3SH9A

Crystal structure of fluorophore-labeled beta-lactamase penp in complex with cefotaxime
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
256
structure length
254
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFCPNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Increased structural flexibility at the active site of a fluorophore-conjugated beta-lactamase distinctively impacts its binding toward diverse cephalosporin antibiotics
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase/antibiotic
total genus 86
structure length 254
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3sh9A00
1LLBA 2Y2NA 2HDUA 4X68A 1XPBA 4S2PA 3QHYA 3HLDA 4FCFA 3SS5A 4P87A 1BSGA 3P98A 4GZBA 1ES2A 2WGVA 4JXVA 1XP4A 4ID4A 5FQQA 4BENA 1LL5A 1QMEA 2WUQA 4KZ8A 4WEKA 2EXBA 3AGEA 5IHVA 3DWKA 1JTGA 1TVFA 3WS4A 1JWPA 3CMZA 3WS5A 3W8KA 2A3UA 2OSUA 2ZM8A 2BLSA 3S22A 4NETA 3V3SA 4DF6A 2JE5A 5CERA 1YLTA 5DF7A 3C7VA 3UNWA 3VMAA 2VGKA 3E2KA 4LENA 1DJAA 5M1AA 3OPPA 4E3OA 5FI2A 2XLNA 4DXBA 1ALQA 4KG2A 2WADA 5CHJA 3GV9A 5JYOA 3Q7VA 5FSRA 3A3JA 1NZOA 4BJPA 4OQHA 1K55A 4U3TA 1SDEA 2C6WB 1FOFA 5FQMA 3OPRA 4X69A 5GL9A 3PBOA 5HAPA 1S6RA 1MPLA 4H8RA 1K6RA 4X6TA 1PZOA 4KZ7A 2XK1A 1W8YA 3PBQA 5FQIA 2Y2HA 3TOIA 4PM7A 5AQ7A 1IKGA 2Y2JA 3A3FA 5FATA 3C5AA 4IEDA 4X53A 3N7WA 2P9VB 4S2OA 4BQMA 2WZXA 4RX2A 3O3VA 5CRFA 3VOYA 1TDLA 2GDNA 3GQZA 1ERMA 3FZCA 3IHBA 3VP1A 4N1XA 5GLBA 4GOGA 3CG5A 3ZVTA 3ZVWA 3PBRA 3ZG0A 3VP2A 3MZEA 3PBTA 3S1YA 1PWDA 4BD1A 2Y91A 1FCOA 2OLVA 2XH9A 4GNUA 3ZG5A 4E3IA 1K57C 4N1HA 4S2LA 3BLMA 2HDRA 3MXRA 4OONA 1K6SA 2ZM0A 3OZHA 2Y2QA 5EVIB 1AXBA 2HP6A 3B3XA 1ONHA 4FH4A 4ZBEA 3NC8A 3CZDA 1JWZA 3UPOA 1H5XA 1KDWA 2X02A 1MWSA 3BFFA 1L0EA 5FQ9A 4GB7A 5KZHA 1WYCA 1H8YA 3LO7A 4Q8IA 4KQOA 3PAGA 4DDSA 5E2GA 4OQGA 4KZ9A 1PIOA 4Y0OA 5F83A 2X01A 3A3EA 3IHAA 4OPRA 3W4OA 2QZ6A 4JBFA 4QJGA 2J8YA 5HX9A 4PMAA 2WYXA 3BFDA 3UY6A 3Q7ZA 3BLSA 3ZG7B 4HBUA 3N4IA 5HL1A 1HZOA 5I94A 2G2WA 3C4OA 2WGWA 4MLLA 1SHVA 2J7VA 2XQZA 2XGNA 4S2NA 4BLMA 4C3QA 2Y2PA 3IF5A 5FI7A 3VSKA 4E6WA 4UA7A 4B4XA 5BOHA 5HAQA 3TSGA 4HEFA 2ZC5B 3MXSA 1K54C 2FFFB 3G2ZA 5FI6A 1XXMA 2PU2A 3SH9A 4JF5A 1W8QA 1LL9A 4MBHA 1VM1A 1K4FA 4OLDA 2Z2LB 4E3NA 4X56A 1PW1A 1ESUA 2XF3A 4KZBA 1ONGA 4WZ5C 4R3JA 4CJNA 1XGJA 2X71A 1HTZA 3C4PA 4UA9A 1GHMA 4GD8A 2OV5A 1GA0A 3LY3A 3UO9A 5J8XA 2ZLYA 5TR7A 5FQKA 3Q07A 3C7UA 5CGSA 4OOYA 4S2MA 3HUMA 1L2SA 1FSWA 2WKHA 4JF4A 4RVAA 5FA7A 4WMCA 5EVIC 3LEZA 2Y2OA 1KE4A 3DWZA 1YLJA 3NDGA 1K56D 4GD6A 3OPLA 1EROA 4KZ6A 3WS1A 1FR6A 1IKIA 3IXHA 4MEZA 4QD4A 1RCJA 4Y0UA 4GKUA 3RJUA 4PM9A 2HP9A 1O07A 2XFSA 2ZQAA 2ZC3B 1ES4A 1ERQA 1WE4A 4XXRA 4K91A 4ZJ1A 3VFHA 1PI4A 3NIAA 5KSCA 2XDMA 3SH8A 2P9VA 1K54A 1XKZA 1YM1A 4RA7A 3SS3A 3ZHHA 4B4ZA 1IYOA 1LI0A 2ZQ7A 1ZC2A 2Y59A 3FKWA 3HVFA 4A5RA 3ZG9B 3WS0A 2C5WB 3NI9A 5L2FA 4MBKA 5M18A 4WZ5A 1BUEA 3RXXA 4WEJA 3GRJA 3OC2A 3LCEA 4GDBA 1JTDA 5AQBA 2DNSA 1YQSA 4FD8A 4C75A 4XUXA 1BLSA 1MY8A 1XGIA 5A92A 1KGFA 3BM6A 4O7DA 2OLUA 5FAQA 3A3DA 3IXDA 4HESA 2EXAA 4ZJ3A 3Q1FA 3UPNA 3V39A 1C3BA 2XFTA 3G31A 3UDXA 1KVLA 4L0LA 5EVIA 5HW3A 3UDIA 3AGFA 1FCNA 3ZDJA 4GN2A 2Y2MA 1XX2A 4QU3A 5F1GA 3W4PA 1I2WA 1JWVA 1M40A 3O86A 1FSYA 4WMCD 4EQIA 4OOMA 1GCEA 5TGFA 4ZJ2A 3HLWA 1IELA 1KDSA 1W5DA 2EFXA 2ZC4B 4KQRA 4ZDXA 3MZFA 2Z2MB 3NBLA 4OVDA 2H10A 1SDNA 4E3JA 3N8LA 4B88A 2EX6A 4OPYA 4WELA 2EX8A 2JC7A 3GTCA 1KGGA 3EQUA 1NJ4A 1NYMA 3HREA 3SOIA 2I72A 3WS2A 3NDEA 1LHYA 3IT9A 2WAEA 2PU4A 2R9WA 2XD1A 2ZMAA 5GLCA 5F1FA 5CEBA 2QPNA 5CEDA 2RL3A 4R4SA 1CI8A 4OP8A 5CECA 1O7EA 5CTNA 1L0GA 2A49A 5E2EA 4BL2A 4RYEA 3ZNYA 4DXCA 4R23A 3EQVA 3DW0A 4HBTA 3UN7A 1MXOA 2ZQDA 2HDQA 2J9OA 1IYQA 2EFUA 4QHCA 4UHUA 4K0XA 4EBLA 1GHPA 4C6YA 1H8ZA 4DDYA 4S2JA 3LY4A 4ZTKA 2WK0A 1CI9A 1PW8A 1BLPA 1KE0A 1IEMA 4KG6A 5EVID 2PBYA 4LCLA 3SH7A 1IYPA 1J9MA 5HAIA 5EECA 1QMFA 3G34A 3MKFA 1I2SA 2Q9MA 4NK3A 4F94A 1Q2QA 1RGYA 3PAEA 1YLPA 5CHUA 1BLCA 2V1ZA 4QY6A 1N9BA 1XA1A 5D3OA 4EBNA 5EUAA 2J9PA 3CJMA 4N92A 4DKIA 3BEBA 1MWRA 3HBRA 4E3LA 1CEGA 1YMXA 2HP5A 1S0WA 4FSFA 1ZG6A 5GHXA 1SKFA 3Q82A 4JXSA 4XUZA 5CXWA 1K57A 2V20A 2CC1A 3WRZA 5KMWA 1IYSA 1MWUA 3IQAA 4R3BA 3PTEA 3SS4A 1EI5A 1CEFA 1OMEA 1E3UA 3BFCA 4P6BA 2Y55A 2E8IA 3ISGA 3VFFA 2G2UA 2WZZA 3I7JA 3IXGA 3IH9A 3UE1A 4N9KA 3G32A 5AQ9A 3UPPA 3TG9A 1LI9A 1MBLA 2ZQ8A 3FWLA 1DJBA 1VQQA 3IF6B 5EVLA 4IVIA 5GHYA 1YLWA 3AGDA 3JYIA 1WYBA 2XEPA 3S4XA 3VP0A 2XD5A 5A93A 1MKIA 4S2KA 3MBZA 2ZC6B 4QB8A 1DY6A 5CGXA 5EE8A 3GR2A 3ZFZA 4P85A 4EV4A 3BRMA 1E4DA 1RP5A 4QY5A 1K55C 5HARA 3G30A 3MKEA 4EWFA 3HLGA 3BFGA 1EWZA 4KG5A 2IWBA 2H5SA 1NY0A 2EX9A 4JXWA 1NZUA 4DE0A 4DE1A 3UDFA 5DTSA 1PWGA 4DE3A 3V3RA 3BECA 1G6AA 2BG1A 4Y7PA 5DVAA 4JKTA 2H0TA 4KENB 5DTKA 4Z9QA 1BLHA 3GVBA 1FCMA 5EOOA 3DTMA 4R4RA 3GMWA 1ES5A 2FFYA 4OOLA 3N8RA 4JPMA 1K38A 2Y4AA 3MFDA 1E3UD 4LV0A 4WM9A 1FR1A 3OCNA 3FV7A 3ZCZA 2EX2A 4KZ5A 2Y2GA 3G4PA 1DJCA 3FYZA 5FAPA 4OQIA 5G18A 3VP4A 5M19A 1JVJA 1BT5A 3IF6C 1E25A 3WWXA 4WZ4A 4OP5A 3VOZA 5E2FA 3G2YA 5KSHA 4JF6A 2IWCA 4K0WA 5F82A 3UE0A 1FQGA 5CTMA 1Z6FA 2RCXA 1U60A 5GHZA 4Y0TA 5DF8A 3V50A 3M6BA 1NRFA 5CHMA 4P0MA 1PZPA 1YMSA 4EUZA 1GHIA 3HL9A 4X55A 4N9LA 2XR0A 1N4OA 3ITBA 4BL3A 4MBFA 4JLFA 4YFMA 4LCMA 2HDSA 2IWDA 4PM6A 4GDNA 2DRWA 3HLEA 5GLAA 5TFQA 4S2NC 2Y2IA 4DE2A 2DCFA 4IVKA 1HVBA 2B5RA 2P74A 3M2JA 5FASA 1KGEA 1RGZA 3IXBA 4R1GA 4LV1A 3ZNTA 4E6XA 1NYYA 2Q9NA 5A90A 1PYYA 2WAFA 1G68A 1TEMA 3HLFA 3V5MA 2VGJA 1ESIA 5E2HA 3FKVA 2H0YA 2JBFA 1K4EA 3A3IA 1XA7A 3N6IA 1TDGA 3GSGA 3PBSA 3IWOA 4D2OA 4S2IA 1HD8A 3IF6A 1BTLA 3Q7VB 4OH0A 4CPKA 2QMIA 1K25A 3O87A 1PI5A 4WBGA 5JYPA 1M6KA 4FH2A 4E3MA 1I5QA 1PWCA 5U47A 4DRTA 2ZC7A 1K56A 3OPHA 5GLDA 3O88A 4E3KA 3Q81A 4JXGA 3ZGAB 2ZQ9A 5EOEA 3HLCA 2ZD8A 3M6HA 4YINA 4BD0A 4UAAA 1SCWA 4U0TA 3MZDA 2WKEA 4IBRA 3E2LA 3P09A 4UA6A 1NXYA 1BULA 3WRTA 3M2KA 4LV3A 3VSLA 4OLGA 1W79A 5FDHA 3ITAA 1YLZA 1BZAA 1Y54A 5AQAA 1KVMA 5A91A 4LV2A 4MNRA 1L0DA 3NY4A 3OCLA 5FAOA 3RXWA 2HPBA 1CK3A 4EBPA 3BYDA 4PPRA 1MWTA 3BFEA 3HUNA 4PM8A 4KZ4A 1ZKJA 2JCHA 1GA9A 3D4FA 4OKPA 4R0QA 2UWXA 4U0XA 4OQ0A 3UE3A 4WYYA 3NCKA 1KE3A 3IWQA 3N8SA 1ZG4A 1Q2PA 1L0FA 1YLYA 1W7FA 2ZQCA 5HFOA 3QNCA 2Y2KA 4KZAA 4PM5A 2WKIA 4OPQA 2V2FF 5CGWA 3G35A 3W4QA 5FQJA 5EPHA 5DTTA 2ZJ9A 4OPZA 3HUOA 1YT4A 3PBNA 4IBXA 2WGIA 4KQQA 3QNBA 4M3KA 2WGWB 3IWIA 4ZAMA 3VP3A 4KZ3A 5DF9A 5E43A 3ZG8B 3HLBA 4RX3A 2Y2LA 1ES3A 3IH8A 2ZM2A 2R9XA
chains in the Genus database with same CATH superfamily
3OOVA 3QHYA 3HLDA 4FCFA 3OLOA 1BSGA 4GZBA 3H82A 4JXVA 3QP5A 1XP4A 1HLUP 2VV8A 4BENA 3AGEA 1CQAA 3CMZA 5L07A 2A3UA 2ZM8A 2BLSA 3S22A 1TS0A 2P7JA 5DF7A 3UNWA 2ZMFA 3VMAA 2VGKA 1Y28A 4LENA 4E3OA 4DXBA 1LT0A 3JVVA 4CLCD 5MC7A 2C6WB 1FOFA 2EWWA 3PBOA 1S6RA 2V1BA 4H8RA 4X6TA 2XK1A 1W8YA 5FQIA 1V9YA 4IEDA 4BQMA 2VV6A 1ERMA 3IHBA 2I9VA 3ZVWA 1H0MA 3B33A 1FCOA 3NOTC 3H7WB 4GNUA 4O0PA 4S2LA 3GDIA 2FH5A 1K6SA 1JWZA 3UPOA 1KDWA 2PRFA 4I3AA 5FQ9A 1G28A 3PAGA 1WA9A 2JKRM 2J8YA 5HX9A 4PMAA 3BFDA 3Q7ZA 1XJ4A 2WGWA 1UWNX 1SHVA 2XGNA 4BLMA 3MQ0A 3IF5A 5FI7A 4UA7A 1NWZA 4XT2A 3UB7A 3MXSA 3G2ZA 3OBFA 2PU2A 2GX5A 1VM1A 4B9OA 4E3NA 4X56A 4KZBA 3CUEC 5IU1A 2J3WA 1HTZA 3LY3A 2BTFP 3C7UA 4JGPA 3HUMA 1L2SA 2WKHA 3LEZA 2Y2OA 1YLJA 3BY8A 3NDGA 4JGOA 4GD6A 1JNUA 1FR6A 2JKFA 5FEGA 2ZC3B 1ES4A 5KSCA 1K54A 2HGVA 3EEAA 1LI0A 2ZQ7A 1ZC2A 3ZG9B 3NI9A 5AQBA 2DNSA 4GJ4A 3H7WA 1KGFA 2OLUA 3UPNA 2EXAA 2INWA 3G31A 1KVLA 3IBJA 1FCNA 2O99A 2W3GA 4EQIA 1FSYA 3T4SA 4NKPA 5TGFA 4ZJ2A 1W5DA 3CHWP 4OVDA 2EX6A 4WELA 2EX8A 3EQUA 1NYMA 3HREA 3GECA 3LIFA 4R70A 1LHYA 2PU4A 2XD1A 4K08A 5CEBA 5CEDA 4OP8A 3LFVA 1L0GA 2A49A 4XT2B 4BMWA 4BL2A 4RYEA 3ZNYA 2ACGA 1KOUA 4IUHA 3K3CA 4PHTA 1T1AA 2IA2A 2ZQDA 4QHCA 4DDYA 1YAXA 4L9FA 4G3VA 1IYPA 5HAIA 3B42A 3G34A 3PHYA 2O9AA 1YLPA 4QY6A 5I5LA 5EUAA 2J9PA 1CEGA 4R3AA 1S0WA 4P6ZS 1SKFA 4HY8A 1K57A 4Q0JA 2JKGA 3WRZA 5EVEA 3IQAA 4IUKA 5J7EA 4P6BA 2Y55A 3TE8A 3MQOA 3TRCA 3DBAA 3G32A 2OWJA 3B47A 1YKDA 1LI9A 3FWLA 2V9AA 2ZQ8A 1MC0A 5GHYA 1PFLA 4WL9A 2ZOIA 2XD5A 3A0RA 5A93A 2O0YA 4MCWA 3MBZA 2KOIA 5CGXA 3LI8A 3GR2A 4P85A 2VJWA 3PXPA 4QY5A 5C5KA 2QKPA 1TS8A 2M7UA 4KG5A 3T1SA 1F2KA 4Y7PA 2WKRA 1G6AA 3DTIA 1LSVA 2H0TA 4KENB 5DTKA 1BLHA 1FCMA 2OWHA 3QP6A 2Y4AA 3MFDA 2O9BA 4LV0A 4WM9A 3OCNA 4QPRA 4KUKA 2VGLS 3RTYA 2EX2A 4KZ5A 2KDKA 3G4PA 1DJCA 3UB9A 1BT5A 2JKRI 2J3TD 4JF6A 4MN6A 2PYRA 5GHZA 4UQIM 4EW7A 4Y0TA 3V50A 3M6BA 3EGDC 1GHIA 4X55A 2XR0A 4II7A 2JKTM 4G3WA 3KYZA 2Y8HA 2DRWA 3KSHA 1T1BA 2XRNA 4IVKA 3ZNTA 4R1GA 4LV1A 4E6XA 5A90A 1NYYA 2Q9NA 2K7SA 1TEMA 4YOFA 3FKVA 4LRYC 2H0YA 1K4EA 2XA7S 3IWOA 4D2OA 3Q7VB 4CPKA 1PI5A 4FH2A 4F3LB 5U47A 4DRTA 3OPHA 5GLDA 4HP4A 3LR4A 2ZQ9A 5EOEA 3HLCA 4BD0A 1SCWA 4IBRA 1NXYA 2OAP1 3WRTA 2PYPA 3UB6A 4LV3A 1Y54A 5KIZA 5AVEA 5AQAA 4MNRA 3NY4A 1GSXA 1N9OA 5FAOA 4EBPA 3BYDA 5LBRA 4PM8A 4KZ4A 5IT5A 4OKPA 4R0QA 5EM0A 4U0XA 4ME4A 2DMWA 3HJIA 5A8BA 1VEUB 3IWQA 1VETB 3LIAA 3HJKA 5J3WA 4PM5A 4CLCE 3EEHA 2PAVP 4OPQA 1Y4OA 2ZJ9A 4HHDA 1YT4A 3O5YA 4IBXA 2WGIA 3VP3A 3ZG8B 3HLBA 4RX3A 2ZM2A 2R9XA 1LLBA 1K0KA 2Y2NA 3MR0A 3P98A 4HP9A 3NHQA 4ETXA 2Q0OA 3DWKA 1JWPA 2OSUA 3V3SA 2LB5A 3MQQA 4HH2A 2JE5A 5CERA 4DF6A 5FEFA 1YLTA 5HL6A 3LI9A 3D9YA 3BWLA 3E2KA 5M1AA 2XLNA 2PR5A 4KG2A 5CHJA 3Q7VA 5FSRA 3A3JA 3A0VA 4U3TA 3MSHA 5FQMA 3OPRA 4F3LA 1MPLA 1K6RA 4KZ7A 3NOUC 3PBQA 3W8KA 3TOIA 4PM7A 3A3FA 4Q0IA 1DP9A 4RX2A 3O3VA 3GQZA 2GDNA 4Y2FA 5DKLA 3VP1A 4GOGA 3CG5A 1P9RA 3ZVTA 3PBTA 1SZVA 2OLVA 4LFUA 3PYPA 2HDRA 2VA0A 2QJ7A 1ODVA 3SZTA 2Y2QA 2OOLA 1YPRA 1VEUA 1VETA 4KQOA 4DDSA 4O01A 4KZ9A 2X01A 3A3EA 1IFQA 3IHAA 5HDSA 2QZ6A 3W4OA 4X1MA 2WYXA 3MJQA 3ZG7B 3N4IA 5HL1A 5I94A 4Y13A 3DAVA 3VE3A 4S2NA 2Y2PA 4B4XA 2VV7A 4HEFA 3KYQA 2FFFB 3SH9A 3UB5P 4JF5A 1LL9A 4MBHA 4BWIA 2Z2LB 1ESUA 1UGUA 1OJ5A 5J8XA 1GHMA 4GD8A 1GA0A 4O8GA 3S7NA 5DJTA 3NULA 3Q07A 1ACFA 5CGSA 4RVAA 5FA7A 5EVIC 3DWZA 5FDSA 1K56D 3OPLA 1EROA 4EU0A 3WS1A 3IXHA 4Q0HA 3VE4A 3T12B 1RCJA 3RJUA 1LL8A 2JKTI 2XFSA 2ZQAA 2Z6DA 4XXRA 2YKFA 2XDMA 3SH8A 2CMNA 4B4ZA 2NUPC 2Y59A 3HVFA 5L2FA 1TS7A 3RXXA 4WEJA 3OC2A 4GDBA 4C75A 4EUVA 1XGIA 3EGXC 5FAQA 3A3DA 4ZJ3A 1T1CA 3V39A 3E4OA 3UDXA 4L0LA 2K31A 4WN5A 5HW3A 3UDIA 3ZDJA 4GN2A 2Y2MA 4QU3A 1M40A 1UWPX 4OOMA 1GCEA 1TD5A 3K2NA 2ZC4B 2Z2MB 3NBLA 2H10A 4E3JA 3N8LA 4B88A 5HDCA 4X1LA 3F1OB 3SOIA 4IHQA 2I72A 3LICA 2WAEA 2ZMAA 3QP4A 1D7EA 1O7EA 2B02A 4R23A 3EQVA 3DW0A 1MXOA 2HDQA 3T4QA 1CI9A 4KG6A 5F69A 2PBDP 1CJFA 3MKFA 1I2SA 2Q9MA 4HI4A 3BJNA 1Q2QA 4F94A 3PAEA 1BLCA 2W27A 1N9BA 4GHIB 4DKIA 1YMXA 4L9EA 2FZ0A 4JXSA 5CXWA 5G4YA 2V20A 4NEED 5KMWA 1PNEA 3T4KA 1E3UA 5L8MA 3VFFA 3I7JA 3FPWA 3IH9A 3TG9A 2GZAA 3KX0X 1MBLA 1DJBA 3MS6A 1F5MA 1WYBA 2XEPA 1MKIA 3LGOA 4QB8A 1ZTUA 4NG2A 1N9LA 3IS2B 3HLGA 4NXEA 1EWZA 4DE0A 4DE1A 3F1OA 3V3RA 3BECA 4HJ4A 2BG1A 3G6OA 4IJGA 1TF1A 1P0ZA 4R4RA 3LR5A 3N8RA 1ZHHB 1FR1A 2P04A 3FV7A 2Y2GA 3FYZA 2PD8A 4QWOA 3IF6C 1E25A 3WWXA 3PR6A 5KSHA 4K0WA 1X0OA 3RH8B 5DF8A 5EV0A 1NRFA 2D02A 4P0MA 1P97A 1PZPA 3R4KA 1T18A 1CF0A 1N4OA 4GHIA 4BL3A 2PR6A 4PM6A 3JPUA 3HLEA 5F6AA 4DE2A 2DCFA 2KX6A 5EM1A 4AFIA 1PYYA 2WAFA 2VGJA 2J80A 1ESIA 3NECA 3GSGA 3PBSA 4S2IA 1BTLA 4CLCC 5IS1A 2QMIA 3O87A 1PWCA 1OTBA 3O88A 4E3KA 3CI6A 3ZGAB 4YINA 4UAAA 4UA6A 4U0TA 3MZDA 5HWWA 3E2LA 4EXOA 1MZUA 3M2KA 3VSLA 3A0SA 4OLGA 3ITAA 1YLZA 4I3JA 4LV2A 3OCLA 4PKYG 1CK3A 5DFYA 4PPRA 3IX8A 3U4LP 4BBVA 1ZKJA 2JCHA 3UE3A 4B93A 4WYYA 3NCKA 1KE3A 3NOPC 1Q2PA 1YLYA 1W7FA 3VOLA 3ICYA 5TBMB 2Y2KA 2ZBBA 1Z09A 5CGWA 5FQJA 5EPHA 5DTTA 2W3FA 4OPZA 3PBNA 5DF9A 5E43A 4D60A 2XROA 2Y2LA 1S1YA 4EEUA 1LSXA 1XPBA 1D06A 3SS5A 4KQDA 4P87A 4ARZB 4ID4A 5FQQA 1LL5A 4JGQA 1QMEA 2WUQA 4KZ8A 4WEKA 5IHVA 3KSFA 1JTGA 1TVFA 3WS4A 3WS5A 3CITA 3FG8A 4Z1WA 5FI2A 2W1TB 2D01A 3JVUA 3CPTB 1ALQA 2WADA 3GV9A 5JYOA 1K55A 4X69A 2Y2HA 5FATA 2Y2JA 3N7WA 2P9VB 2ZL1B 2WZXA 4JGRA 5CRFA 1TDLA 1OJGA 3FZCA 5GLBA 4MN7A 1V9ZA 3UMEA 3VP2A 3MXQA 1PWDA 4BD1A 2Y91A 5L09A 3UMDA 4E3IA 1K57C 4N1HA 3BLMA 1PRQA 4OONA 3MXRA 4NXGA 5EVIB 2HP6A 1L3LA 3DTKA 1ONHA 3IBRA 4ZBEA 3NC8A 2VKSA 3L7HA 3CZDA 1H5XA 2X02A 1MWSA 3BFFA 5KZHA 3F1PB 4G3KA 2BASA 1H8YA 1XFQA 4HOIA 2HF6A 5TBMA 1LSWA 4OQGA 3LIDA 3S7QA 2NUTC 5F83A 4QJGA 3UY6A 3BLSA 2G2WA 3KSGA 3CLOA 3VSKA 3KYEA 4GW9A 2ZC5B 4ZRRA 5FI6A 1XXMA 3BY9A 4YWZA 1W8QA 4ARZA 1NLYA 4GCZA 2GJ3A 1PW1A 4WZ5C 4R3JA 1YSQA 2HJEA 3C4PA 4FOFA 2OV5A 3UO9A 2ZLYA 5FQKA 5HD5A 4S2MA 4WMCA 1XJ2A 3W2ZA 1KE4A 2W1TA 1TS6A 3CPTA 4KZ6A 3QP2A 4Y15A 5J4EA 1IKIA 4Y0UA 2HP9A 1OT9A 3T1RA 3MFXA 1D1JA 3VFHA 4K91A 4ZJ1A 1PI4A 3NIAA 4BBUA 2P9VA 1XKZA 2ZL1A 2VK3A 4RA7A 4A5RA 3FKWA 2C5WB 1BUEA 3LCEA 1JTDA 2B18A 5F5YA 1BLSA 1MY8A 3BM6A 4HESA 3ZQ5A 3Q1FA 4WUJA 2M7VA 5EVIA 1G6OA 5F1GA 3W4PA 1I2WA 1JWVA 5AVFA 3UB8A 1GSWA 4CQHA 4HNBA 4ZDXA 3EOIA 3LIEA 3MZFA 3P01A 1SDNA 2QJ5A 4OPYA 1KGGA 2W3DA 1FILA 3NDEA 5F1FA 5EFWA 3MF0A 3H82B 4R4SA 5CTNA 3T4TA 5E2EA 1XJ6A 4DXCA 2WKQA 4WLAA 4HBTA 1G5UA 3RFBA 1IYQA 4K0XA 4EBLA 4L9GA 4C6YA 2J3TC 2PHYA 4S2JA 3LY4A 2PBYA 4HH3A 3SH7A 4YNRA 5EECA 1QMFA 3BQ8A 2HJ9C 2V1ZA 1XA1A 2V8FA 4EBNA 3CJMA 1MWRA 3HBRA 2HP5A 3LUQA 1T19A 1ZG6A 5CX7A 3Q82A 4NXFA 2CC1A 1IYSA 1MWUA 3D72A 4R3BA 3PTEA 3SS4A 4E04A 1S4SA 3BFCA 2VZWA 1S66L 2E8IA 1DRMA 3IXGA 1OTEA 5AQ9A 5K5BA 1DP6A 1W63M 3IF6B 1VQQA 4IVIA 3P7NA 4R38A 1YLWA 3LR0A 2PT7A 2ZC6B 3IX3A 4I38A 3C38A 5EE8A 3T4OA 3BRMA 1E4DA 5HARA 3G30A 4P6ZM 4UQIS 3QP1A 3BFGA 3ULFA 2Y79A 3E98A 2H5SA 1NY0A 4JXWA 3V67A 3CUEA 3EWKA 4JKTA 3D3OA 3GVBA 5EOOA 3S7PA 1VB6A 1SKOB 2FFYA 4OOLA 2UV0E 4Y3IA 1E3UD 4CLCB 3T1QB 4FUWA 5M19A 1JVJA 4DN0A 3VOZA 4PKYA 3G2YA 5F82A 3UE0A 1Z6FA 2RCXA 5CHMA 3F1NB 1YMSA 4EUZA 4FTXA 1FIKA 4N9LA 4LRXC 2JN7A 1N9NA 3ITBA 4LCMA 2HDSA 3C30A 4HQAA 5GLAA 5TFQA 1MKMA 4S2NC 4GS9B 2Y2IA 2B5RA 4X25A 1KGEA 2VEAA 3IXBA 1BYWA 3LYXA 5TJJA 4BBTA 1G68A 2VGLM 3V5MA 5E2HA 2JBFA 3A3IA 1XA7A 1TDGA 1OTDA 1HD8A 3IF6A 1K25A 4WBGA 1STZA 1M6KA 1I5QA 2ZC7A 1K56A 3Q81A 1XFNA 4JXGA 2ZD8A 3M6HA 1S67L 4RQ9A 2ZOHA 3C8CA 2L1MA 1NLZA 2A24B 3E0YA 4PAUA 1BZAA 2V0UA 5A91A 1L0DA 5HWVA 3RXWA 2HPBA 1MWTA 3BFEA 1XJ3A 2XA7M 1SKOA 1GA9A 3CAXA 4OQ0A 2R78A 4CLCA 1L0FA 2OAQ1 2ZQCA 5HFOA 4KZAA 2WKIA 1AWIA 3W4QA 4KUOA 3HUOA 4M3KA 3IWIA 2L4RA 4EETB 2B95A 3BQAA 2HDUA 4X68A 3F1NA 4S2PA 1ES2A 2WGVA 2EXBA 5DFXA 4I39A 3KO6A 4GS9A 2YKHA 4NETA 3C7VA 2G7UA 2E8JA 1DJAA 3FPVA 3OPPA 5AJGA 1NZOA 4BJPA 4I5SA 4OQHA 2M1CA 1SDEA 5GL9A 3E4PA 5HAPA 3LEQA 1PZOA 5HD3A 3E4QA 5AQ7A 1IKGA 3C5AA 4X53A 4S2OA 5HPIA 3VOYA 2A24A 4N1XA 4M4XA 3PBRA 3FC7A 3ZG0A 3MZEA 1F98A 3S1YA 2XH9A 3ZG5A 3BW6A 4UEYA 4Y17A 2ZM0A 3OZHA 1DP8A 1AXBA 3B3XA 4EERA 4FH4A 4MMNA 3KSIA 3CWFA 1L0EA 4GB7A 1WYCA 3LO7A 5HDDA 4Q8IA 2GNXA 5E2GA 4Y5FA 1PIOA 4Y0OA 4OPRA 4JBFA 2WKPA 3IS2A 4DMZA 4HBUA 1HZOA 3C4OA 4MLLA 2J7VA 2XQZA 4C3QA 4E6WA 5BOHA 5HAQA 3TSGA 4ESPA 1K54C 2V1AA 1K4FA 1IOUA 4OLDA 2XF3A 1ONGA 2VX8A 4CJNA 1XGJA 2X71A 4UA9A 1VHMA 5TR7A 1A0KA 4OOYA 1FSWA 4JF4A 3VV4A 3S7OA 4MEZA 4HIAA 4QD4A 4GKUA 4PM9A 4R6LA 1O07A 2EWVA 5DKKA 1ERQA 1WE4A 1YM1A 3HCYA 3SS3A 3ZHHA 2AVXA 1IYOA 3WS0A 4NXBA 5M18A 4MBKA 4WZ5A 3GRJA 1YQSA 4FD8A 4XUXA 4EESA 5A92A 3T50A 4O7DA 3IXDA 5HSQA 1C3BA 2XFTA 3AGFA 1P9WA 1XX2A 3O86A 3DTEA 4WMCD 3HLWA 1IELA 1KDSA 2V0WA 2EFXA 4KQRA 2MJ6A 4EQ1A 5DJUA 4H6JB 2JC7A 3GTCA 1NJ4A 3R7WB 3WS2A 3IT9A 2R9WA 4LPZA 5GLCA 2QHKA 2QPNA 2RL3A 1CI8A 5CECA 3C2WA 3IX4A 4MN5A 1F9IA 2PDRA 3UN7A 2J9OA 2EFUA 4UHUA 2PD7A 1GHPA 1OT6A 1H8ZA 3U2AA 4MDZA 2KLIA 4ZTKA 2WK0A 1PW8A 1BLPA 1KE0A 1IEMA 5EVID 4LCLA 1J9MA 5L10A 4NK3A 1RGYA 5CHUA 5D3OA 1J3WA 1OTIA 5HZHA 2A2LA 4N92A 4E3LA 3BEBA 3H9WA 4FSFA 5GHXA 4XUZA 4GLQA 1EI5A 2Z6CA 1CEFA 1OMEA 4ETZA 3ISGA 2G2UA 2WZZA 3QP8A 2K2NA 3UE1A 4N9KA 3UPPA 5EVLA 3AGDA 1S1ZA 3JYIA 3S4XA 3VP0A 4HJ3A 4S2KA 1W63Q 1DY6A 1H3QA 3ZFZA 4EV4A 1RP5A 3LIBA 1K55C 3MKEA 4EWFA 2IWBA 4DJ2A 2EX9A 4H6JA 1NZUA 3UDFA 5DTSA 1PWGA 4DE3A 3R7WA 5FL3A 5DVAA 1YSPA 4I3IA 4Z9QA 1H8MA 2VLGA 3MMHA 3DTMA 3GMWA 1ES5A 3L9KA 4JPMA 1K38A 2O9CA 3ZCZA 2QYBA 5FAPA 4OQIA 5G18A 3VP4A 3F1PA 4EEPA 3T1XA 4WZ4A 4LRZE 4OP5A 3T4LA 5E2FA 2IWCA 1FQGA 5CTMA 1U60A 4DJ3A 1EW0A 3ZYTA 5HPFA 3HL9A 4MBFA 4JLFA 4LLOB 4YFMA 2IWDA 4GDNA 3UE6A 1S4RA 1HVBA 3SW1A 2P74A 3M2JA 5FASA 1RGZA 5G4ZA 3T4JA 3HLFA 3NJAA 2L0WA 2P08A 3N6IA 4HJ6A 2HV1A 4WF0A 4OH0A 5JYPA 4E3MA 2V8CA 1OPXA 2WKEA 3P09A 1BULA 4LGWA 2W3EA 2QWSA 1W79A 5FDHA 1KVMA 2EA9A 5HWTA 2W0NA 1GSVA 2JHEA 5F68A 3HUNA 2ZMVA 2HZ5A 3D4FA 2UWXA 2XSSA 3N8SA 1ZG4A 3TJZC 3QNCA 3TW8A 3LR3A 2V2FF 3G35A 2H28A 2LB9A 2W1RA 1NRJA 2W3HA 4KQQA 3QNBA 2WGWB 4ZAMA 4KZ3A 1OTAA 3K3DA 1ES3A 3IH8A
chains in the Genus database with same CATH topology
1LLBA 2Y2NA 2HDUA 4X68A 1XPBA 4S2PA 3QHYA 3HLDA 4FCFA 3SS5A 4P87A 1BSGA 3P98A 4GZBA 1ES2A 2WGVA 4JXVA 1XP4A 4ID4A 5FQQA 4BENA 1LL5A 1QMEA 2WUQA 4KZ8A 4WEKA 2EXBA 3AGEA 5IHVA 3DWKA 1JTGA 1TVFA 3WS4A 1JWPA 3CMZA 3WS5A 3W8KA 2A3UA 2OSUA 2ZM8A 2BLSA 3S22A 4NETA 3V3SA 4DF6A 2JE5A 5CERA 1YLTA 5DF7A 3C7VA 3UNWA 3VMAA 2VGKA 3E2KA 4LENA 1DJAA 5M1AA 3OPPA 4E3OA 5FI2A 2XLNA 4DXBA 1ALQA 4KG2A 2WADA 5CHJA 3GV9A 5JYOA 3Q7VA 5FSRA 3A3JA 1NZOA 4BJPA 4OQHA 1K55A 4U3TA 1SDEA 2C6WB 1FOFA 5FQMA 3OPRA 4X69A 5GL9A 3PBOA 5HAPA 1S6RA 1MPLA 4H8RA 1K6RA 4X6TA 1PZOA 4KZ7A 2XK1A 1W8YA 3PBQA 5FQIA 2Y2HA 3TOIA 4PM7A 5AQ7A 1IKGA 2Y2JA 3A3FA 5FATA 3C5AA 4IEDA 4X53A 3N7WA 2P9VB 4S2OA 4BQMA 2WZXA 4RX2A 3O3VA 5CRFA 3VOYA 1TDLA 2GDNA 3GQZA 1ERMA 3FZCA 3IHBA 3VP1A 4N1XA 5GLBA 4GOGA 3CG5A 3ZVTA 3ZVWA 3PBRA 3ZG0A 3VP2A 3MZEA 3PBTA 3S1YA 1PWDA 4BD1A 2Y91A 1FCOA 2OLVA 2XH9A 4GNUA 3ZG5A 4E3IA 1K57C 4N1HA 4S2LA 3BLMA 2HDRA 3MXRA 4OONA 1K6SA 2ZM0A 3OZHA 2Y2QA 5EVIB 1AXBA 2HP6A 3B3XA 1ONHA 4FH4A 4ZBEA 3NC8A 3CZDA 1JWZA 3UPOA 1H5XA 1KDWA 2X02A 1MWSA 3BFFA 1L0EA 5FQ9A 4GB7A 5KZHA 1WYCA 1H8YA 3LO7A 4Q8IA 4KQOA 3PAGA 4DDSA 5E2GA 4OQGA 4KZ9A 1PIOA 4Y0OA 5F83A 2X01A 3A3EA 3IHAA 4OPRA 3W4OA 2QZ6A 4JBFA 4QJGA 2J8YA 5HX9A 4PMAA 2WYXA 3BFDA 3UY6A 3Q7ZA 3BLSA 3ZG7B 4HBUA 3N4IA 5HL1A 1HZOA 5I94A 2G2WA 3C4OA 2WGWA 4MLLA 1SHVA 2J7VA 2XQZA 2XGNA 4S2NA 4BLMA 4C3QA 2Y2PA 3IF5A 5FI7A 3VSKA 4E6WA 4UA7A 4B4XA 5BOHA 5HAQA 3TSGA 4HEFA 2ZC5B 3MXSA 1K54C 2FFFB 3G2ZA 5FI6A 1XXMA 2PU2A 3SH9A 4JF5A 1W8QA 1LL9A 4MBHA 1VM1A 1K4FA 4OLDA 2Z2LB 4E3NA 4X56A 1PW1A 1ESUA 2XF3A 4KZBA 1ONGA 4WZ5C 4R3JA 4CJNA 1XGJA 2X71A 1HTZA 3C4PA 4UA9A 1GHMA 4GD8A 2OV5A 1GA0A 3LY3A 3UO9A 5J8XA 2ZLYA 5TR7A 5FQKA 3Q07A 3C7UA 5CGSA 4OOYA 4S2MA 3HUMA 1L2SA 1FSWA 2WKHA 4JF4A 4RVAA 5FA7A 4WMCA 5EVIC 3LEZA 2Y2OA 1KE4A 3DWZA 1YLJA 3NDGA 1K56D 4GD6A 3OPLA 1EROA 4KZ6A 3WS1A 1FR6A 1IKIA 3IXHA 4MEZA 4QD4A 1RCJA 4Y0UA 4GKUA 3RJUA 4PM9A 2HP9A 1O07A 2XFSA 2ZQAA 2ZC3B 1ES4A 1ERQA 1WE4A 4XXRA 4K91A 4ZJ1A 3VFHA 1PI4A 3NIAA 5KSCA 2XDMA 3SH8A 2P9VA 1K54A 1XKZA 1YM1A 4RA7A 3SS3A 3ZHHA 4B4ZA 1IYOA 1LI0A 2ZQ7A 1ZC2A 2Y59A 3FKWA 3HVFA 4A5RA 3ZG9B 3WS0A 2C5WB 3NI9A 5L2FA 4MBKA 5M18A 4WZ5A 1BUEA 3RXXA 4WEJA 3GRJA 3OC2A 3LCEA 4GDBA 1JTDA 5AQBA 2DNSA 1YQSA 4FD8A 4C75A 4XUXA 1BLSA 1MY8A 1XGIA 5A92A 1KGFA 3BM6A 4O7DA 2OLUA 5FAQA 3A3DA 3IXDA 4HESA 2EXAA 4ZJ3A 3Q1FA 3UPNA 3V39A 1C3BA 2XFTA 3G31A 3UDXA 1KVLA 4L0LA 5EVIA 5HW3A 3UDIA 3AGFA 1FCNA 3ZDJA 4GN2A 2Y2MA 1XX2A 4QU3A 5F1GA 3W4PA 1I2WA 1JWVA 1M40A 3O86A 1FSYA 4WMCD 4EQIA 4OOMA 1GCEA 5TGFA 4ZJ2A 3HLWA 1IELA 1KDSA 1W5DA 2EFXA 2ZC4B 4KQRA 4ZDXA 3MZFA 2Z2MB 3NBLA 4OVDA 2H10A 1SDNA 4E3JA 3N8LA 4B88A 2EX6A 4OPYA 4WELA 2EX8A 2JC7A 3GTCA 1KGGA 3EQUA 1NJ4A 1NYMA 3HREA 3SOIA 2I72A 3WS2A 3NDEA 1LHYA 3IT9A 2WAEA 2PU4A 2R9WA 2XD1A 2ZMAA 5GLCA 5F1FA 5CEBA 2QPNA 5CEDA 2RL3A 4R4SA 1CI8A 4OP8A 5CECA 1O7EA 5CTNA 1L0GA 2A49A 5E2EA 4BL2A 4RYEA 3ZNYA 4DXCA 4R23A 3EQVA 3DW0A 4HBTA 3UN7A 1MXOA 2ZQDA 2HDQA 2J9OA 1IYQA 2EFUA 4QHCA 4UHUA 4K0XA 4EBLA 1GHPA 4C6YA 1H8ZA 4DDYA 4S2JA 3LY4A 4ZTKA 2WK0A 1CI9A 1PW8A 1BLPA 1KE0A 1IEMA 4KG6A 5EVID 2PBYA 4LCLA 3SH7A 1IYPA 1J9MA 5HAIA 5EECA 1QMFA 3G34A 3MKFA 1I2SA 2Q9MA 4NK3A 4F94A 1Q2QA 1RGYA 3PAEA 1YLPA 5CHUA 1BLCA 2V1ZA 4QY6A 1N9BA 1XA1A 5D3OA 4EBNA 5EUAA 2J9PA 3CJMA 4N92A 4DKIA 3BEBA 1MWRA 3HBRA 4E3LA 1CEGA 1YMXA 2HP5A 1S0WA 4FSFA 1ZG6A 5GHXA 1SKFA 3Q82A 4JXSA 4XUZA 5CXWA 1K57A 2V20A 2CC1A 3WRZA 5KMWA 1IYSA 1MWUA 3IQAA 4R3BA 3PTEA 3SS4A 1EI5A 1CEFA 1OMEA 1E3UA 3BFCA 4P6BA 2Y55A 2E8IA 3ISGA 3VFFA 2G2UA 2WZZA 3I7JA 3IXGA 3IH9A 3UE1A 4N9KA 3G32A 5AQ9A 3UPPA 3TG9A 1LI9A 1MBLA 2ZQ8A 3FWLA 1DJBA 1VQQA 3IF6B 5EVLA 4IVIA 5GHYA 1YLWA 3AGDA 3JYIA 1WYBA 2XEPA 3S4XA 3VP0A 2XD5A 5A93A 1MKIA 4S2KA 3MBZA 2ZC6B 4QB8A 1DY6A 5CGXA 5EE8A 3GR2A 3ZFZA 4P85A 4EV4A 3BRMA 1E4DA 1RP5A 4QY5A 1K55C 5HARA 3G30A 3MKEA 4EWFA 3HLGA 3BFGA 1EWZA 4KG5A 2IWBA 2H5SA 1NY0A 2EX9A 4JXWA 1NZUA 4DE0A 4DE1A 3UDFA 5DTSA 1PWGA 4DE3A 3V3RA 3BECA 1G6AA 2BG1A 4Y7PA 5DVAA 4JKTA 2H0TA 4KENB 5DTKA 4Z9QA 1BLHA 3GVBA 1FCMA 5EOOA 3DTMA 4R4RA 3GMWA 1ES5A 2FFYA 4OOLA 3N8RA 4JPMA 1K38A 2Y4AA 3MFDA 1E3UD 4LV0A 4WM9A 1FR1A 3OCNA 3FV7A 3ZCZA 2EX2A 4KZ5A 2Y2GA 3G4PA 1DJCA 3FYZA 5FAPA 4OQIA 5G18A 3VP4A 5M19A 1JVJA 1BT5A 3IF6C 1E25A 3WWXA 4WZ4A 4OP5A 3VOZA 5E2FA 3G2YA 5KSHA 4JF6A 2IWCA 4K0WA 5F82A 3UE0A 1FQGA 5CTMA 1Z6FA 2RCXA 1U60A 5GHZA 4Y0TA 5DF8A 3V50A 3M6BA 1NRFA 5CHMA 4P0MA 1PZPA 1YMSA 4EUZA 1GHIA 3HL9A 4X55A 4N9LA 2XR0A 1N4OA 3ITBA 4BL3A 4MBFA 4JLFA 4YFMA 4LCMA 2HDSA 2IWDA 4PM6A 4GDNA 2DRWA 3HLEA 5GLAA 5TFQA 4S2NC 2Y2IA 4DE2A 2DCFA 4IVKA 1HVBA 2B5RA 2P74A 3M2JA 5FASA 1KGEA 1RGZA 3IXBA 4R1GA 4LV1A 3ZNTA 4E6XA 1NYYA 2Q9NA 5A90A 1PYYA 2WAFA 1G68A 1TEMA 3HLFA 3V5MA 2VGJA 1ESIA 5E2HA 3FKVA 2H0YA 2JBFA 1K4EA 3A3IA 1XA7A 3N6IA 1TDGA 3GSGA 3PBSA 3IWOA 4D2OA 4S2IA 1HD8A 3IF6A 1BTLA 3Q7VB 4OH0A 4CPKA 2QMIA 1K25A 3O87A 1PI5A 4WBGA 5JYPA 1M6KA 4FH2A 4E3MA 1I5QA 1PWCA 5U47A 4DRTA 2ZC7A 1K56A 3OPHA 5GLDA 3O88A 4E3KA 3Q81A 4JXGA 3ZGAB 2ZQ9A 5EOEA 3HLCA 2ZD8A 3M6HA 4YINA 4BD0A 4UAAA 1SCWA 4U0TA 3MZDA 2WKEA 4IBRA 3E2LA 3P09A 4UA6A 1NXYA 1BULA 3WRTA 3M2KA 4LV3A 3VSLA 4OLGA 1W79A 5FDHA 3ITAA 1YLZA 1BZAA 1Y54A 5AQAA 1KVMA 5A91A 4LV2A 4MNRA 1L0DA 3NY4A 3OCLA 5FAOA 3RXWA 2HPBA 1CK3A 4EBPA 3BYDA 4PPRA 1MWTA 3BFEA 3HUNA 4PM8A 4KZ4A 1ZKJA 2JCHA 1GA9A 3D4FA 4OKPA 4R0QA 2UWXA 4U0XA 4OQ0A 3UE3A 4WYYA 3NCKA 1KE3A 3IWQA 3N8SA 1ZG4A 1Q2PA 1L0FA 1YLYA 1W7FA 2ZQCA 5HFOA 3QNCA 2Y2KA 4KZAA 4PM5A 2WKIA 4OPQA 2V2FF 5CGWA 3G35A 3W4QA 5FQJA 5EPHA 5DTTA 2ZJ9A 4OPZA 3HUOA 1YT4A 3PBNA 4IBXA 2WGIA 4KQQA 3QNBA 4M3KA 2WGWB 3IWIA 4ZAMA 3VP3A 4KZ3A 5DF9A 5E43A 3ZG8B 3HLBA 4RX3A 2Y2LA 1ES3A 3IH8A 2ZM2A 2R9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LLB A;  2Y2N A;  2HDU A;  4X68 A;  1XPB A;  4S2P A;  3QHY A;  3HLD A;  4FCF A;  3SS5 A;  4P87 A;  1BSG A;  3P98 A;  4GZB A;  1ES2 A;  2WGV A;  4JXV A;  1XP4 A;  4ID4 A;  5FQQ A;  4BEN A;  1LL5 A;  1QME A;  2WUQ A;  4KZ8 A;  4WEK A;  2EXB A;  3AGE A;  5IHV A;  3DWK A;  1JTG A;  1TVF A;  3WS4 A;  1JWP A;  3CMZ A;  3WS5 A;  3W8K A;  2A3U A;  2OSU A;  2ZM8 A;  2BLS A;  3S22 A;  4NET A;  3V3S A;  4DF6 A;  2JE5 A;  5CER A;  1YLT A;  5DF7 A;  3C7V A;  3UNW A;  3VMA A;  2VGK A;  3E2K A;  4LEN A;  1DJA A;  5M1A A;  3OPP A;  4E3O A;  5FI2 A;  2XLN A;  4DXB A;  1ALQ A;  4KG2 A;  2WAD A;  5CHJ A;  3GV9 A;  5JYO A;  3Q7V A;  5FSR A;  3A3J A;  1NZO A;  4BJP A;  4OQH A;  1K55 A;  4U3T A;  1SDE A;  2C6W B;  1FOF A;  5FQM A;  3OPR A;  4X69 A;  5GL9 A;  3PBO A;  5HAP A;  1S6R A;  1MPL A;  4H8R A;  1K6R A;  4X6T A;  1PZO A;  4KZ7 A;  2XK1 A;  1W8Y A;  3PBQ A;  5FQI A;  2Y2H A;  3TOI A;  4PM7 A;  5AQ7 A;  1IKG A;  2Y2J A;  3A3F A;  5FAT A;  3C5A A;  4IED A;  4X53 A;  3N7W A;  2P9V B;  4S2O A;  4BQM A;  2WZX A;  4RX2 A;  3O3V A;  5CRF A;  3VOY A;  1TDL A;  2GDN A;  3GQZ A;  1ERM A;  3FZC A;  3IHB A;  3VP1 A;  4N1X A;  5GLB A;  4GOG A;  3CG5 A;  3ZVT A;  3ZVW A;  3PBR A;  3ZG0 A;  3VP2 A;  3MZE A;  3PBT A;  3S1Y A;  1PWD A;  4BD1 A;  2Y91 A;  1FCO A;  2OLV A;  2XH9 A;  4GNU A;  3ZG5 A;  4E3I A;  1K57 C;  4N1H A;  4S2L A;  3BLM A;  2HDR A;  3MXR A;  4OON A;  1K6S A;  2ZM0 A;  3OZH A;  2Y2Q A;  5EVI B;  1AXB A;  2HP6 A;  3B3X A;  1ONH A;  4FH4 A;  4ZBE A;  3NC8 A;  3CZD A;  1JWZ A;  3UPO A;  1H5X A;  1KDW A;  2X02 A;  1MWS A;  3BFF A;  1L0E A;  5FQ9 A;  4GB7 A;  5KZH A;  1WYC A;  1H8Y A;  3LO7 A;  4Q8I A;  4KQO A;  3PAG A;  4DDS A;  5E2G A;  4OQG A;  4KZ9 A;  1PIO A;  4Y0O A;  5F83 A;  2X01 A;  3A3E A;  3IHA A;  4OPR A;  3W4O A;  2QZ6 A;  4JBF A;  4QJG A;  2J8Y A;  5HX9 A;  4PMA A;  2WYX A;  3BFD A;  3UY6 A;  3Q7Z A;  3BLS A;  3ZG7 B;  4HBU A;  3N4I A;  5HL1 A;  1HZO A;  5I94 A;  2G2W A;  3C4O A;  2WGW A;  4MLL A;  1SHV A;  2J7V A;  2XQZ A;  2XGN A;  4S2N A;  4BLM A;  4C3Q A;  2Y2P A;  3IF5 A;  5FI7 A;  3VSK A;  4E6W A;  4UA7 A;  4B4X A;  5BOH A;  5HAQ A;  3TSG A;  4HEF A;  2ZC5 B;  3MXS A;  1K54 C;  2FFF B;  3G2Z A;  5FI6 A;  1XXM A;  2PU2 A;  3SH9 A;  4JF5 A;  1W8Q A;  1LL9 A;  4MBH A;  1VM1 A;  1K4F A;  4OLD A;  2Z2L B;  4E3N A;  4X56 A;  1PW1 A;  1ESU A;  2XF3 A;  4KZB A;  1ONG A;  4WZ5 C;  4R3J A;  4CJN A;  1XGJ A;  2X71 A;  1HTZ A;  3C4P A;  4UA9 A;  1GHM A;  4GD8 A;  2OV5 A;  1GA0 A;  3LY3 A;  3UO9 A;  5J8X A;  2ZLY A;  5TR7 A;  5FQK A;  3Q07 A;  3C7U A;  5CGS A;  4OOY A;  4S2M A;  3HUM A;  1L2S A;  1FSW A;  2WKH A;  4JF4 A;  4RVA A;  5FA7 A;  4WMC A;  5EVI C;  3LEZ A;  2Y2O A;  1KE4 A;  3DWZ A;  1YLJ A;  3NDG A;  1K56 D;  4GD6 A;  3OPL A;  1ERO A;  4KZ6 A;  3WS1 A;  1FR6 A;  1IKI A;  3IXH A;  4MEZ A;  4QD4 A;  1RCJ A;  4Y0U A;  4GKU A;  3RJU A;  4PM9 A;  2HP9 A;  1O07 A;  2XFS A;  2ZQA A;  2ZC3 B;  1ES4 A;  1ERQ A;  1WE4 A;  4XXR A;  4K91 A;  4ZJ1 A;  3VFH A;  1PI4 A;  3NIA A;  5KSC A;  2XDM A;  3SH8 A;  2P9V A;  1K54 A;  1XKZ A;  1YM1 A;  4RA7 A;  3SS3 A;  3ZHH A;  4B4Z A;  1IYO A;  1LI0 A;  2ZQ7 A;  1ZC2 A;  2Y59 A;  3FKW A;  3HVF A;  4A5R A;  3ZG9 B;  3WS0 A;  2C5W B;  3NI9 A;  5L2F A;  4MBK A;  5M18 A;  4WZ5 A;  1BUE A;  3RXX A;  4WEJ A;  3GRJ A;  3OC2 A;  3LCE A;  4GDB A;  1JTD A;  5AQB A;  2DNS A;  1YQS A;  4FD8 A;  4C75 A;  4XUX A;  1BLS A;  1MY8 A;  1XGI A;  5A92 A;  1KGF A;  3BM6 A;  4O7D A;  2OLU A;  5FAQ A;  3A3D A;  3IXD A;  4HES A;  2EXA A;  4ZJ3 A;  3Q1F A;  3UPN A;  3V39 A;  1C3B A;  2XFT A;  3G31 A;  3UDX A;  1KVL A;  4L0L A;  5EVI A;  5HW3 A;  3UDI A;  3AGF A;  1FCN A;  3ZDJ A;  4GN2 A;  2Y2M A;  1XX2 A;  4QU3 A;  5F1G A;  3W4P A;  1I2W A;  1JWV A;  1M40 A;  3O86 A;  1FSY A;  4WMC D;  4EQI A;  4OOM A;  1GCE A;  5TGF A;  4ZJ2 A;  3HLW A;  1IEL A;  1KDS A;  1W5D A;  2EFX A;  2ZC4 B;  4KQR A;  4ZDX A;  3MZF A;  2Z2M B;  3NBL A;  4OVD A;  2H10 A;  1SDN A;  4E3J A;  3N8L A;  4B88 A;  2EX6 A;  4OPY A;  4WEL A;  2EX8 A;  2JC7 A;  3GTC A;  1KGG A;  3EQU A;  1NJ4 A;  1NYM A;  3HRE A;  3SOI A;  2I72 A;  3WS2 A;  3NDE A;  1LHY A;  3IT9 A;  2WAE A;  2PU4 A;  2R9W A;  2XD1 A;  2ZMA A;  5GLC A;  5F1F A;  5CEB A;  2QPN A;  5CED A;  2RL3 A;  4R4S A;  1CI8 A;  4OP8 A;  5CEC A;  1O7E A;  5CTN A;  1L0G A;  2A49 A;  5E2E A;  4BL2 A;  4RYE A;  3ZNY A;  4DXC A;  4R23 A;  3EQV A;  3DW0 A;  4HBT A;  3UN7 A;  1MXO A;  2ZQD A;  2HDQ A;  2J9O A;  1IYQ A;  2EFU A;  4QHC A;  4UHU A;  4K0X A;  4EBL A;  1GHP A;  4C6Y A;  1H8Z A;  4DDY A;  4S2J A;  3LY4 A;  4ZTK A;  2WK0 A;  1CI9 A;  1PW8 A;  1BLP A;  1KE0 A;  1IEM A;  4KG6 A;  5EVI D;  2PBY A;  4LCL A;  3SH7 A;  1IYP A;  1J9M A;  5HAI A;  5EEC A;  1QMF A;  3G34 A;  3MKF A;  1I2S A;  2Q9M A;  4NK3 A;  4F94 A;  1Q2Q A;  1RGY A;  3PAE A;  1YLP A;  5CHU A;  1BLC A;  2V1Z A;  4QY6 A;  1N9B A;  1XA1 A;  5D3O A;  4EBN A;  5EUA A;  2J9P A;  3CJM A;  4N92 A;  4DKI A;  3BEB A;  1MWR A;  3HBR A;  4E3L A;  1CEG A;  1YMX A;  2HP5 A;  1S0W A;  4FSF A;  1ZG6 A;  5GHX A;  1SKF A;  3Q82 A;  4JXS A;  4XUZ A;  5CXW A;  1K57 A;  2V20 A;  2CC1 A;  3WRZ A;  5KMW A;  1IYS A;  1MWU A;  3IQA A;  4R3B A;  3PTE A;  3SS4 A;  1EI5 A;  1CEF A;  1OME A;  1E3U A;  3BFC A;  4P6B A;  2Y55 A;  2E8I A;  3ISG A;  3VFF A;  2G2U A;  2WZZ A;  3I7J A;  3IXG A;  3IH9 A;  3UE1 A;  4N9K A;  3G32 A;  5AQ9 A;  3UPP A;  3TG9 A;  1LI9 A;  1MBL A;  2ZQ8 A;  3FWL A;  1DJB A;  1VQQ A;  3IF6 B;  5EVL A;  4IVI A;  5GHY A;  1YLW A;  3AGD A;  3JYI A;  1WYB A;  2XEP A;  3S4X A;  3VP0 A;  2XD5 A;  5A93 A;  1MKI A;  4S2K A;  3MBZ A;  2ZC6 B;  4QB8 A;  1DY6 A;  5CGX A;  5EE8 A;  3GR2 A;  3ZFZ A;  4P85 A;  4EV4 A;  3BRM A;  1E4D A;  1RP5 A;  4QY5 A;  1K55 C;  5HAR A;  3G30 A;  3MKE A;  4EWF A;  3HLG A;  3BFG A;  1EWZ A;  4KG5 A;  2IWB A;  2H5S A;  1NY0 A;  2EX9 A;  4JXW A;  1NZU A;  4DE0 A;  4DE1 A;  3UDF A;  5DTS A;  1PWG A;  4DE3 A;  3V3R A;  3BEC A;  1G6A A;  2BG1 A;  4Y7P A;  5DVA A;  4JKT A;  2H0T A;  4KEN B;  5DTK A;  4Z9Q A;  1BLH A;  3GVB A;  1FCM A;  5EOO A;  3DTM A;  4R4R A;  3GMW A;  1ES5 A;  2FFY A;  4OOL A;  3N8R A;  4JPM A;  1K38 A;  2Y4A A;  3MFD A;  1E3U D;  4LV0 A;  4WM9 A;  1FR1 A;  3OCN A;  3FV7 A;  3ZCZ A;  2EX2 A;  4KZ5 A;  2Y2G A;  3G4P A;  1DJC A;  3FYZ A;  5FAP A;  4OQI A;  5G18 A;  3VP4 A;  5M19 A;  1JVJ A;  1BT5 A;  3IF6 C;  1E25 A;  3WWX A;  4WZ4 A;  4OP5 A;  3VOZ A;  5E2F A;  3G2Y A;  5KSH A;  4JF6 A;  2IWC A;  4K0W A;  5F82 A;  3UE0 A;  1FQG A;  5CTM A;  1Z6F A;  2RCX A;  1U60 A;  5GHZ A;  4Y0T A;  5DF8 A;  3V50 A;  3M6B A;  1NRF A;  5CHM A;  4P0M A;  1PZP A;  1YMS A;  4EUZ A;  1GHI A;  3HL9 A;  4X55 A;  4N9L A;  2XR0 A;  1N4O A;  3ITB A;  4BL3 A;  4MBF A;  4JLF A;  4YFM A;  4LCM A;  2HDS A;  2IWD A;  4PM6 A;  4GDN A;  2DRW A;  3HLE A;  5GLA A;  5TFQ A;  4S2N C;  2Y2I A;  4DE2 A;  2DCF A;  4IVK A;  1HVB A;  2B5R A;  2P74 A;  3M2J A;  5FAS A;  1KGE A;  1RGZ A;  3IXB A;  4R1G A;  4LV1 A;  3ZNT A;  4E6X A;  1NYY A;  2Q9N A;  5A90 A;  1PYY A;  2WAF A;  1G68 A;  1TEM A;  3HLF A;  3V5M A;  2VGJ A;  1ESI A;  5E2H A;  3FKV A;  2H0Y A;  2JBF A;  1K4E A;  3A3I A;  1XA7 A;  3N6I A;  1TDG A;  3GSG A;  3PBS A;  3IWO A;  4D2O A;  4S2I A;  1HD8 A;  3IF6 A;  1BTL A;  3Q7V B;  4OH0 A;  4CPK A;  2QMI A;  1K25 A;  3O87 A;  1PI5 A;  4WBG A;  5JYP A;  1M6K A;  4FH2 A;  4E3M A;  1I5Q A;  1PWC A;  5U47 A;  4DRT A;  2ZC7 A;  1K56 A;  3OPH A;  5GLD A;  3O88 A;  4E3K A;  3Q81 A;  4JXG A;  3ZGA B;  2ZQ9 A;  5EOE A;  3HLC A;  2ZD8 A;  3M6H A;  4YIN A;  4BD0 A;  4UAA A;  1SCW A;  4U0T A;  3MZD A;  2WKE A;  4IBR A;  3E2L A;  3P09 A;  4UA6 A;  1NXY A;  1BUL A;  3WRT A;  3M2K A;  4LV3 A;  3VSL A;  4OLG A;  1W79 A;  5FDH A;  3ITA A;  1YLZ A;  1BZA A;  1Y54 A;  5AQA A;  1KVM A;  5A91 A;  4LV2 A;  4MNR A;  1L0D A;  3NY4 A;  3OCL A;  5FAO A;  3RXW A;  2HPB A;  1CK3 A;  4EBP A;  3BYD A;  4PPR A;  1MWT A;  3BFE A;  3HUN A;  4PM8 A;  4KZ4 A;  1ZKJ A;  2JCH A;  1GA9 A;  3D4F A;  4OKP A;  4R0Q A;  2UWX A;  4U0X A;  4OQ0 A;  3UE3 A;  4WYY A;  3NCK A;  1KE3 A;  3IWQ A;  3N8S A;  1ZG4 A;  1Q2P A;  1L0F A;  1YLY A;  1W7F A;  2ZQC A;  5HFO A;  3QNC A;  2Y2K A;  4KZA A;  4PM5 A;  2WKI A;  4OPQ A;  2V2F F;  5CGW A;  3G35 A;  3W4Q A;  5FQJ A;  5EPH A;  5DTT A;  2ZJ9 A;  4OPZ A;  3HUO A;  1YT4 A;  3PBN A;  4IBX A;  2WGI A;  4KQQ A;  3QNB A;  4M3K A;  2WGW B;  3IWI A;  4ZAM A;  3VP3 A;  4KZ3 A;  5DF9 A;  5E43 A;  3ZG8 B;  3HLB A;  4RX3 A;  2Y2L A;  1ES3 A;  3IH8 A;  2ZM2 A;  2R9X A; 
#chains in the Genus database with same CATH topology
 3OOV A;  3QHY A;  3HLD A;  4FCF A;  3OLO A;  1BSG A;  4GZB A;  3H82 A;  4JXV A;  3QP5 A;  1XP4 A;  1HLU P;  2VV8 A;  4BEN A;  3AGE A;  1CQA A;  3CMZ A;  5L07 A;  2A3U A;  2ZM8 A;  2BLS A;  3S22 A;  1TS0 A;  2P7J A;  5DF7 A;  3UNW A;  2ZMF A;  3VMA A;  2VGK A;  1Y28 A;  4LEN A;  4E3O A;  4DXB A;  1LT0 A;  3JVV A;  4CLC D;  5MC7 A;  2C6W B;  1FOF A;  2EWW A;  3PBO A;  1S6R A;  2V1B A;  4H8R A;  4X6T A;  2XK1 A;  1W8Y A;  5FQI A;  1V9Y A;  4IED A;  4BQM A;  2VV6 A;  1ERM A;  3IHB A;  2I9V A;  3ZVW A;  1H0M A;  3B33 A;  1FCO A;  3NOT C;  3H7W B;  4GNU A;  4O0P A;  4S2L A;  3GDI A;  2FH5 A;  1K6S A;  1JWZ A;  3UPO A;  1KDW A;  2PRF A;  4I3A A;  5FQ9 A;  1G28 A;  3PAG A;  1WA9 A;  2JKR M;  2J8Y A;  5HX9 A;  4PMA A;  3BFD A;  3Q7Z A;  1XJ4 A;  2WGW A;  1UWN X;  1SHV A;  2XGN A;  4BLM A;  3MQ0 A;  3IF5 A;  5FI7 A;  4UA7 A;  1NWZ A;  4XT2 A;  3UB7 A;  3MXS A;  3G2Z A;  3OBF A;  2PU2 A;  2GX5 A;  1VM1 A;  4B9O A;  4E3N A;  4X56 A;  4KZB A;  3CUE C;  5IU1 A;  2J3W A;  1HTZ A;  3LY3 A;  2BTF P;  3C7U A;  4JGP A;  3HUM A;  1L2S A;  2WKH A;  3LEZ A;  2Y2O A;  1YLJ A;  3BY8 A;  3NDG A;  4JGO A;  4GD6 A;  1JNU A;  1FR6 A;  2JKF A;  5FEG A;  2ZC3 B;  1ES4 A;  5KSC A;  1K54 A;  2HGV A;  3EEA A;  1LI0 A;  2ZQ7 A;  1ZC2 A;  3ZG9 B;  3NI9 A;  5AQB A;  2DNS A;  4GJ4 A;  3H7W A;  1KGF A;  2OLU A;  3UPN A;  2EXA A;  2INW A;  3G31 A;  1KVL A;  3IBJ A;  1FCN A;  2O99 A;  2W3G A;  4EQI A;  1FSY A;  3T4S A;  4NKP A;  5TGF A;  4ZJ2 A;  1W5D A;  3CHW P;  4OVD A;  2EX6 A;  4WEL A;  2EX8 A;  3EQU A;  1NYM A;  3HRE A;  3GEC A;  3LIF A;  4R70 A;  1LHY A;  2PU4 A;  2XD1 A;  4K08 A;  5CEB A;  5CED A;  4OP8 A;  3LFV A;  1L0G A;  2A49 A;  4XT2 B;  4BMW A;  4BL2 A;  4RYE A;  3ZNY A;  2ACG A;  1KOU A;  4IUH A;  3K3C A;  4PHT A;  1T1A A;  2IA2 A;  2ZQD A;  4QHC A;  4DDY A;  1YAX A;  4L9F A;  4G3V A;  1IYP A;  5HAI A;  3B42 A;  3G34 A;  3PHY A;  2O9A A;  1YLP A;  4QY6 A;  5I5L A;  5EUA A;  2J9P A;  1CEG A;  4R3A A;  1S0W A;  4P6Z S;  1SKF A;  4HY8 A;  1K57 A;  4Q0J A;  2JKG A;  3WRZ A;  5EVE A;  3IQA A;  4IUK A;  5J7E A;  4P6B A;  2Y55 A;  3TE8 A;  3MQO A;  3TRC A;  3DBA A;  3G32 A;  2OWJ A;  3B47 A;  1YKD A;  1LI9 A;  3FWL A;  2V9A A;  2ZQ8 A;  1MC0 A;  5GHY A;  1PFL A;  4WL9 A;  2ZOI A;  2XD5 A;  3A0R A;  5A93 A;  2O0Y A;  4MCW A;  3MBZ A;  2KOI A;  5CGX A;  3LI8 A;  3GR2 A;  4P85 A;  2VJW A;  3PXP A;  4QY5 A;  5C5K A;  2QKP A;  1TS8 A;  2M7U A;  4KG5 A;  3T1S A;  1F2K A;  4Y7P A;  2WKR A;  1G6A A;  3DTI A;  1LSV A;  2H0T A;  4KEN B;  5DTK A;  1BLH A;  1FCM A;  2OWH A;  3QP6 A;  2Y4A A;  3MFD A;  2O9B A;  4LV0 A;  4WM9 A;  3OCN A;  4QPR A;  4KUK A;  2VGL S;  3RTY A;  2EX2 A;  4KZ5 A;  2KDK A;  3G4P A;  1DJC A;  3UB9 A;  1BT5 A;  2JKR I;  2J3T D;  4JF6 A;  4MN6 A;  2PYR A;  5GHZ A;  4UQI M;  4EW7 A;  4Y0T A;  3V50 A;  3M6B A;  3EGD C;  1GHI A;  4X55 A;  2XR0 A;  4II7 A;  2JKT M;  4G3W A;  3KYZ A;  2Y8H A;  2DRW A;  3KSH A;  1T1B A;  2XRN A;  4IVK A;  3ZNT A;  4R1G A;  4LV1 A;  4E6X A;  5A90 A;  1NYY A;  2Q9N A;  2K7S A;  1TEM A;  4YOF A;  3FKV A;  4LRY C;  2H0Y A;  1K4E A;  2XA7 S;  3IWO A;  4D2O A;  3Q7V B;  4CPK A;  1PI5 A;  4FH2 A;  4F3L B;  5U47 A;  4DRT A;  3OPH A;  5GLD A;  4HP4 A;  3LR4 A;  2ZQ9 A;  5EOE A;  3HLC A;  4BD0 A;  1SCW A;  4IBR A;  1NXY A;  2OAP 1;  3WRT A;  2PYP A;  3UB6 A;  4LV3 A;  1Y54 A;  5KIZ A;  5AVE A;  5AQA A;  4MNR A;  3NY4 A;  1GSX A;  1N9O A;  5FAO A;  4EBP A;  3BYD A;  5LBR A;  4PM8 A;  4KZ4 A;  5IT5 A;  4OKP A;  4R0Q A;  5EM0 A;  4U0X A;  4ME4 A;  2DMW A;  3HJI A;  5A8B A;  1VEU B;  3IWQ A;  1VET B;  3LIA A;  3HJK A;  5J3W A;  4PM5 A;  4CLC E;  3EEH A;  2PAV P;  4OPQ A;  1Y4O A;  2ZJ9 A;  4HHD A;  1YT4 A;  3O5Y A;  4IBX A;  2WGI A;  3VP3 A;  3ZG8 B;  3HLB A;  4RX3 A;  2ZM2 A;  2R9X A;  1LLB A;  1K0K A;  2Y2N A;  3MR0 A;  3P98 A;  4HP9 A;  3NHQ A;  4ETX A;  2Q0O A;  3DWK A;  1JWP A;  2OSU A;  3V3S A;  2LB5 A;  3MQQ A;  4HH2 A;  2JE5 A;  5CER A;  4DF6 A;  5FEF A;  1YLT A;  5HL6 A;  3LI9 A;  3D9Y A;  3BWL A;  3E2K A;  5M1A A;  2XLN A;  2PR5 A;  4KG2 A;  5CHJ A;  3Q7V A;  5FSR A;  3A3J A;  3A0V A;  4U3T A;  3MSH A;  5FQM A;  3OPR A;  4F3L A;  1MPL A;  1K6R A;  4KZ7 A;  3NOU C;  3PBQ A;  3W8K A;  3TOI A;  4PM7 A;  3A3F A;  4Q0I A;  1DP9 A;  4RX2 A;  3O3V A;  3GQZ A;  2GDN A;  4Y2F A;  5DKL A;  3VP1 A;  4GOG A;  3CG5 A;  1P9R A;  3ZVT A;  3PBT A;  1SZV A;  2OLV A;  4LFU A;  3PYP A;  2HDR A;  2VA0 A;  2QJ7 A;  1ODV A;  3SZT A;  2Y2Q A;  2OOL A;  1YPR A;  1VEU A;  1VET A;  4KQO A;  4DDS A;  4O01 A;  4KZ9 A;  2X01 A;  3A3E A;  1IFQ A;  3IHA A;  5HDS A;  2QZ6 A;  3W4O A;  4X1M A;  2WYX A;  3MJQ A;  3ZG7 B;  3N4I A;  5HL1 A;  5I94 A;  4Y13 A;  3DAV A;  3VE3 A;  4S2N A;  2Y2P A;  4B4X A;  2VV7 A;  4HEF A;  3KYQ A;  2FFF B;  3SH9 A;  3UB5 P;  4JF5 A;  1LL9 A;  4MBH A;  4BWI A;  2Z2L B;  1ESU A;  1UGU A;  1OJ5 A;  5J8X A;  1GHM A;  4GD8 A;  1GA0 A;  4O8G A;  3S7N A;  5DJT A;  3NUL A;  3Q07 A;  1ACF A;  5CGS A;  4RVA A;  5FA7 A;  5EVI C;  3DWZ A;  5FDS A;  1K56 D;  3OPL A;  1ERO A;  4EU0 A;  3WS1 A;  3IXH A;  4Q0H A;  3VE4 A;  3T12 B;  1RCJ A;  3RJU A;  1LL8 A;  2JKT I;  2XFS A;  2ZQA A;  2Z6D A;  4XXR A;  2YKF A;  2XDM A;  3SH8 A;  2CMN A;  4B4Z A;  2NUP C;  2Y59 A;  3HVF A;  5L2F A;  1TS7 A;  3RXX A;  4WEJ A;  3OC2 A;  4GDB A;  4C75 A;  4EUV A;  1XGI A;  3EGX C;  5FAQ A;  3A3D A;  4ZJ3 A;  1T1C A;  3V39 A;  3E4O A;  3UDX A;  4L0L A;  2K31 A;  4WN5 A;  5HW3 A;  3UDI A;  3ZDJ A;  4GN2 A;  2Y2M A;  4QU3 A;  1M40 A;  1UWP X;  4OOM A;  1GCE A;  1TD5 A;  3K2N A;  2ZC4 B;  2Z2M B;  3NBL A;  2H10 A;  4E3J A;  3N8L A;  4B88 A;  5HDC A;  4X1L A;  3F1O B;  3SOI A;  4IHQ A;  2I72 A;  3LIC A;  2WAE A;  2ZMA A;  3QP4 A;  1D7E A;  1O7E A;  2B02 A;  4R23 A;  3EQV A;  3DW0 A;  1MXO A;  2HDQ A;  3T4Q A;  1CI9 A;  4KG6 A;  5F69 A;  2PBD P;  1CJF A;  3MKF A;  1I2S A;  2Q9M A;  4HI4 A;  3BJN A;  1Q2Q A;  4F94 A;  3PAE A;  1BLC A;  2W27 A;  1N9B A;  4GHI B;  4DKI A;  1YMX A;  4L9E A;  2FZ0 A;  4JXS A;  5CXW A;  5G4Y A;  2V20 A;  4NEE D;  5KMW A;  1PNE A;  3T4K A;  1E3U A;  5L8M A;  3VFF A;  3I7J A;  3FPW A;  3IH9 A;  3TG9 A;  2GZA A;  3KX0 X;  1MBL A;  1DJB A;  3MS6 A;  1F5M A;  1WYB A;  2XEP A;  1MKI A;  3LGO A;  4QB8 A;  1ZTU A;  4NG2 A;  1N9L A;  3IS2 B;  3HLG A;  4NXE A;  1EWZ A;  4DE0 A;  4DE1 A;  3F1O A;  3V3R A;  3BEC A;  4HJ4 A;  2BG1 A;  3G6O A;  4IJG A;  1TF1 A;  1P0Z A;  4R4R A;  3LR5 A;  3N8R A;  1ZHH B;  1FR1 A;  2P04 A;  3FV7 A;  2Y2G A;  3FYZ A;  2PD8 A;  4QWO A;  3IF6 C;  1E25 A;  3WWX A;  3PR6 A;  5KSH A;  4K0W A;  1X0O A;  3RH8 B;  5DF8 A;  5EV0 A;  1NRF A;  2D02 A;  4P0M A;  1P97 A;  1PZP A;  3R4K A;  1T18 A;  1CF0 A;  1N4O A;  4GHI A;  4BL3 A;  2PR6 A;  4PM6 A;  3JPU A;  3HLE A;  5F6A A;  4DE2 A;  2DCF A;  2KX6 A;  5EM1 A;  4AFI A;  1PYY A;  2WAF A;  2VGJ A;  2J80 A;  1ESI A;  3NEC A;  3GSG A;  3PBS A;  4S2I A;  1BTL A;  4CLC C;  5IS1 A;  2QMI A;  3O87 A;  1PWC A;  1OTB A;  3O88 A;  4E3K A;  3CI6 A;  3ZGA B;  4YIN A;  4UAA A;  4UA6 A;  4U0T A;  3MZD A;  5HWW A;  3E2L A;  4EXO A;  1MZU A;  3M2K A;  3VSL A;  3A0S A;  4OLG A;  3ITA A;  1YLZ A;  4I3J A;  4LV2 A;  3OCL A;  4PKY G;  1CK3 A;  5DFY A;  4PPR A;  3IX8 A;  3U4L P;  4BBV A;  1ZKJ A;  2JCH A;  3UE3 A;  4B93 A;  4WYY A;  3NCK A;  1KE3 A;  3NOP C;  1Q2P A;  1YLY A;  1W7F A;  3VOL A;  3ICY A;  5TBM B;  2Y2K A;  2ZBB A;  1Z09 A;  5CGW A;  5FQJ A;  5EPH A;  5DTT A;  2W3F A;  4OPZ A;  3PBN A;  5DF9 A;  5E43 A;  4D60 A;  2XRO A;  2Y2L A;  1S1Y A;  4EEU A;  1LSX A;  1XPB A;  1D06 A;  3SS5 A;  4KQD A;  4P87 A;  4ARZ B;  4ID4 A;  5FQQ A;  1LL5 A;  4JGQ A;  1QME A;  2WUQ A;  4KZ8 A;  4WEK A;  5IHV A;  3KSF A;  1JTG A;  1TVF A;  3WS4 A;  3WS5 A;  3CIT A;  3FG8 A;  4Z1W A;  5FI2 A;  2W1T B;  2D01 A;  3JVU A;  3CPT B;  1ALQ A;  2WAD A;  3GV9 A;  5JYO A;  1K55 A;  4X69 A;  2Y2H A;  5FAT A;  2Y2J A;  3N7W A;  2P9V B;  2ZL1 B;  2WZX A;  4JGR A;  5CRF A;  1TDL A;  1OJG A;  3FZC A;  5GLB A;  4MN7 A;  1V9Z A;  3UME A;  3VP2 A;  3MXQ A;  1PWD A;  4BD1 A;  2Y91 A;  5L09 A;  3UMD A;  4E3I A;  1K57 C;  4N1H A;  3BLM A;  1PRQ A;  4OON A;  3MXR A;  4NXG A;  5EVI B;  2HP6 A;  1L3L A;  3DTK A;  1ONH A;  3IBR A;  4ZBE A;  3NC8 A;  2VKS A;  3L7H A;  3CZD A;  1H5X A;  2X02 A;  1MWS A;  3BFF A;  5KZH A;  3F1P B;  4G3K A;  2BAS A;  1H8Y A;  1XFQ A;  4HOI A;  2HF6 A;  5TBM A;  1LSW A;  4OQG A;  3LID A;  3S7Q A;  2NUT C;  5F83 A;  4QJG A;  3UY6 A;  3BLS A;  2G2W A;  3KSG A;  3CLO A;  3VSK A;  3KYE A;  4GW9 A;  2ZC5 B;  4ZRR A;  5FI6 A;  1XXM A;  3BY9 A;  4YWZ A;  1W8Q A;  4ARZ A;  1NLY A;  4GCZ A;  2GJ3 A;  1PW1 A;  4WZ5 C;  4R3J A;  1YSQ A;  2HJE A;  3C4P A;  4FOF A;  2OV5 A;  3UO9 A;  2ZLY A;  5FQK A;  5HD5 A;  4S2M A;  4WMC A;  1XJ2 A;  3W2Z A;  1KE4 A;  2W1T A;  1TS6 A;  3CPT A;  4KZ6 A;  3QP2 A;  4Y15 A;  5J4E A;  1IKI A;  4Y0U A;  2HP9 A;  1OT9 A;  3T1R A;  3MFX A;  1D1J A;  3VFH A;  4K91 A;  4ZJ1 A;  1PI4 A;  3NIA A;  4BBU A;  2P9V A;  1XKZ A;  2ZL1 A;  2VK3 A;  4RA7 A;  4A5R A;  3FKW A;  2C5W B;  1BUE A;  3LCE A;  1JTD A;  2B18 A;  5F5Y A;  1BLS A;  1MY8 A;  3BM6 A;  4HES A;  3ZQ5 A;  3Q1F A;  4WUJ A;  2M7V A;  5EVI A;  1G6O A;  5F1G A;  3W4P A;  1I2W A;  1JWV A;  5AVF A;  3UB8 A;  1GSW A;  4CQH A;  4HNB A;  4ZDX A;  3EOI A;  3LIE A;  3MZF A;  3P01 A;  1SDN A;  2QJ5 A;  4OPY A;  1KGG A;  2W3D A;  1FIL A;  3NDE A;  5F1F A;  5EFW A;  3MF0 A;  3H82 B;  4R4S A;  5CTN A;  3T4T A;  5E2E A;  1XJ6 A;  4DXC A;  2WKQ A;  4WLA A;  4HBT A;  1G5U A;  3RFB A;  1IYQ A;  4K0X A;  4EBL A;  4L9G A;  4C6Y A;  2J3T C;  2PHY A;  4S2J A;  3LY4 A;  2PBY A;  4HH3 A;  3SH7 A;  4YNR A;  5EEC A;  1QMF A;  3BQ8 A;  2HJ9 C;  2V1Z A;  1XA1 A;  2V8F A;  4EBN A;  3CJM A;  1MWR A;  3HBR A;  2HP5 A;  3LUQ A;  1T19 A;  1ZG6 A;  5CX7 A;  3Q82 A;  4NXF A;  2CC1 A;  1IYS A;  1MWU A;  3D72 A;  4R3B A;  3PTE A;  3SS4 A;  4E04 A;  1S4S A;  3BFC A;  2VZW A;  1S66 L;  2E8I A;  1DRM A;  3IXG A;  1OTE A;  5AQ9 A;  5K5B A;  1DP6 A;  1W63 M;  3IF6 B;  1VQQ A;  4IVI A;  3P7N A;  4R38 A;  1YLW A;  3LR0 A;  2PT7 A;  2ZC6 B;  3IX3 A;  4I38 A;  3C38 A;  5EE8 A;  3T4O A;  3BRM A;  1E4D A;  5HAR A;  3G30 A;  4P6Z M;  4UQI S;  3QP1 A;  3BFG A;  3ULF A;  2Y79 A;  3E98 A;  2H5S A;  1NY0 A;  4JXW A;  3V67 A;  3CUE A;  3EWK A;  4JKT A;  3D3O A;  3GVB A;  5EOO A;  3S7P A;  1VB6 A;  1SKO B;  2FFY A;  4OOL A;  2UV0 E;  4Y3I A;  1E3U D;  4CLC B;  3T1Q B;  4FUW A;  5M19 A;  1JVJ A;  4DN0 A;  3VOZ A;  4PKY A;  3G2Y A;  5F82 A;  3UE0 A;  1Z6F A;  2RCX A;  5CHM A;  3F1N B;  1YMS A;  4EUZ A;  4FTX A;  1FIK A;  4N9L A;  4LRX C;  2JN7 A;  1N9N A;  3ITB A;  4LCM A;  2HDS A;  3C30 A;  4HQA A;  5GLA A;  5TFQ A;  1MKM A;  4S2N C;  4GS9 B;  2Y2I A;  2B5R A;  4X25 A;  1KGE A;  2VEA A;  3IXB A;  1BYW A;  3LYX A;  5TJJ A;  4BBT A;  1G68 A;  2VGL M;  3V5M A;  5E2H A;  2JBF A;  3A3I A;  1XA7 A;  1TDG A;  1OTD A;  1HD8 A;  3IF6 A;  1K25 A;  4WBG A;  1STZ A;  1M6K A;  1I5Q A;  2ZC7 A;  1K56 A;  3Q81 A;  1XFN A;  4JXG A;  2ZD8 A;  3M6H A;  1S67 L;  4RQ9 A;  2ZOH A;  3C8C A;  2L1M A;  1NLZ A;  2A24 B;  3E0Y A;  4PAU A;  1BZA A;  2V0U A;  5A91 A;  1L0D A;  5HWV A;  3RXW A;  2HPB A;  1MWT A;  3BFE A;  1XJ3 A;  2XA7 M;  1SKO A;  1GA9 A;  3CAX A;  4OQ0 A;  2R78 A;  4CLC A;  1L0F A;  2OAQ 1;  2ZQC A;  5HFO A;  4KZA A;  2WKI A;  1AWI A;  3W4Q A;  4KUO A;  3HUO A;  4M3K A;  3IWI A;  2L4R A;  4EET B;  2B95 A;  3BQA A;  2HDU A;  4X68 A;  3F1N A;  4S2P A;  1ES2 A;  2WGV A;  2EXB A;  5DFX A;  4I39 A;  3KO6 A;  4GS9 A;  2YKH A;  4NET A;  3C7V A;  2G7U A;  2E8J A;  1DJA A;  3FPV A;  3OPP A;  5AJG A;  1NZO A;  4BJP A;  4I5S A;  4OQH A;  2M1C A;  1SDE A;  5GL9 A;  3E4P A;  5HAP A;  3LEQ A;  1PZO A;  5HD3 A;  3E4Q A;  5AQ7 A;  1IKG A;  3C5A A;  4X53 A;  4S2O A;  5HPI A;  3VOY A;  2A24 A;  4N1X A;  4M4X A;  3PBR A;  3FC7 A;  3ZG0 A;  3MZE A;  1F98 A;  3S1Y A;  2XH9 A;  3ZG5 A;  3BW6 A;  4UEY A;  4Y17 A;  2ZM0 A;  3OZH A;  1DP8 A;  1AXB A;  3B3X A;  4EER A;  4FH4 A;  4MMN A;  3KSI A;  3CWF A;  1L0E A;  4GB7 A;  1WYC A;  3LO7 A;  5HDD A;  4Q8I A;  2GNX A;  5E2G A;  4Y5F A;  1PIO A;  4Y0O A;  4OPR A;  4JBF A;  2WKP A;  3IS2 A;  4DMZ A;  4HBU A;  1HZO A;  3C4O A;  4MLL A;  2J7V A;  2XQZ A;  4C3Q A;  4E6W A;  5BOH A;  5HAQ A;  3TSG A;  4ESP A;  1K54 C;  2V1A A;  1K4F A;  1IOU A;  4OLD A;  2XF3 A;  1ONG A;  2VX8 A;  4CJN A;  1XGJ A;  2X71 A;  4UA9 A;  1VHM A;  5TR7 A;  1A0K A;  4OOY A;  1FSW A;  4JF4 A;  3VV4 A;  3S7O A;  4MEZ A;  4HIA A;  4QD4 A;  4GKU A;  4PM9 A;  4R6L A;  1O07 A;  2EWV A;  5DKK A;  1ERQ A;  1WE4 A;  1YM1 A;  3HCY A;  3SS3 A;  3ZHH A;  2AVX A;  1IYO A;  3WS0 A;  4NXB A;  5M18 A;  4MBK A;  4WZ5 A;  3GRJ A;  1YQS A;  4FD8 A;  4XUX A;  4EES A;  5A92 A;  3T50 A;  4O7D A;  3IXD A;  5HSQ A;  1C3B A;  2XFT A;  3AGF A;  1P9W A;  1XX2 A;  3O86 A;  3DTE A;  4WMC D;  3HLW A;  1IEL A;  1KDS A;  2V0W A;  2EFX A;  4KQR A;  2MJ6 A;  4EQ1 A;  5DJU A;  4H6J B;  2JC7 A;  3GTC A;  1NJ4 A;  3R7W B;  3WS2 A;  3IT9 A;  2R9W A;  4LPZ A;  5GLC A;  2QHK A;  2QPN A;  2RL3 A;  1CI8 A;  5CEC A;  3C2W A;  3IX4 A;  4MN5 A;  1F9I A;  2PDR A;  3UN7 A;  2J9O A;  2EFU A;  4UHU A;  2PD7 A;  1GHP A;  1OT6 A;  1H8Z A;  3U2A A;  4MDZ A;  2KLI A;  4ZTK A;  2WK0 A;  1PW8 A;  1BLP A;  1KE0 A;  1IEM A;  5EVI D;  4LCL A;  1J9M A;  5L10 A;  4NK3 A;  1RGY A;  5CHU A;  5D3O A;  1J3W A;  1OTI A;  5HZH A;  2A2L A;  4N92 A;  4E3L A;  3BEB A;  3H9W A;  4FSF A;  5GHX A;  4XUZ A;  4GLQ A;  1EI5 A;  2Z6C A;  1CEF A;  1OME A;  4ETZ A;  3ISG A;  2G2U A;  2WZZ A;  3QP8 A;  2K2N A;  3UE1 A;  4N9K A;  3UPP A;  5EVL A;  3AGD A;  1S1Z A;  3JYI A;  3S4X A;  3VP0 A;  4HJ3 A;  4S2K A;  1W63 Q;  1DY6 A;  1H3Q A;  3ZFZ A;  4EV4 A;  1RP5 A;  3LIB A;  1K55 C;  3MKE A;  4EWF A;  2IWB A;  4DJ2 A;  2EX9 A;  4H6J A;  1NZU A;  3UDF A;  5DTS A;  1PWG A;  4DE3 A;  3R7W A;  5FL3 A;  5DVA A;  1YSP A;  4I3I A;  4Z9Q A;  1H8M A;  2VLG A;  3MMH A;  3DTM A;  3GMW A;  1ES5 A;  3L9K A;  4JPM A;  1K38 A;  2O9C A;  3ZCZ A;  2QYB A;  5FAP A;  4OQI A;  5G18 A;  3VP4 A;  3F1P A;  4EEP A;  3T1X A;  4WZ4 A;  4LRZ E;  4OP5 A;  3T4L A;  5E2F A;  2IWC A;  1FQG A;  5CTM A;  1U60 A;  4DJ3 A;  1EW0 A;  3ZYT A;  5HPF A;  3HL9 A;  4MBF A;  4JLF A;  4LLO B;  4YFM A;  2IWD A;  4GDN A;  3UE6 A;  1S4R A;  1HVB A;  3SW1 A;  2P74 A;  3M2J A;  5FAS A;  1RGZ A;  5G4Z A;  3T4J A;  3HLF A;  3NJA A;  2L0W A;  2P08 A;  3N6I A;  4HJ6 A;  2HV1 A;  4WF0 A;  4OH0 A;  5JYP A;  4E3M A;  2V8C A;  1OPX A;  2WKE A;  3P09 A;  1BUL A;  4LGW A;  2W3E A;  2QWS A;  1W79 A;  5FDH A;  1KVM A;  2EA9 A;  5HWT A;  2W0N A;  1GSV A;  2JHE A;  5F68 A;  3HUN A;  2ZMV A;  2HZ5 A;  3D4F A;  2UWX A;  2XSS A;  3N8S A;  1ZG4 A;  3TJZ C;  3QNC A;  3TW8 A;  3LR3 A;  2V2F F;  3G35 A;  2H28 A;  2LB9 A;  2W1R A;  1NRJ A;  2W3H A;  4KQQ A;  3QNB A;  2WGW B;  4ZAM A;  4KZ3 A;  1OTA A;  3K3D A;  1ES3 A;  3IH8 A; 
#chains in the Genus database with same CATH homology
 1LLB A;  2Y2N A;  2HDU A;  4X68 A;  1XPB A;  4S2P A;  3QHY A;  3HLD A;  4FCF A;  3SS5 A;  4P87 A;  1BSG A;  3P98 A;  4GZB A;  1ES2 A;  2WGV A;  4JXV A;  1XP4 A;  4ID4 A;  5FQQ A;  4BEN A;  1LL5 A;  1QME A;  2WUQ A;  4KZ8 A;  4WEK A;  2EXB A;  3AGE A;  5IHV A;  3DWK A;  1JTG A;  1TVF A;  3WS4 A;  1JWP A;  3CMZ A;  3WS5 A;  3W8K A;  2A3U A;  2OSU A;  2ZM8 A;  2BLS A;  3S22 A;  4NET A;  3V3S A;  4DF6 A;  2JE5 A;  5CER A;  1YLT A;  5DF7 A;  3C7V A;  3UNW A;  3VMA A;  2VGK A;  3E2K A;  4LEN A;  1DJA A;  5M1A A;  3OPP A;  4E3O A;  5FI2 A;  2XLN A;  4DXB A;  1ALQ A;  4KG2 A;  2WAD A;  5CHJ A;  3GV9 A;  5JYO A;  3Q7V A;  5FSR A;  3A3J A;  1NZO A;  4BJP A;  4OQH A;  1K55 A;  4U3T A;  1SDE A;  2C6W B;  1FOF A;  5FQM A;  3OPR A;  4X69 A;  5GL9 A;  3PBO A;  5HAP A;  1S6R A;  1MPL A;  4H8R A;  1K6R A;  4X6T A;  1PZO A;  4KZ7 A;  2XK1 A;  1W8Y A;  3PBQ A;  5FQI A;  2Y2H A;  3TOI A;  4PM7 A;  5AQ7 A;  1IKG A;  2Y2J A;  3A3F A;  5FAT A;  3C5A A;  4IED A;  4X53 A;  3N7W A;  2P9V B;  4S2O A;  4BQM A;  2WZX A;  4RX2 A;  3O3V A;  5CRF A;  3VOY A;  1TDL A;  2GDN A;  3GQZ A;  1ERM A;  3FZC A;  3IHB A;  3VP1 A;  4N1X A;  5GLB A;  4GOG A;  3CG5 A;  3ZVT A;  3ZVW A;  3PBR A;  3ZG0 A;  3VP2 A;  3MZE A;  3PBT A;  3S1Y A;  1PWD A;  4BD1 A;  2Y91 A;  1FCO A;  2OLV A;  2XH9 A;  4GNU A;  3ZG5 A;  4E3I A;  1K57 C;  4N1H A;  4S2L A;  3BLM A;  2HDR A;  3MXR A;  4OON A;  1K6S A;  2ZM0 A;  3OZH A;  2Y2Q A;  5EVI B;  1AXB A;  2HP6 A;  3B3X A;  1ONH A;  4FH4 A;  4ZBE A;  3NC8 A;  3CZD A;  1JWZ A;  3UPO A;  1H5X A;  1KDW A;  2X02 A;  1MWS A;  3BFF A;  1L0E A;  5FQ9 A;  4GB7 A;  5KZH A;  1WYC A;  1H8Y A;  3LO7 A;  4Q8I A;  4KQO A;  3PAG A;  4DDS A;  5E2G A;  4OQG A;  4KZ9 A;  1PIO A;  4Y0O A;  5F83 A;  2X01 A;  3A3E A;  3IHA A;  4OPR A;  3W4O A;  2QZ6 A;  4JBF A;  4QJG A;  2J8Y A;  5HX9 A;  4PMA A;  2WYX A;  3BFD A;  3UY6 A;  3Q7Z A;  3BLS A;  3ZG7 B;  4HBU A;  3N4I A;  5HL1 A;  1HZO A;  5I94 A;  2G2W A;  3C4O A;  2WGW A;  4MLL A;  1SHV A;  2J7V A;  2XQZ A;  2XGN A;  4S2N A;  4BLM A;  4C3Q A;  2Y2P A;  3IF5 A;  5FI7 A;  3VSK A;  4E6W A;  4UA7 A;  4B4X A;  5BOH A;  5HAQ A;  3TSG A;  4HEF A;  2ZC5 B;  3MXS A;  1K54 C;  2FFF B;  3G2Z A;  5FI6 A;  1XXM A;  2PU2 A;  3SH9 A;  4JF5 A;  1W8Q A;  1LL9 A;  4MBH A;  1VM1 A;  1K4F A;  4OLD A;  2Z2L B;  4E3N A;  4X56 A;  1PW1 A;  1ESU A;  2XF3 A;  4KZB A;  1ONG A;  4WZ5 C;  4R3J A;  4CJN A;  1XGJ A;  2X71 A;  1HTZ A;  3C4P A;  4UA9 A;  1GHM A;  4GD8 A;  2OV5 A;  1GA0 A;  3LY3 A;  3UO9 A;  5J8X A;  2ZLY A;  5TR7 A;  5FQK A;  3Q07 A;  3C7U A;  5CGS A;  4OOY A;  4S2M A;  3HUM A;  1L2S A;  1FSW A;  2WKH A;  4JF4 A;  4RVA A;  5FA7 A;  4WMC A;  5EVI C;  3LEZ A;  2Y2O A;  1KE4 A;  3DWZ A;  1YLJ A;  3NDG A;  1K56 D;  4GD6 A;  3OPL A;  1ERO A;  4KZ6 A;  3WS1 A;  1FR6 A;  1IKI A;  3IXH A;  4MEZ A;  4QD4 A;  1RCJ A;  4Y0U A;  4GKU A;  3RJU A;  4PM9 A;  2HP9 A;  1O07 A;  2XFS A;  2ZQA A;  2ZC3 B;  1ES4 A;  1ERQ A;  1WE4 A;  4XXR A;  4K91 A;  4ZJ1 A;  3VFH A;  1PI4 A;  3NIA A;  5KSC A;  2XDM A;  3SH8 A;  2P9V A;  1K54 A;  1XKZ A;  1YM1 A;  4RA7 A;  3SS3 A;  3ZHH A;  4B4Z A;  1IYO A;  1LI0 A;  2ZQ7 A;  1ZC2 A;  2Y59 A;  3FKW A;  3HVF A;  4A5R A;  3ZG9 B;  3WS0 A;  2C5W B;  3NI9 A;  5L2F A;  4MBK A;  5M18 A;  4WZ5 A;  1BUE A;  3RXX A;  4WEJ A;  3GRJ A;  3OC2 A;  3LCE A;  4GDB A;  1JTD A;  5AQB A;  2DNS A;  1YQS A;  4FD8 A;  4C75 A;  4XUX A;  1BLS A;  1MY8 A;  1XGI A;  5A92 A;  1KGF A;  3BM6 A;  4O7D A;  2OLU A;  5FAQ A;  3A3D A;  3IXD A;  4HES A;  2EXA A;  4ZJ3 A;  3Q1F A;  3UPN A;  3V39 A;  1C3B A;  2XFT A;  3G31 A;  3UDX A;  1KVL A;  4L0L A;  5EVI A;  5HW3 A;  3UDI A;  3AGF A;  1FCN A;  3ZDJ A;  4GN2 A;  2Y2M A;  1XX2 A;  4QU3 A;  5F1G A;  3W4P A;  1I2W A;  1JWV A;  1M40 A;  3O86 A;  1FSY A;  4WMC D;  4EQI A;  4OOM A;  1GCE A;  5TGF A;  4ZJ2 A;  3HLW A;  1IEL A;  1KDS A;  1W5D A;  2EFX A;  2ZC4 B;  4KQR A;  4ZDX A;  3MZF A;  2Z2M B;  3NBL A;  4OVD A;  2H10 A;  1SDN A;  4E3J A;  3N8L A;  4B88 A;  2EX6 A;  4OPY A;  4WEL A;  2EX8 A;  2JC7 A;  3GTC A;  1KGG A;  3EQU A;  1NJ4 A;  1NYM A;  3HRE A;  3SOI A;  2I72 A;  3WS2 A;  3NDE A;  1LHY A;  3IT9 A;  2WAE A;  2PU4 A;  2R9W A;  2XD1 A;  2ZMA A;  5GLC A;  5F1F A;  5CEB A;  2QPN A;  5CED A;  2RL3 A;  4R4S A;  1CI8 A;  4OP8 A;  5CEC A;  1O7E A;  5CTN A;  1L0G A;  2A49 A;  5E2E A;  4BL2 A;  4RYE A;  3ZNY A;  4DXC A;  4R23 A;  3EQV A;  3DW0 A;  4HBT A;  3UN7 A;  1MXO A;  2ZQD A;  2HDQ A;  2J9O A;  1IYQ A;  2EFU A;  4QHC A;  4UHU A;  4K0X A;  4EBL A;  1GHP A;  4C6Y A;  1H8Z A;  4DDY A;  4S2J A;  3LY4 A;  4ZTK A;  2WK0 A;  1CI9 A;  1PW8 A;  1BLP A;  1KE0 A;  1IEM A;  4KG6 A;  5EVI D;  2PBY A;  4LCL A;  3SH7 A;  1IYP A;  1J9M A;  5HAI A;  5EEC A;  1QMF A;  3G34 A;  3MKF A;  1I2S A;  2Q9M A;  4NK3 A;  4F94 A;  1Q2Q A;  1RGY A;  3PAE A;  1YLP A;  5CHU A;  1BLC A;  2V1Z A;  4QY6 A;  1N9B A;  1XA1 A;  5D3O A;  4EBN A;  5EUA A;  2J9P A;  3CJM A;  4N92 A;  4DKI A;  3BEB A;  1MWR A;  3HBR A;  4E3L A;  1CEG A;  1YMX A;  2HP5 A;  1S0W A;  4FSF A;  1ZG6 A;  5GHX A;  1SKF A;  3Q82 A;  4JXS A;  4XUZ A;  5CXW A;  1K57 A;  2V20 A;  2CC1 A;  3WRZ A;  5KMW A;  1IYS A;  1MWU A;  3IQA A;  4R3B A;  3PTE A;  3SS4 A;  1EI5 A;  1CEF A;  1OME A;  1E3U A;  3BFC A;  4P6B A;  2Y55 A;  2E8I A;  3ISG A;  3VFF A;  2G2U A;  2WZZ A;  3I7J A;  3IXG A;  3IH9 A;  3UE1 A;  4N9K A;  3G32 A;  5AQ9 A;  3UPP A;  3TG9 A;  1LI9 A;  1MBL A;  2ZQ8 A;  3FWL A;  1DJB A;  1VQQ A;  3IF6 B;  5EVL A;  4IVI A;  5GHY A;  1YLW A;  3AGD A;  3JYI A;  1WYB A;  2XEP A;  3S4X A;  3VP0 A;  2XD5 A;  5A93 A;  1MKI A;  4S2K A;  3MBZ A;  2ZC6 B;  4QB8 A;  1DY6 A;  5CGX A;  5EE8 A;  3GR2 A;  3ZFZ A;  4P85 A;  4EV4 A;  3BRM A;  1E4D A;  1RP5 A;  4QY5 A;  1K55 C;  5HAR A;  3G30 A;  3MKE A;  4EWF A;  3HLG A;  3BFG A;  1EWZ A;  4KG5 A;  2IWB A;  2H5S A;  1NY0 A;  2EX9 A;  4JXW A;  1NZU A;  4DE0 A;  4DE1 A;  3UDF A;  5DTS A;  1PWG A;  4DE3 A;  3V3R A;  3BEC A;  1G6A A;  2BG1 A;  4Y7P A;  5DVA A;  4JKT A;  2H0T A;  4KEN B;  5DTK A;  4Z9Q A;  1BLH A;  3GVB A;  1FCM A;  5EOO A;  3DTM A;  4R4R A;  3GMW A;  1ES5 A;  2FFY A;  4OOL A;  3N8R A;  4JPM A;  1K38 A;  2Y4A A;  3MFD A;  1E3U D;  4LV0 A;  4WM9 A;  1FR1 A;  3OCN A;  3FV7 A;  3ZCZ A;  2EX2 A;  4KZ5 A;  2Y2G A;  3G4P A;  1DJC A;  3FYZ A;  5FAP A;  4OQI A;  5G18 A;  3VP4 A;  5M19 A;  1JVJ A;  1BT5 A;  3IF6 C;  1E25 A;  3WWX A;  4WZ4 A;  4OP5 A;  3VOZ A;  5E2F A;  3G2Y A;  5KSH A;  4JF6 A;  2IWC A;  4K0W A;  5F82 A;  3UE0 A;  1FQG A;  5CTM A;  1Z6F A;  2RCX A;  1U60 A;  5GHZ A;  4Y0T A;  5DF8 A;  3V50 A;  3M6B A;  1NRF A;  5CHM A;  4P0M A;  1PZP A;  1YMS A;  4EUZ A;  1GHI A;  3HL9 A;  4X55 A;  4N9L A;  2XR0 A;  1N4O A;  3ITB A;  4BL3 A;  4MBF A;  4JLF A;  4YFM A;  4LCM A;  2HDS A;  2IWD A;  4PM6 A;  4GDN A;  2DRW A;  3HLE A;  5GLA A;  5TFQ A;  4S2N C;  2Y2I A;  4DE2 A;  2DCF A;  4IVK A;  1HVB A;  2B5R A;  2P74 A;  3M2J A;  5FAS A;  1KGE A;  1RGZ A;  3IXB A;  4R1G A;  4LV1 A;  3ZNT A;  4E6X A;  1NYY A;  2Q9N A;  5A90 A;  1PYY A;  2WAF A;  1G68 A;  1TEM A;  3HLF A;  3V5M A;  2VGJ A;  1ESI A;  5E2H A;  3FKV A;  2H0Y A;  2JBF A;  1K4E A;  3A3I A;  1XA7 A;  3N6I A;  1TDG A;  3GSG A;  3PBS A;  3IWO A;  4D2O A;  4S2I A;  1HD8 A;  3IF6 A;  1BTL A;  3Q7V B;  4OH0 A;  4CPK A;  2QMI A;  1K25 A;  3O87 A;  1PI5 A;  4WBG A;  5JYP A;  1M6K A;  4FH2 A;  4E3M A;  1I5Q A;  1PWC A;  5U47 A;  4DRT A;  2ZC7 A;  1K56 A;  3OPH A;  5GLD A;  3O88 A;  4E3K A;  3Q81 A;  4JXG A;  3ZGA B;  2ZQ9 A;  5EOE A;  3HLC A;  2ZD8 A;  3M6H A;  4YIN A;  4BD0 A;  4UAA A;  1SCW A;  4U0T A;  3MZD A;  2WKE A;  4IBR A;  3E2L A;  3P09 A;  4UA6 A;  1NXY A;  1BUL A;  3WRT A;  3M2K A;  4LV3 A;  3VSL A;  4OLG A;  1W79 A;  5FDH A;  3ITA A;  1YLZ A;  1BZA A;  1Y54 A;  5AQA A;  1KVM A;  5A91 A;  4LV2 A;  4MNR A;  1L0D A;  3NY4 A;  3OCL A;  5FAO A;  3RXW A;  2HPB A;  1CK3 A;  4EBP A;  3BYD A;  4PPR A;  1MWT A;  3BFE A;  3HUN A;  4PM8 A;  4KZ4 A;  1ZKJ A;  2JCH A;  1GA9 A;  3D4F A;  4OKP A;  4R0Q A;  2UWX A;  4U0X A;  4OQ0 A;  3UE3 A;  4WYY A;  3NCK A;  1KE3 A;  3IWQ A;  3N8S A;  1ZG4 A;  1Q2P A;  1L0F A;  1YLY A;  1W7F A;  2ZQC A;  5HFO A;  3QNC A;  2Y2K A;  4KZA A;  4PM5 A;  2WKI A;  4OPQ A;  2V2F F;  5CGW A;  3G35 A;  3W4Q A;  5FQJ A;  5EPH A;  5DTT A;  2ZJ9 A;  4OPZ A;  3HUO A;  1YT4 A;  3PBN A;  4IBX A;  2WGI A;  4KQQ A;  3QNB A;  4M3K A;  2WGW B;  3IWI A;  4ZAM A;  3VP3 A;  4KZ3 A;  5DF9 A;  5E43 A;  3ZG8 B;  3HLB A;  4RX3 A;  2Y2L A;  1ES3 A;  3IH8 A;  2ZM2 A;  2R9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...