3OCN A;  3UB6 A;  4GKU A;  3ZGA B;  2K31 A;  2V0W A;  1TS8 A;  4MN7 A;  1JWP A;  2A24 B;  1JWV A;  2G2W A;  2CMN A;  3FKV A;  3UME A;  2ZC3 B;  1XA7 A;  3O87 A;  1GA0 A;  1PRQ A;  1C3B A;  3VOY A;  3TSG A;  3FKW A;  1IKG A;  3T4K A;  3S7O A;  4JF4 A;  5IS1 A;  4L9F A;  1VHM A;  1YLY A;  3NC8 A;  1DP9 A;  3OPP A;  3AGF A;  1OME A;  4HJ3 A;  4ARZ A;  1MKI A;  4R1G A;  1E3U A;  1TDG A;  2I9V A;  1K54 A;  4LPZ A;  4BMW A;  2XFS A;  5EM0 A;  4GJ4 A;  5CEC A;  2C6W B;  3FZC A;  1D1J A;  3VP2 A;  2ZC6 B;  4NET A;  4WEK A;  1V9Y A;  3IX8 A;  1XP4 A;  3IH8 A;  3VP0 A;  3P7N A;  2OOL A;  1YPR A;  3V50 A;  3IXG A;  2B02 A;  1PW1 A;  3CUE C;  1LI0 A;  4Y2F A;  2YKF A;  2YKH A;  2PBD P;  5KSC A;  1F98 A;  3S4X A;  3E4O A;  4OON A;  1OT9 A;  1BUE A;  4JXV A;  2Y59 A;  4OLD A;  3ZG7 B;  1P0Z A;  5AQ7 A;  3NDG A;  2FFY A;  1IYS A;  1FR1 A;  4S2N C;  2Y2N A;  5HZH A;  5HDS A;  2JKR I;  5HSQ A;  1L0G A;  3VFH A;  3QP6 A;  4MEZ A;  4PPR A;  4GN2 A;  4DE3 A;  2A24 A;  3F1P B;  1HD8 A;  3ZFZ A;  2HDS A;  1CF0 A;  4NXB A;  2ZM0 A;  4IBR A;  4OH0 A;  4LLO B;  3HUO A;  5FAO A;  3F1P A;  3M2J A;  1HVB A;  2V1B A;  4HI4 A;  3G32 A;  3IS2 A;  4LGW A;  3CIT A;  5CTM A;  2ZOH A;  4FH2 A;  1BLH A;  4P6B A;  3IF6 B;  1S67 L;  2W3G A;  1S1Y A;  2OWJ A;  2VA0 A;  5GHX A;  4HY8 A;  3RXW A;  3NY4 A;  2GNX A;  2J80 A;  2Y2I A;  2ZM8 A;  4DE2 A;  2HDU A;  1OTI A;  5HPI A;  4XXR A;  5CHU A;  5M19 A;  2ZD8 A;  2G2U A;  4Y7P A;  4BBV A;  3BFD A;  3EEH A;  1HZO A;  1S66 L;  2O9A A;  4FH4 A;  5F1F A;  4EEP A;  2H5S A;  2W3H A;  4CLC E;  1M40 A;  3AGD A;  5HD5 A;  2CC1 A;  3BWL A;  4EBL A;  2WKP A;  3NEC A;  3MF0 A;  1T18 A;  2J3T C;  4CLC D;  3N7W A;  5DKK A;  1KVL A;  4WBG A;  4WF0 A;  4XUZ A;  2WKR A;  1MY8 A;  2ZL1 A;  4KG2 A;  3O88 A;  3BLM A;  2Y2K A;  4PKY G;  1GHP A;  1GSW A;  2A49 A;  3BEC A;  4PM5 A;  2XLN A;  1ES3 A;  2D01 A;  3GEC A;  4ZJ2 A;  4E3K A;  4NKP A;  3IF6 C;  1ESI A;  3GRJ A;  3QNC A;  1PNE A;  3SH9 A;  3M2K A;  4P87 A;  4E3N A;  1I5Q A;  3LID A;  3KYE A;  2V9A A;  1BLP A;  2PBY A;  5FQJ A;  2ZJ9 A;  1NY0 A;  3MQO A;  4I3J A;  1WE4 A;  1J3W A;  4GNU A;  4X69 A;  4I38 A;  4LV1 A;  4AFI A;  3IXD A;  2M1C A;  3IWO A;  3D9Y A;  5I94 A;  1K0K A;  1PZO A;  5DTS A;  1CEG A;  3S1Y A;  1EI5 A;  4PM7 A;  2EFX A;  3CZD A;  5F6A A;  2EWV A;  2IA2 A;  5E2F A;  4GOG A;  3VP4 A;  3QP2 A;  3FC7 A;  3V67 A;  4HBT A;  4DE1 A;  1SHV A;  5E43 A;  3C7U A;  3PBR A;  3ITA A;  4Y17 A;  3UE3 A;  3LR3 A;  5F5Y A;  1PIO A;  5KIZ A;  4JF6 A;  5HDD A;  1ZG6 A;  5EOE A;  3S22 A;  2W1T A;  4EXO A;  4CLC A;  1EWZ A;  4PM9 A;  5C5K A;  3OOV A;  5CX7 A;  2Z6C A;  2ZQ7 A;  4EV4 A;  3M6B A;  3S7Q A;  3A3F A;  5FDH A;  5J8X A;  1K55 C;  1W5D A;  4ZTK A;  4KUK A;  4JBF A;  2VV6 A;  5HWV A;  4Y0O A;  3O3V A;  3QP1 A;  3PXP A;  1D06 A;  5AJG A;  2XA7 M;  5FQK A;  2ZM2 A;  4Q0H A;  4QJG A;  1YSP A;  5F1G A;  3TW8 A;  2W3F A;  4OPR A;  5CGX A;  4BQM A;  4MLL A;  2P9V A;  2Q9N A;  3MFD A;  1GHI A;  3P98 A;  5KMW A;  2RCX A;  2WK0 A;  1NJ4 A;  1VEU A;  4C75 A;  3WS4 A;  5EVI B;  1XPB A;  4Y0U A;  3MR0 A;  5U47 A;  1JVJ A;  2Y2O A;  5G4Y A;  2PR6 A;  1CJF A;  4FTX A;  4NK3 A;  1W8Y A;  4OOY A;  2ZMA A;  2VZW A;  4FSF A;  3CPT B;  4FOF A;  4DDY A;  3RXX A;  3EGX C;  4HP4 A;  5DJU A;  1O07 A;  1PWC A;  4UQI S;  2IWB A;  3IF6 A;  4WMC D;  5IU1 A;  1WA9 A;  3V39 A;  2XF3 A;  5GLC A;  1ES5 A;  3O5Y A;  5FQI A;  3T4T A;  3UDF A;  3MS6 A;  5A8B A;  2XH9 A;  1SDE A;  2ZMV A;  2L1M A;  2ZC4 B;  5EVL A;  4R3A A;  4IUK A;  5I5L A;  1LL8 A;  3SZT A;  4O8G A;  1TS0 A;  2QZ6 A;  2QYB A;  4KQR A;  3UB5 P;  3MZE A;  3CPT A;  1YM1 A;  3NBL A;  4KZ9 A;  2J3T D;  4HQA A;  2J9P A;  3LGO A;  3PBN A;  2OLV A;  3MBZ A;  1J9M A;  3ZCZ A;  3ZG5 A;  2MJ6 A;  4GS9 B;  5EVI A;  1S4S A;  4HP9 A;  2R9W A;  5G4Z A;  5AVF A;  3S7N A;  1RP5 A;  3FYZ A;  3PTE A;  4K0X A;  3BW6 A;  2KX6 A;  4HJ6 A;  3JVV A;  5L07 A;  1XX2 A;  1WYB A;  1W63 M;  3QP4 A;  3HLC A;  3VE3 A;  5EE8 A;  3IWI A;  3ZYT A;  1VET B;  3WS0 A;  4F3L B;  3VMA A;  4B88 A;  5FI7 A;  3A3J A;  1BLS A;  4PM8 A;  3NDE A;  1KE3 A;  1RGY A;  1DJA A;  3HLW A;  3IH9 A;  4MNR A;  4UQI M;  1DP8 A;  4KEN B;  3ULF A;  3ZQ5 A;  3SH7 A;  3FV7 A;  2XDM A;  3WS1 A;  3T1X A;  4Z1W A;  1NXY A;  1YAX A;  5J4E A;  2V2F F;  5L09 A;  3FPV A;  4KZ8 A;  4N1X A;  4BBT A;  1SCW A;  1IOU A;  1V9Z A;  3NOU C;  5EPH A;  4KZ3 A;  4FD8 A;  4YFM A;  1MKM A;  4DE0 A;  1MXO A;  3LYX A;  1I2W A;  2WGW B;  2JHE A;  3IQA A;  5FQM A;  1H8Z A;  3LO7 A;  2A2L A;  5M1A A;  3H9W A;  3LR0 A;  4UEY A;  1X0O A;  2Y91 A;  1PI5 A;  2JKT I;  4JXG A;  4O7D A;  5HL6 A;  4GDN A;  4R70 A;  3OC2 A;  4MBH A;  3H82 A;  1BT5 A;  1LL9 A;  4E3I A;  4EUZ A;  4BWI A;  2WGW A;  2J8Y A;  3A3I A;  3BY9 A;  3DBA A;  2VK3 A;  5HAR A;  4HOI A;  3NI9 A;  2Q9M A;  2PYP A;  4H6J B;  1YQS A;  4JKT A;  1CQA A;  4LFU A;  3BFC A;  2WUQ A;  1PYY A;  4S2I A;  1UWN X;  3ISG A;  5DKL A;  2A3U A;  3A3D A;  3BRM A;  3JYI A;  3GTC A;  2QWS A;  5J7E A;  3S7P A;  5CHJ A;  2KDK A;  3LFV A;  1KVM A;  1LSW A;  2BAS A;  4EET B;  1FIL A;  4M3K A;  3NHQ A;  2VKS A;  1MPL A;  1K56 D;  2VJW A;  4B4X A;  2HZ5 A;  4BJP A;  3LIE A;  4LEN A;  1VET A;  4RQ9 A;  1NRJ A;  4K08 A;  4EQI A;  5A90 A;  5CGW A;  4G3K A;  2HP5 A;  4GDB A;  2GX5 A;  3EQU A;  3HBR A;  1BTL A;  1ES2 A;  5AQA A;  4ME4 A;  3SOI A;  3KSI A;  5EOO A;  2Z2L B;  4HEF A;  3BEB A;  4I5S A;  3RFB A;  2PRF A;  4LCL A;  3GVB A;  3LI9 A;  1FIK A;  3MZD A;  5CGS A;  4E3J A;  2BG1 A;  5HDC A;  2J3W A;  3ZG0 A;  4X1M A;  3PR6 A;  5DF9 A;  2INW A;  2QHK A;  2Y2G A;  3KSF A;  2XRO A;  1MWU A;  1W79 A;  4EBP A;  2HDQ A;  1H5X A;  2M7U A;  3SS5 A;  3WS5 A;  4BEN A;  5CRF A;  4Q8I A;  4U0T A;  1Y54 A;  1TVF A;  1SZV A;  3VOL A;  3C5A A;  4ZJ1 A;  4L0L A;  1NWZ A;  1VM1 A;  3CJM A;  1AXB A;  1SKF A;  3C30 A;  4L9G A;  5TFQ A;  3F1N A;  3MFX A;  2HV1 A;  3W2Z A;  4KZ4 A;  4X25 A;  3F1O B;  5E2H A;  2WYX A;  3V3R A;  3PHY A;  1FSW A;  4M4X A;  2ZBB A;  3HLF A;  2ZL1 B;  1WYC A;  4OOL A;  5A93 A;  2WZZ A;  3Q7V A;  1ALQ A;  5FI6 A;  2EFU A;  5HW3 A;  4ZJ3 A;  1L0D A;  5F82 A;  5CER A;  3UB7 A;  1Y28 A;  1G5U A;  4E3O A;  3T4J A;  5FAQ A;  5GLA A;  5L10 A;  4LCM A;  2VGL S;  1STZ A;  1S6R A;  3UMD A;  4HBU A;  1LT0 A;  3N8R A;  1G68 A;  2W3D A;  1W63 Q;  2WZX A;  4WM9 A;  1HLU P;  2PD8 A;  2Y2Q A;  1K4F A;  1YMS A;  3UPP A;  3LIA A;  1CEF A;  4P6Z S;  2B18 A;  4X68 A;  4RYE A;  1FR6 A;  2DNS A;  1ZC2 A;  3VSL A;  5AQ9 A;  1K38 A;  2W1T B;  4WZ5 A;  5F69 A;  1TD5 A;  4D60 A;  4LV3 A;  2OLU A;  3T4S A;  3RJU A;  2XEP A;  4KQO A;  1YKD A;  4MDZ A;  1CI9 A;  1BSG A;  3GV9 A;  4U0X A;  5EM1 A;  2Y2H A;  1K56 A;  3U2A A;  5DFX A;  1W8Q A;  3PAE A;  3GR2 A;  3PAG A;  3UE6 A;  4JPM A;  4OP8 A;  1L0F A;  3LIC A;  4ZDX A;  1W7F A;  4DXB A;  3T50 A;  1XKZ A;  4DXC A;  4IBX A;  2JKG A;  4NXF A;  3T1Q B;  3VE4 A;  5FAT A;  3Q1F A;  5DJT A;  3MXQ A;  3N4I A;  3GDI A;  4JGR A;  3TOI A;  1K54 C;  3EWK A;  1IEL A;  2W3E A;  3T4L A;  5GHZ A;  2OWH A;  3C4P A;  4R4R A;  1K57 A;  1PWG A;  3W4P A;  2HP6 A;  1O7E A;  2PYR A;  2Y4A A;  1YLT A;  3H82 B;  4QPR A;  1QME A;  2K2N A;  5FEF A;  4MBK A;  3JPU A;  2PT7 A;  4DN0 A;  3D3O A;  1DP6 A;  2FZ0 A;  4EWF A;  2XA7 S;  3G31 A;  2JC7 A;  3HJK A;  3QNB A;  3CLO A;  2WGV A;  3E2K A;  3ZNY A;  4LRY C;  1KDS A;  2ZC5 B;  3ITB A;  3UDI A;  4X53 A;  4G3V A;  5EUA A;  2JBF A;  1XXM A;  4PM6 A;  3SW1 A;  3FWL A;  3NJA A;  4EUV A;  1XA1 A;  5HFO A;  2NUT C;  3UE0 A;  5AVE A;  5FAP A;  2WKQ A;  3IHB A;  5CTN A;  1IFQ A;  4Y3I A;  5A92 A;  4II7 A;  3T12 B;  5M18 A;  3A0V A;  4OQG A;  3HLE A;  1JWZ A;  4MCW A;  3MKE A;  3MQ0 A;  4MN5 A;  3IXH A;  1ZG4 A;  2PAV P;  3ZG8 B;  4XT2 B;  3DWK A; 
#chains in the Genus database with same CATH homology
 5EE8 A;  1GA0 A;  3IWI A;  3WS0 A;  1C3B A;  3VOY A;  3TSG A;  3FKW A;  1IKG A;  2QPN A;  3VMA A;  1U60 A;  1I2S A;  1XGJ A;  2ZQD A;  4JF4 A;  4B88 A;  4S2N A;  3BLS A;  4OLG A;  1YLY A;  3IXB A;  3CMZ A;  3NC8 A;  4WMC A;  5FI7 A;  1IYO A;  1DJB A;  3A3J A;  4R0Q A;  1BLS A;  4PM8 A;  3NDE A;  5EVI C;  4X6T A;  3OPP A;  3AGF A;  1YMX A;  5JYO A;  4WZ4 A;  1FCO A;  1KE3 A;  1RGY A;  1DJA A;  3HLW A;  3IH9 A;  1OME A;  2X71 A;  3Q7Z A;  4MNR A;  5FQ9 A;  1ERM A;  5TGF A;  4GD8 A;  4KEN B;  3SH7 A;  3FV7 A;  1N9B A;  4KG5 A;  4IVI A;  2XDM A;  3WS1 A;  1L0E A;  1MKI A;  1NXY A;  4R1G A;  1E3U A;  4HES A;  4KG6 A;  1TDG A;  5A91 A;  5EEC A;  2V2F F;  4KZ8 A;  1XGI A;  1GHM A;  4N1X A;  1K54 A;  4LV2 A;  3ZVW A;  3E2L A;  1SCW A;  2XFS A;  2EX2 A;  3UO9 A;  5EPH A;  2OSU A;  5CHM A;  2EXB A;  4KZ3 A;  2PU2 A;  1NZO A;  5CEC A;  4FD8 A;  2C6W B;  3FZC A;  3VP2 A;  5F83 A;  1K4E A;  2ZC6 B;  4YFM A;  2X02 A;  4NET A;  4WEK A;  3W8K A;  1RGZ A;  3G30 A;  1YT4 A;  4C3Q A;  4DE0 A;  1MXO A;  1FSY A;  1XP4 A;  3IH8 A;  3VP0 A;  1I2W A;  2WGW B;  3IQA A;  5FQM A;  3V50 A;  3OZH A;  1H8Z A;  3LO7 A;  3IXG A;  1TEM A;  1PW1 A;  3PBO A;  5M1A A;  1KGG A;  5E2E A;  1LI0 A;  1YLP A;  4C6Y A;  2DRW A;  3CG5 A;  2Y91 A;  4GB7 A;  1PI5 A;  4JXG A;  1K57 C;  4BD0 A;  5KSC A;  3M6H A;  4O7D A;  2VGJ A;  2IWC A;  3S4X A;  4DDS A;  4GDN A;  3TG9 A;  4QD4 A;  4ZAM A;  5G18 A;  3OC2 A;  1E25 A;  2J7V A;  4MBH A;  4OON A;  4QB8 A;  4N9L A;  1BUE A;  4JXV A;  2Y59 A;  4OLD A;  3ZG7 B;  4B4Z A;  1BT5 A;  4KZB A;  1LL9 A;  1M6K A;  4GZB A;  1MWR A;  2I72 A;  5AQ7 A;  4JXW A;  4E3I A;  4EUZ A;  3NDG A;  2FFY A;  2J8Y A;  2WGW A;  3A3I A;  1IYS A;  1FR1 A;  4S2N C;  5HAP A;  4U3T A;  5HAR A;  4RVA A;  2Y2N A;  2ZC7 A;  2XFT A;  3NI9 A;  2XGN A;  2Q9M A;  1L0G A;  3VFH A;  1YQS A;  5L2F A;  2B5R A;  4JKT A;  4A5R A;  4MEZ A;  4PPR A;  4GN2 A;  4DE3 A;  2Y2J A;  1HD8 A;  1K6S A;  4F94 A;  2HPB A;  3BFC A;  4E6X A;  3ZFZ A;  2HDS A;  1PYY A;  2WUQ A;  2Y2L A;  4X56 A;  5GL9 A;  5IHV A;  4E3M A;  3N8S A;  4R4S A;  4WEL A;  4S2I A;  2Y55 A;  3ISG A;  2A3U A;  1JTG A;  3A3D A;  3BRM A;  3LY4 A;  1YLJ A;  4LV0 A;  1Q2Q A;  1E3U D;  2ZM0 A;  3JYI A;  2ZQ8 A;  3HL9 A;  1DY6 A;  3GTC A;  5FI2 A;  1K25 A;  3VOZ A;  3VP1 A;  4IBR A;  5KZH A;  5CHJ A;  1LHY A;  1S0W A;  4KZ5 A;  1KVM A;  1HTZ A;  4OH0 A;  1MWT A;  4M3K A;  1MPL A;  3W4O A;  3ZVT A;  3HUO A;  5FAO A;  3VSK A;  1K56 D;  2QMI A;  3HVF A;  4B4X A;  1K6R A;  3M2J A;  5DTK A;  1HVB A;  4D2O A;  1MWS A;  2WKH A;  1TDL A;  3W4Q A;  4BJP A;  4K0W A;  3IHA A;  4QY6 A;  3B3X A;  3G32 A;  4E6W A;  3EQV A;  5CTM A;  3BM6 A;  3HLB A;  1IYQ A;  4LEN A;  3DWZ A;  3BFG A;  4FH2 A;  1BLH A;  2Y2P A;  4P6B A;  4UHU A;  3PBS A;  3IF6 B;  4EQI A;  5A90 A;  4DKI A;  2RL3 A;  2XD5 A;  3C7V A;  5CGW A;  5GHX A;  2XQZ A;  3RXW A;  3NY4 A;  5DTT A;  5HAI A;  2GDN A;  1LLB A;  2HP5 A;  4GDB A;  2Y2I A;  1G6A A;  2ZM8 A;  4DE2 A;  2HDU A;  4JF5 A;  3EQU A;  4OVD A;  4XXR A;  4KZ6 A;  3A3E A;  5CHU A;  5M19 A;  2ZD8 A;  3HBR A;  1BTL A;  1ES2 A;  4WYY A;  2G2U A;  5AQA A;  3SOI A;  4Y7P A;  1ERO A;  3SS3 A;  3WS2 A;  3N6I A;  3BFD A;  3MZF A;  5AQB A;  5EOO A;  2HP9 A;  3UE1 A;  2Z2L B;  3IWQ A;  2P74 A;  3OCL A;  3MKF A;  1HZO A;  4HEF A;  3BEB A;  4PMA A;  2ZQ9 A;  2WAE A;  5DF8 A;  4LCL A;  1BLC A;  3GVB A;  4FH4 A;  3Q07 A;  5F1F A;  3WRT A;  3Q82 A;  3BFE A;  2H5S A;  3MZD A;  3MXS A;  3PBT A;  3MXR A;  1M40 A;  2WAF A;  5CGS A;  4E3J A;  2BG1 A;  3AGD A;  4GD6 A;  3AGE A;  3ZG0 A;  5DF9 A;  2R9X A;  3V3S A;  2CC1 A;  1KGF A;  2Y2G A;  1BUL A;  4UA9 A;  1MWU A;  1W79 A;  1GCE A;  4EBL A;  4EBP A;  2HDQ A;  3HUM A;  1H5X A;  4R3J A;  3ZG9 B;  3GSG A;  3SS5 A;  1YLW A;  3IT9 A;  2WKI A;  2ZQA A;  3WS5 A;  4E3L A;  4BEN A;  5CRF A;  1IEM A;  2EX8 A;  3N7W A;  4Q8I A;  4U0T A;  3G34 A;  2Y2M A;  3G4P A;  1KVL A;  4WBG A;  4CPK A;  1Y54 A;  2V1Z A;  3SH8 A;  1TVF A;  4P0M A;  4XUZ A;  3C5A A;  1MY8 A;  4ZJ1 A;  4L0L A;  2Z2M B;  3G35 A;  1VM1 A;  4KG2 A;  1ESU A;  3CJM A;  3BLM A;  2Y2K A;  3O88 A;  1GHP A;  3HUN A;  1AXB A;  2A49 A;  3N8L A;  1DJC A;  1SKF A;  5HX9 A;  3BEC A;  5TFQ A;  4OQ0 A;  4PM5 A;  3WWX A;  2XLN A;  3VP3 A;  1ES3 A;  3GQZ A;  4KZ4 A;  1BZA A;  5E2H A;  2WYX A;  3V3R A;  4BLM A;  4ZJ2 A;  4E3K A;  1FSW A;  3IF6 C;  4DRT A;  1IKI A;  1ESI A;  1LI9 A;  3GRJ A;  3QNC A;  3SH9 A;  3HLF A;  4RX2 A;  3M2K A;  4P87 A;  4E3N A;  4X55 A;  1I5Q A;  2ZQC A;  1ONH A;  1BLP A;  2PBY A;  5FQJ A;  1WYC A;  2ZJ9 A;  3DW0 A;  3I7J A;  4OOL A;  1NY0 A;  5A93 A;  1KE4 A;  2WZZ A;  3Q7V A;  4KZ7 A;  1ALQ A;  5FI6 A;  4RA7 A;  1WE4 A;  3OPR A;  4BD1 A;  2EFU A;  4GNU A;  4P85 A;  4X69 A;  5HW3 A;  4ZJ3 A;  3ZNT A;  1L0D A;  4LV1 A;  5F82 A;  5FSR A;  3IXD A;  5CER A;  3IWO A;  2E8I A;  2EX9 A;  5I94 A;  5GHY A;  5KSH A;  1PZO A;  5HL1 A;  5DTS A;  1CEG A;  1MBL A;  3S1Y A;  1EI5 A;  4PM7 A;  2EFX A;  3CZD A;  4OPZ A;  2V20 A;  5E2F A;  4GOG A;  3VP4 A;  4E3O A;  4KQQ A;  5FAQ A;  5TR7 A;  5GLA A;  2JE5 A;  4LCM A;  4OKP A;  1GA9 A;  4BL2 A;  1S6R A;  4HBU A;  5CED A;  2IWD A;  3N8R A;  4HBT A;  4JXS A;  1G68 A;  1SHV A;  3C7U A;  4N92 A;  5E43 A;  4DE1 A;  3PBR A;  3ITA A;  1SDN A;  2FFF B;  3UE3 A;  4QU3 A;  1KGE A;  4FCF A;  2WZX A;  1PIO A;  4WM9 A;  4JF6 A;  4IVK A;  1ZG6 A;  5EOE A;  2XD1 A;  3S22 A;  1FOF A;  1N4O A;  4H8R A;  5E2G A;  5JYP A;  1EWZ A;  4PM9 A;  4KZA A;  5GLD A;  4ZBE A;  5DF7 A;  4N9K A;  1YLZ A;  2Y2Q A;  1VQQ A;  1K4F A;  1CI8 A;  1YMS A;  2ZQ7 A;  3UPP A;  4EV4 A;  1PW8 A;  2H10 A;  3DTM A;  3M6B A;  3A3F A;  1NZU A;  5FDH A;  1CEF A;  4OQH A;  5J8X A;  1K55 C;  4X68 A;  4RYE A;  1W5D A;  2XK1 A;  1FR6 A;  4Z9Q A;  2DNS A;  4N1H A;  1ZC2 A;  4ZTK A;  3VSL A;  4IED A;  5AQ9 A;  1K38 A;  4JBF A;  4OQI A;  4WZ5 A;  3UN7 A;  4XUX A;  4Y0O A;  4OP5 A;  3O3V A;  4LV3 A;  2X01 A;  2OLU A;  3RJU A;  1E4D A;  4S2K A;  4QY5 A;  3BYD A;  2XEP A;  2HDR A;  2ZM2 A;  5FQK A;  4KQO A;  3UDX A;  1CI9 A;  3BFF A;  3IF5 A;  3LY3 A;  4QJG A;  1BSG A;  3GV9 A;  4MBF A;  4U0X A;  3SS4 A;  5F1G A;  5BOH A;  5GLB A;  2Y2H A;  1ES4 A;  1K56 A;  4RX3 A;  2H0Y A;  5CXW A;  4CJN A;  2H0T A;  2WAD A;  4OPR A;  1W8Q A;  5CGX A;  2ZLY A;  4BQM A;  3PAE A;  4MLL A;  2Q9N A;  2P9V A;  2WGI A;  1GHI A;  3GR2 A;  3MFD A;  3P98 A;  3PAG A;  5FQQ A;  1NRF A;  1JTD A;  1ERQ A;  1FCM A;  4JPM A;  4OP8 A;  5KMW A;  1L0F A;  4UA6 A;  4ZDX A;  3HLD A;  1W7F A;  4DXB A;  1XKZ A;  2RCX A;  4DXC A;  2WK0 A;  1NJ4 A;  4C75 A;  4IBX A;  4WZ5 C;  3WS4 A;  3WRZ A;  3PBQ A;  4S2L A;  5DVA A;  5EVI B;  3G2Z A;  1XPB A;  4Y0U A;  4S2J A;  2VGK A;  5FAT A;  3Q1F A;  2PU4 A;  4QHC A;  2UWX A;  5U47 A;  1JVJ A;  1FQG A;  3G2Y A;  3D4F A;  3VFF A;  2Y2O A;  2P9V B;  3N4I A;  3HLG A;  4NK3 A;  1W8Y A;  3UY6 A;  4JLF A;  2ZMA A;  4OOY A;  3TOI A;  1K54 C;  4R23 A;  5FAS A;  1PZP A;  5CEB A;  4FSF A;  1IEL A;  4DDY A;  3RXX A;  5GHZ A;  1ZKJ A;  3C4P A;  4R4R A;  1O07 A;  5D3O A;  3UPO A;  3NIA A;  4OOM A;  1PWC A;  3LEZ A;  4S2M A;  1PWD A;  1K57 A;  3C4O A;  4OPY A;  1Q2P A;  4BL3 A;  1PWG A;  2IWB A;  3W4P A;  1KE0 A;  4S2O A;  3O86 A;  3IF6 A;  4WMC D;  4UAA A;  2HP6 A;  1O7E A;  2XF3 A;  3V39 A;  2Y4A A;  1FCN A;  1PI4 A;  1YLT A;  3OPH A;  1K55 A;  1ES5 A;  4S2P A;  5GLC A;  1KDW A;  1QME A;  3QHY A;  5FQI A;  4MBK A;  3UDF A;  1H8Y A;  4DF6 A;  1QMF A;  1RCJ A;  2EX6 A;  2XH9 A;  4ID4 A;  1SDE A;  3UPN A;  2ZC4 B;  2EXA A;  5EVL A;  4EWF A;  4OPQ A;  1NYY A;  2JC7 A;  3G31 A;  3QNB A;  1NYM A;  4K91 A;  2J9O A;  4Y0T A;  2C5W B;  3HRE A;  3ZHH A;  3NCK A;  2WGV A;  3E2K A;  3ZNY A;  1KDS A;  2ZC5 B;  2BLS A;  3ITB A;  2QZ6 A;  2OV5 A;  4KQR A;  3UDI A;  1L2S A;  4X53 A;  5EVI D;  3MZE A;  3V5M A;  1Z6F A;  1YM1 A;  3P09 A;  3UNW A;  4UA7 A;  3NBL A;  2JBF A;  1XXM A;  5EUA A;  3LCE A;  4PM6 A;  1ONG A;  2JCH A;  4KZ9 A;  1IYP A;  3OCN A;  2J9P A;  2XR0 A;  3FWL A;  3PBN A;  1CK3 A;  4YIN A;  1XA1 A;  4GKU A;  5HFO A;  3ZGA B;  2OLV A;  3MBZ A;  4EBN A;  3UE0 A;  1J9M A;  3ZCZ A;  3ZG5 A;  3GMW A;  2DCF A;  5FAP A;  3IHB A;  1JWP A;  5EVI A;  3Q81 A;  5CTN A;  2WKE A;  3Q7V B;  1JWV A;  2R9W A;  5A92 A;  2G2W A;  5M18 A;  4OQG A;  3FKV A;  3HLE A;  4WEJ A;  1RP5 A;  3FYZ A;  3PTE A;  4K0X A;  1JWZ A;  5HAQ A;  3ZDJ A;  1LL5 A;  3MKE A;  2ZC3 B;  3OPL A;  3IXH A;  1ZG4 A;  1XX2 A;  4R3B A;  1WYB A;  1XA7 A;  3O87 A;  3HLC A;  3ZG8 B;  3DWK A;  5FA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...