3SH9A

Crystal structure of fluorophore-labeled beta-lactamase penp in complex with cefotaxime
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
256
structure length
254
Chain Sequence
b'DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFCPNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Increased structural flexibility at the active site of a fluorophore-conjugated beta-lactamase distinctively impacts its binding toward diverse cephalosporin antibiotics
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase/antibiotic
total genus 86
structure length 254
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3sh9A00
2ZC4B 4HBUA 4GD8A 4P6BA 1FR6A 2C6WB 3D4FA 2J7VA 3FKWA 1TDGA 1KGEA 4EWFA 3SH9A 3UPOA 5FATA 4XUXA 4ZTKA 1FCNA 5FAOA 5EE8A 3N4IA 1LI9A 1H5XA 3NDEA 4FH4A 1S6RA 4LCMA 4OQHA 3S4XA 3VOYA 4P87A 5FI2A 4BL2A 1KDWA 1MWSA 3MZEA 1HVBA 2XR0A 4DE2A 1CI8A 3IHBA 3ZVWA 3OC2A 2FFFB 1HD8A 2EFXA 5CHMA 5EPHA 3MZFA 5GL9A 1MKIA 1GCEA 2ZJ9A 3HL9A 4WZ4A 1K57C 1EROA 1LI0A 4HBTA 4KZ9A 5I94A 5DTKA 4R4RA 1PI4A 1L0EA 2C5WB 2WGWA 2HDUA 1JTDA 3M6BA 4ZBEA 1YM1A 2EX9A 4PM8A 4ZJ1A 1NJ4A 5IHVA 4KZ3A 2J9OA 1N4OA 1DJAA 3ITBA 1XKZA 3M2KA 1PZPA 3PAEA 3Q7VA 4KENB 4MEZA 4OH0A 5EVIB 5FQJA 5DF9A 3BECA 3SH8A 2Y91A 4R1GA 5CHUA 5J8XA 1WE4A 5DF8A 4ZJ3A 3ZVTA 3ZG8B 5A90A 1OMEA 3UDIA 4PMAA 4Y0OA 4RX3A 2HDRA 4ZAMA 1DJBA 1WYCA 3P09A 5FDHA 4OPQA 2HP9A 3DWKA 5TFQA 3NBLA 3HLCA 3GMWA 1ZKJA 2P9VB 2VGKA 2WK0A 2WUQA 3UE1A 3ZNTA 5FAQA 2V1ZA 1FOFA 5EECA 5KZHA 3G4PA 1CI9A 1I5QA 2Y2PA 3HBRA 4DXBA 4WM9A 3Q1FA 4KZ7A 3ISGA 3V39A 1LHYA 4GKUA 4KQRA 1W7FA 3LY3A 2G2WA 3N7WA 1KE0A 3VP0A 2Z2LB 4P0MA 3IXGA 4OONA 3SH7A 2Y2KA 3A3DA 4OPRA 2QPNA 2DCFA 3OPPA 4GZBA 3LCEA 3DW0A 1XGIA 1PWGA 2WGIA 2ZQ9A 4FSFA 4NETA 5FAPA 4S2LA 3VP4A 5CEDA 2WAFA 1MY8A 2BLSA 2XFTA 3BLMA 3BFDA 4OKPA 3WRZA 4U0XA 1NYMA 3WRTA 4KQOA 2QMIA 5E2HA 4KG6A 1KE4A 1NYYA 4S2NC 3NI9A 4GDBA 1N9BA 5CTMA 4BJPA 1IKGA 5CRFA 2Y2MA 5GLCA 2WKHA 1BUEA 1BLHA 2H10A 4FH2A 3UY6A 1E3UA 1EI5A 2R9WA 5F82A 5M19A 3HLBA 1SKFA 2RCXA 4IBXA 3ZG7B 1J9MA 2V2FF 4MLLA 3G30A 1TEMA 3NCKA 2X01A 2Z2MB 4S2NA 4WZ5A 5CECA 4D2OA 5BOHA 3UDXA 1H8ZA 1XX2A 2PU2A 2Y2LA 4X55A 2ZQAA 5CGXA 5EVLA 1XGJA 4OLDA 2XH9A 2A49A 3CG5A 4RA7A 1TDLA 3PBTA 2ZM8A 5HFOA 4FCFA 1HZOA 3FYZA 4DDYA 3GRJA 1LL9A 4E6WA 1YLZA 4H8RA 3AGDA 5FQMA 3TOIA 5EVIC 1PYYA 5GLDA 3UPPA 5FASA 1FSWA 5E2GA 1ES3A 4BL3A 1ESUA 3MBZA 4E3IA 4WMCD 2DNSA 3IXHA 3IWQA 5EOEA 4IVIA 1GA9A 3HUOA 1SDNA 3PBOA 4OQIA 1K4EA 1JWPA 1L0GA 3HUNA 5GHZA 2Y59A 1GHPA 4JXGA 4E3NA 4R23A 2Y2OA 4X68A 3G34A 3QNCA 5AQAA 3JYIA 1IYPA 2HPBA 5FI6A 1KDSA 1S0WA 3BFCA 4C6YA 4KZAA 5GLBA 1IEMA 3Q82A 1AXBA 4LV3A 2IWBA 3OCNA 4DKIA 3BYDA 2V20A 3IT9A 3VP3A 4K0WA 4BLMA 1MWRA 2PBYA 3OCLA 1PZOA 4QD4A 4BD0A 2ZQDA 4P85A 3OPHA 3V3SA 4L0LA 1I2WA 1PW1A 4S2PA 2EXAA 5CGSA 2EX2A 1SCWA 1Y54A 3BFGA 3G2YA 3WS0A 1VM1A 1Z6FA 4JXWA 4MBHA 5CERA 2GDNA 4DF6A 5HW3A 4GN2A 4JF4A 1HTZA 3G31A 2HDSA 2R9XA 4BD1A 4HESA 1KGGA 4DDSA 4EUZA 2E8IA 3VOZA 3C7UA 3CZDA 5G18A 5GHYA 5CEBA 3O88A 4Q8IA 1W8QA 4WEKA 1G68A 2ZQ8A 5CGWA 1PI5A 3G35A 3M6HA 2Y2IA 5FQKA 3G2ZA 4S2OA 1W5DA 1PIOA 5FI7A 3BFEA 4OQGA 2Y4AA 1YT4A 4X56A 3UDFA 4XXRA 1O7EA 5U47A 4C75A 1M6KA 1TVFA 1L0DA 4DE0A 4EBLA 3RJUA 3P98A 1PWDA 3IQAA 1K57A 2BG1A 5F83A 3C7VA 3HLFA 4K0XA 2ZC6B 2WKIA 1RCJA 5DVAA 3V5MA 1DY6A 5HX9A 1O07A 2ZM0A 3IF6C 3GSGA 3MFDA 2OV5A 2IWDA 2EX6A 1K55C 1YMSA 3VFHA 3VFFA 1FQGA 3E2KA 5DTSA 5AQ9A 3EQVA 3GTCA 2VGJA 3BM6A 1ES4A 2Q9MA 4K91A 2OLUA 3HVFA 3NDGA 3IH8A 3SS3A 3BLSA 1YQSA 4PPRA 1YLTA 1G6AA 4DE1A 3PBNA 2Y2NA 1SHVA 3C4PA 4PM9A 1GA0A 1K25A 1SDEA 4DRTA 3I7JA 2ZD8A 4LV2A 3RXXA 4QB8A 1CEGA 4S2IA 5FA7A 4EV4A 1Q2QA 4N9LA 1RGZA 4EBNA 4IEDA 3FZCA 3VMAA 1YLJA 4UHUA 1FSYA 3QHYA 4JLFA 1NZUA 3LY4A 2XQZA 3GR2A 2OLVA 1W79A 4KG2A 2ZC5B 4E6XA 1YMXA 3NY4A 1ZG4A 4KZ5A 5E2EA 2G2UA 2Y55A 4N1HA 3VP2A 3ZG5A 4N1XA 4HEFA 1ZC2A 4RVAA 5A92A 2HDQA 4Y0UA 3M2JA 4KZBA 2JBFA 4IVKA 1XXMA 5GHXA 1GHIA 5AQBA 2PU4A 3S22A 4X69A 1YLWA 1ESIA 1BLPA 2XFSA 2RL3A 2ZC7A 2ZC3B 1FR1A 3IF6B 3MXSA 4XUZA 3WS5A 3N8LA 5KMWA 4KZ6A 3NC8A 3ZCZA 3ZG0A 3W4PA 3NIAA 1C3BA 1PWCA 3E2LA 4B4ZA 4X53A 1NRFA 3QNBA 3WWXA 2ZQCA 4ID4A 1BT5A 1KGFA 3VP1A 1MBLA 4B4XA 3LEZA 5TR7A 2XGNA 1CEFA 4WMCA 4Y0TA 3Q07A 5EOOA 1ALQA 1E25A 4R3JA 3Q7ZA 4OP8A 5F1GA 3UPNA 1IELA 3MZDA 3W4QA 4WEJA 1W8YA 1K56D 4X6TA 5EVIA 4MBKA 1ES5A 3BRMA 4E3LA 3CJMA 4OLGA 1BLSA 4LENA 3AGFA 1KVLA 3ZGAB 4GDNA 2ZMAA 3OPLA 1IKIA 4OOYA 3UE3A 3BFFA 1NY0A 3A3JA 4E3OA 4MBFA 3IWIA 4LV0A 1K6RA 4MNRA 5CTNA 4E3KA 2ZLYA 2P9VA 3LO7A 4ZJ2A 3PBSA 2JCHA 3MKEA 4GB7A 3C5AA 4KZ8A 3HLEA 5D3OA 4OOLA 2XEPA 1LLBA 4WYYA 4YFMA 2WADA 4OPYA 1K4FA 1K54C 2EFUA 3O86A 2X71A 4PM7A 2Y2JA 5E2FA 4S2KA 2DRWA 4OP5A 5AQ7A 3OZHA 3C4OA 3OPRA 4UA9A 2XDMA 4FD8A 4A5RA 1E4DA 1I2SA 2B5RA 3N8SA 5A93A 3AGEA 3EQUA 4N9KA 3DTMA 1ERMA 2WYXA 4OPZA 4GD6A 3FWLA 4Y7PA 1GHMA 4UA7A 4OQ0A 4F94A 1QMEA 4OVDA 3IXBA 1K54A 3MXRA 3ITAA 5JYOA 4Z9QA 4RX2A 5TGFA 1BULA 3IXDA 1ERQA 1BSGA 1CK3A 4KQQA 4BQMA 3WS1A 2J8YA 2P74A 4CJNA 4UAAA 2EX8A 2QZ6A 2Y2HA 1BLCA 4R4SA 4S2MA 5A91A 1ONHA 1MWTA 1KVMA 4GOGA 2XF3A 3GVBA 1M40A 4O7DA 3PBQA 3Q81A 2Y2QA 1JTGA 2OSUA 5F1FA 2Y2GA 3WS2A 4DE3A 1K38A 1MXOA 4LCLA 4YINA 5FSRA 1IYQA 1NXYA 3BEBA 1L0FA 3CMZA 4QJGA 4U0TA 5HARA 1LL5A 5E43A 3IF6A 3PTEA 5FQQA 1K55A 2XD1A 5DF7A 5FQIA 3V3RA 2ZM2A 4EQIA 1JWVA 2HP6A 4R3BA 5M1AA 1KE3A 3ZG9B 3UN7A 4QHCA 5CXWA 3UE0A 3UO9A 2WGWB 4GNUA 1XPBA 3SS5A 3N6IA 4C3QA 4QY6A 1FCMA 1JVJA 4QU3A 3B3XA 3Q7VB 3WS4A 4ZDXA 3FKVA 4EBPA 4WBGA 4E3JA 4M3KA 1EWZA 3IH9A 3VSLA 2WAEA 4OOMA 1ONGA 3IWOA 5CHJA 3UNWA 3HREA 5KSHA 2Q9NA 4WZ5C 1PW8A 3RXWA 2EXBA 4PM6A 4BENA 4U3TA 1YLYA 2J9PA 3PBRA 4KG5A 3TG9A 3DWZA 1DJCA 2HP5A 1E3UD 1BTLA 2WKEA 4NK3A 5JYPA 3S1YA 4WELA 5HL1A 1H8YA 3HUMA 1U60A 3ZHHA 1FCOA 2H5SA 1NZOA 3ZFZA 4JF5A 3G32A 2X02A 1XA7A 3A3FA 3A3EA 5HAIA 4JPMA 2A3UA 1K6SA 3HLWA 5DTTA 3SS4A 2JE5A 1XP4A 3HLDA 4JKTA 3TSGA 4S2JA 5EUAA 1MWUA 3A3IA 4UA6A 5FQ9A 2H0TA 2JC7A 5GLAA 5M18A 3V50A 1RP5A 2WZXA 3GQZA 3HLGA 1QMFA 1VQQA 4PM5A 3N8RA 2XD5A 2XK1A 4JBFA 2WGVA 4DXCA 1MPLA 1RGYA 5KSCA 1Q2PA 3VSKA 1IYOA 3GV9A 1IYSA 2FFYA 4JXVA 1ES2A 1BZAA 1K56A 4JF6A 2XLNA 1L2SA 3O87A 1ZG6A 2I72A 4CPKA 4JXSA 5HAQA 4B88A 4QY5A 1XA1A 2IWCA 2H0YA 4LV1A 2CC1A 4N92A 1JWZA 5HAPA 2WZZA 4RYEA 1WYBA 1YLPA 5EVID 3W8KA 2UWXA 2ZQ7A 4E3MA 3W4OA 3IF5A 3FV7A 3IHAA 5L2FA 3ZNYA 3O3VA 4IBRA 3PAGA 3SOIA 4KZ4A 3ZDJA 3MKFA 4R0QA
chains in the Genus database with same CATH superfamily
3EWKA 4GD8A 3FKWA 5AVFA 1TDGA 1KGEA 3T1RA 4QWOA 3SH9A 4ZTKA 1FCNA 5EE8A 3S4XA 4Z1WA 1KDWA 1OTAA 3MZEA 1HVBA 3FG8A 1CI8A 3ZVWA 5HD5A 5DKKA 4WZ4A 1XJ3A 1K57C 2W1TA 3MF0A 5DTKA 2CMNA 4R4RA 2C5WB 1L0EA 4M4XA 1JTDA 2V1BA 3M6BA 4O8GA 1CQAA 4L9GA 4ZJ1A 1NJ4A 4KZ3A 3UNWA 1N4OA 4MEZA 3M2KA 1KOUA 4Y17A 3E4PA 2VGLS 2ZMVA 3BECA 2QJ5A 4R1GA 3P7NA 1WE4A 4ZJ3A 4DJ3A 3ZVTA 2HDRA 4I39A 5HPFA 1ZKJA 2WUQA 5FAQA 3T4KA 1LHYA 4KQRA 3LY3A 4GHIA 2B95A 1WA9A 4P0MA 2VJWA 2XA7S 3OPPA 4GZBA 3LCEA 2K31A 1PWGA 2XRNA 5FAPA 4NETA 3VP4A 3LICA 2WAFA 1MY8A 4U0XA 3WRTA 3U4LP 5E2HA 2ZBBA 5CTMA 3HJIA 2OAP1 4X1LA 4EEUA 1BUEA 1ZHHB 1BLHA 3H82A 1VHMA 1SZVA 3UY6A 1EI5A 4H6JA 5M19A 4MMNA 4MLLA 3G30A 1TEMA 4S2NA 5CECA 2HF6A 1XX2A 4X55A 3JVVA 2A49A 4MN7A 2K7SA 1F5MA 1LL9A 4E6WA 3T1XA 4NKPA 5J7EA 1PFLA 5FQMA 5GLDA 1FSWA 3LIEA 1ES3A 4BL3A 5J3WA 1TS6A 4EEPA 3IWQA 3DTIA 1GA9A 4IVIA 1SDNA 1K4EA 4JXGA 3L7HA 4X68A 5FI6A 1KDSA 2UV0E 4Y3IA 5GLBA 4LV3A 2IWBA 3OCNA 3BYDA 2V20A 4FUWA 3OCLA 4QD4A 4P85A 3BJNA 3ULFA 4S2PA 5CGSA 1SCWA 3BFGA 3G2YA 4MBHA 1HTZA 3B42A 1KGGA 3VOZA 5CEBA 4Q8IA 1W8QA 4WEKA 2ZQ8A 3M6HA 3G35A 2PR5A 2ZL1A 4YOFA 1IOUA 2V9AA 1M6KA 3K3CA 3RJUA 5F6AA 1UWNX 2WKQA 3JPUA 3CWFA 2QWSA 3C7VA 4K0XA 3EGXC 3GSGA 3VFFA 5FEGA 1FQGA 3DTKA 3E2KA 4HJ6A 5DTSA 3D3OA 2VGJA 2OLUA 3HVFA 3A0VA 4PPRA 4CLCC 1G6AA 2Z6DA 3S7OA 1V9ZA 5EV0A 2DMWA 1N9LA 1SHVA 4PM9A 5FDSA 3UB7A 2HV1A 2ZD8A 5F68A 2VV6A 4QB8A 1CEGA 4S2IA 1Q2QA 2L0WA 4UHUA 1FSYA 2OLVA 4KG2A 4KZ5A 1ZG4A 4N1HA 3ZG5A 1ZC2A 1OTBA 4RVAA 3HCYA 4KZBA 4IVKA 5GHXA 5AQBA 2H28A 1YLWA 3WS5A 3MXSA 5HDCA 3ZG0A 3NIAA 4WN5A 3P01A 3K2NA 1MBLA 4B4XA 2XGNA 4WMCA 4I3IA 4R3JA 5F1GA 3UPNA 4HH3A 3VV4A 1K56D 2Y8HA 4OLGA 4JGRA 1KVLA 3LR0A 1ACFA 3BFFA 3KSGA 1NY0A 4LV0A 5IT5A 2ZLYA 2JCHA 3HLEA 1N9OA 5D3OA 1LLBA 1FILA 2EFUA 4DJ2A 4B93A 4S2KA 5AQ7A 5HWVA 3OZHA 4FD8A 2LB9A 3D72A 4ME4A 3CPTB 1I2SA 2B5RA 3N8SA 3AGEA 4HY8A 3FC7A 4ETXA 3DTMA 2WYXA 1GHMA 4F94A 4O0PA 1QMEA 4OVDA 3IXBA 1K54A 3MXRA 2WKRA 1BULA 1CK3A 2OWHA 3LUQA 3WS1A 2J8YA 5HD3A 4CJNA 1VETB 2QZ6A 2GZAA 4YWZA 4PAUA 3Q81A 1JTGA 1DRMA 3O5YA 1L0FA 5DFXA 3PTEA 4EQIA 3DAVA 4QPRA 2QHKA 4IHQA 3KYQA 5M1AA 1GSWA 3UO9A 4GNUA 1XPBA 3SS5A 4C3QA 4QY6A 4NXGA 4QU3A 4ZDXA 3FKVA 2WAEA 2PR6A 5K5BA 3D9YA 1PW8A 1W63Q 4KG5A 5JYPA 4WELA 2Y79A 3H7WA 1YKDA 2X02A 3A3FA 3A3EA 4JPMA 5DTTA 2AVXA 4JKTA 3TSGA 5EUAA 1MWUA 5M18A 2H0TA 3E4QA 3V50A 1RP5A 3GQZA 3N8RA 2XK1A 4DXCA 1RGYA 3VSKA 1IYOA 4IJGA 3GV9A 1ES2A 3EGDC 3UMEA 4EUVA 3O87A 3LR3A 1ZG6A 4Y15A 5HAQA 4Y5FA 3H82B 3NHQA 4H6JB 4MN6A 5EVID 2UWXA 2ZQ7A 3W4OA 3MFXA 1SKOA 4BMWA 3MKFA 4Y2FA 4P6BA 3D4FA 2C6WB 5EM0A 2J7VA 4EWFA 2VA0A 3N4IA 1XJ6A 1H5XA 4OQHA 4LCMA 4P87A 3IHBA 1CF0A 5CHMA 1MKIA 1GCEA 2EA9A 1EROA 3B33A 5MC7A 2HDUA 5IHVA 1PZPA 3Q7VA 4JGPA 5EVIB 4HJ4A 3SH8A 5J8XA 1YAXA 3NOTC 5DF8A 2R78A 1JNUA 4PMAA 2BTFP 1OT6A 2QYBA 1WYCA 2D01A 5TFQA 4WLAA 2QJ7A 4G3VA 1N9NA 3UE6A 5F5YA 1I5QA 1L3LA 4KZ7A 3ISGA 4UEYA 5KIZA 1W7FA 2G2WA 3VP0A 1KE0A 2Z2LB 2ZL1B 4HOIA 4OONA 3A3DA 2DCFA 2ZQ9A 2XFTA 3SW1A 3BFDA 1NYMA 1TS7A 1F9IA 2QMIA 3LIAA 1N9BA 4GS9A 5CRFA 3T1SA 2JKTM 4EETB 1E3UA 5F82A 2PAVP 2V2FF 4PKYA 2Z2MB 4WZ5A 5A8BA 4KUOA 2JKFA 2PU2A 4OLDA 4RA7A 3CG5A 2XSSA 4HHDA 3LIFA 1YSPA 2ZM8A 1HZOA 3GRJA 4H8RA 1V9YA 3TOIA 3LI9A 3LR5A 1ESUA 4WMCD 3MJQA 4WUJA 3IXHA 5TJJA 3HUOA 5GHZA 1T1AA 3RH8B 2O9AA 2P08A 1S0WA 5EVEA 1AXBA 3T1QB 3KYZA 3IT9A 1Z09A 3VP3A 4K0WA 4BLMA 3RTYA 3NJAA 1T18A 4ETZA 4L0LA 2W3DA 2EXAA 3QP6A 3WS0A 4GN2A 4JF4A 3G31A 4BD1A 4EUZA 3C7UA 3CZDA 3U2AA 4EU0A 3O88A 5FQKA 3G2ZA 4S2OA 4WF0A 1T19A 1W5DA 5FI7A 3PXPA 4GW9A 4I3AA 4ARZA 4R6LA 3MS6A 4X56A 1L0DA 4EBLA 3P98A 2WKPA 2W3GA 2J3TD 4DMZA 3QP8A 1VEUA 5DVAA 3V5MA 1O07A 2ZM0A 2OV5A 3BW6A 1YMSA 3GTCA 5HZHA 2Q9MA 3NDGA 4WL9A 1LSVA 1G28A 3BLSA 4BBTA 1YLTA 1J3WA 3PBNA 2PDRA 3PYPA 1OTIA 3C4PA 4DRTA 3I7JA 4Q0JA 3NULA 4RQ9A 1OJGA 3FZCA 5TBMA 3TW8A 1F2KA 1NZUA 2XQZA 1YMXA 3NY4A 1S66L 5E2EA 2Y55A 3VP2A 4E04A 4N1XA 1OTDA 3M2JA 3E4OA 2A24A 3S22A 3BQAA 4X69A 1BLPA 2ZC7A 3HJKA 3T4JA 1D7EA 5KMWA 1Y4OA 1C3BA 2M1CA 4B4ZA 3WWXA 4ID4A 1KGFA 1GSVA 1STZA 4Y0TA 3IX4A 3Q07A 5EOOA 2ZOHA 5EVIA 4KQDA 3JVUA 1BLSA 4LENA 2O99A 3A0RA 3ZGAB 3IBJA 4L9EA 4OOYA 1UGUA 3H7WB 5CTNA 4E3KA 4Y13A 3MKEA 3VE4A 2ACGA 2PYPA 4OOLA 3CUEA 4WYYA 4YFMA 4OPYA 3IBRA 1K4FA 4B9OA 3O86A 4PM7A 3S7PA 4OP5A 3T4QA 3C4OA 3OPRA 2B02A 2NUPC 1MZUA 4A5RA 5A93A 4N9KA 5HWWA 1ERMA 1Y28A 4OQ0A 5JYOA 3QP5A 4RX2A 1ERQA 1BSGA 3KO6A 3QP1A 1SKOB 3IS2B 4IUKA 5A91A 1ONHA 1KVMA 2V8CA 2L1MA 2Y2GA 4LPZA 4DE3A 5FSRA 3BEBA 3CMZA 5HARA 5IS1A 1D1JA 1LL5A 3C8CA 5E43A 3IF6A 2P7JA 1K55A 2XD1A 1JWVA 3B47A 4K08A 2HP6A 3ZG9B 3UN7A 4QHCA 3UE0A 2P04A 3N6IA 1FCMA 1JVJA 3DTEA 3Q7VB 4X1MA 4EBPA 4WBGA 2EXBA 4U3TA 1YLYA 2J9PA 2HP5A 2WKEA 1E3UD 4Q0HA 5HL1A 3ZHHA 1FCOA 1NZOA 1S1YA 1ZTUA 4JF5A 5HAIA 4F3LA 3HLWA 3A3IA 4UA6A 4KUKA 2OAQ1 2WZXA 3HLGA 1VQQA 3OBFA 2PYRA 4JBFA 1MPLA 5KSCA 4JXVA 4GS9B 4I5SA 2XLNA 1L2SA 2HJ9C 4I38A 3FPVA 4P6ZM 1IFQA 3CI6A 4N92A 1JWZA 3GDIA 1LL8A 3A0SA 3G6OA 4LFUA 4RYEA 5HPIA 1YLPA 3IHAA 5L2FA 3ZNYA 2O9BA 3EEHA 3O3VA 4IBRA 3ZDJA 3LEQA 4HBUA 4HQAA 1FR6A 2VEAA 2KX6A 5FATA 4XUXA 4EXOA 3NDEA 1LI9A 1S6RA 1XJ4A 1H3QA 5FI2A 4BL2A 3K3DA 1VB6A 3OC2A 2FFFB 1AWIA 3MZFA 5GL9A 3HL9A 2JKTI 4KZ9A 5I94A 1PI4A 2WGWA 4ZBEA 2EX9A 3ITBA 1XKZA 3PAEA 4OH0A 5FQJA 3LYXA 2VX8A 3ZG8B 3UDIA 4RX3A 4ZAMA 1DJBA 3P09A 5FDHA 3OOVA 4OPQA 2HP9A 1TS8A 3NBLA 3HLCA 3GMWA 2VGKA 2O0YA 3UE1A 3ZNTA 4MN5A 1FOFA 4NXBA 5KZHA 3HBRA 4DXBA 3Q1FA 3V39A 3LIDA 3C30A 4GKUA 3IXGA 3SH7A 2Y2KA 2FZ0A 4OPRA 2QPNA 4ARZB 3DW0A 1XGIA 4FSFA 4S2LA 5CEDA 4HJ3A 3CHWP 4KQOA 4MDZA 4KG6A 1NYYA 3NI9A 4GDBA 4CLCD 1IKGA 4LRZE 2Y2MA 2WKHA 3T12B 3KX0X 2QKPA 1VEUB 2R9WA 2MJ6A 3HLBA 1SKFA 1P9WA 1J9MA 2X01A 4D2OA 5BOHA 1H8ZA 2M7UA 2Y2LA 4I3JA 3TJZC 2ZQAA 5CGXA 5EVLA 1XGJA 2XH9A 2JKGA 1TDLA 4AFIA 1P9RA 5HFOA 4DDYA 1PYYA 5FASA 3UPPA 5E2GA 1OPXA 5TBMB 4E3IA 2DNSA 5EOEA 1OT9A 3PBOA 4OQIA 5HDSA 1JWPA 1L0GA 2JKRM 2PBDP 5DKLA 2Y2OA 3QNCA 3JYIA 1IYPA 3BFCA 4XT2A 3Q82A 3IS2A 2XROA 1MWRA 2A24B 2PBYA 1PZOA 4BD0A 3FPWA 1G5UA 3OPHA 2XA7M 3V3SA 1PW1A 5DFYA 2Q0OA 2EX2A 1Y54A 1VM1A 4JXWA 5CERA 4DF6A 2INWA 2HDSA 2YKHA 2R9XA 4HESA 4DDSA 2E8IA 4UQIM 1G68A 1PI5A 1W63M 2J3TC 1A0KA 5G4YA 2Y4AA 2V1AA 3H9WA 5U47A 1YSQA 4DE0A 2BASA 3F1PB 4ZRRA 3IQAA 5FEFA 1K57A 4HIAA 1TS0A 3HLFA 2ZC6B 2WKIA 1NWZA 3SZTA 2PHYA 2IWDA 3VFHA 4K91A 1ES4A 3SS3A 2JHEA 2KOIA 4P6ZS 4NXFA 1GA0A 3RXXA 5FA7A 4EV4A 1RGZA 4EBNA 4IEDA 3T4TA 1T1BA 3KSFA 3OLOA 2GX5A 3LY4A 3MSHA 2ZC5B 5EFWA 5HDDA 2G2UA 4HEFA 1XXMA 1ESIA 3R4KA 1FR1A 1LT0A 3IF6B 4XUZA 3N8LA 1DP9A 3NC8A 4NXEA 5IU1A 3ZCZA 3W4PA 4ESPA 4X53A 3NOUC 1BT5A 1S4RA 3VP1A 3LFVA 2Z6CA 5L10A 3BY9A 3Q7ZA 3W4QA 4JGQA 4WEJA 1W8YA 4MBKA 1D06A 4E3LA 4GDNA 2A2LA 3UE3A 1IKIA 3R7WA 2V0UA 1TD5A 3IWIA 4MNRA 4Q0IA 4F3LB 3LO7A 4ZJ2A 2W27A 3GECA 4GB7A 3C5AA 2W3EA 1H8MA 2D02A 2Y2JA 2DRWA 4UA9A 2XDMA 1E4DA 1ODVA 1P0ZA 1P97A 2FH5A 3ICYA 4GJ4A 1OJ5A 4LLOB 4Y7PA 1BYWA 3FWLA 3BQ8A 4UA7A 3MR0A 2I9VA 4Z9QA 5EM1A 4KQQA 4BQMA 2P74A 1LSXA 4UAAA 2Y2HA 3LR4A 4S2MA 1MWTA 5HSQA 3F1OA 2W0NA 2VV7A 1M40A 4O7DA 3PBQA 3QP4A 2OSUA 5F1FA 3WS2A 4YINA 1MXOA 1IYQA 4DN0A 4BWIA 2B18A 3PHYA 5FQQA 5DF7A 3V3RA 2OOLA 2ZM2A 4R38A 2V8FA 2G7UA 4CLCA 2WGWB 2KLIA 3B3XA 3CLOA 1EWZA 3IH9A 3IWOA 5CHJA 5KSHA 4WZ5C 4NEED 4PM6A 4BENA 3EEAA 3DWZA 1DJCA 4II7A 1BTLA 4NK3A 5FL3A 3S1YA 4UQIS 5AJGA 4BBUA 3LGOA 3G32A 1XA7A 3SS4A 1NLZA 4S2JA 5GLAA 5FQ9A 2JC7A 1G6OA 5L8MA 4PM5A 3NECA 4HI4A 1S4SA 2K2NA 3E98A 1IYSA 3F1NB 5L09A 1BZAA 3UB5P 3F1PA 3T4SA 4EERA 4CPKA 3MQQA 4B88A 4QY5A 1XA1A 4LV1A 3MXQA 4FTXA 1WYBA 4E3MA 3IF5A 3FV7A 2IA2A 3PR6A 2VK3A 2ZC4B 3IX3A 4FOFA 3CITA 2NUTC 3UPOA 3TE8A 5FAOA 4FH4A 3VOYA 3KYEA 5F69A 1MWSA 2XR0A 4DE2A 2O9CA 1HD8A 2EFXA 5EPHA 2ZJ9A 5HL6A 1LI0A 2PT7A 4HBTA 4CQHA 1YM1A 5DJTA 4PM8A 4XT2B 2J9OA 1DJAA 4KENB 1H0MA 3IX8A 5DF9A 2Y91A 2YKFA 5CHUA 2EWWA 3E0YA 5G4ZA 1F98A 4BBVA 1DP6A 3V67A 5A90A 1OMEA 3NOPC 4Y0OA 2HZ5A 3DWKA 2P9VB 2WK0A 2V1ZA 5EECA 3G4PA 4G3WA 1CI9A 2Y2PA 4G3KA 4WM9A 3N7WA 2JKRI 2W3HA 1CJFA 2WGIA 4OKPA 2BLSA 3WRZA 3BLMA 4S2NC 1KE4A 4YNRA 4BJPA 5GLCA 3T4LA 2H10A 2W1RA 4FH2A 4LRYC 1HLUP 2RCXA 4IBXA 3ZG7B 3MMHA 4L9FA 3KSIA 3NCKA 3UDXA 2OWJA 3PBTA 2J80A 4FCFA 3FYZA 3LIBA 1YLZA 4NG2A 3AGDA 5EVIC 3MBZA 1UWPX 3EOIA 4CLCE 3HUNA 2Y59A 1GHPA 5HWTA 4E3NA 4R23A 3G34A 5AQAA 2HPBA 2VKSA 4C6YA 4KZAA 1IEMA 1XFNA 2V0WA 4DKIA 1MKMA 3CUEC 2ZQDA 1S1ZA 1I2WA 3C2WA 1Z6FA 2GDNA 5HW3A 4HP4A 2VV8A 4X25A 4EW7A 5G18A 5GHYA 5CGWA 2Y2IA 1PIOA 3BFEA 4OQGA 1YT4A 3UDFA 4XXRA 1O7EA 4C75A 1TVFA 2PD7A 1PWDA 3RFBA 3R7WB 2BG1A 5F83A 1MC0A 1RCJA 1DY6A 5HX9A 3IF6C 3MFDA 2EX6A 1K55C 3S7QA 5AQ9A 3EQVA 3BM6A 3IH8A 1YQSA 2HGVA 4DE1A 2PD8A 2Y2NA 5CX7A 1K25A 1DP8A 1SDEA 3W2ZA 4LV2A 4N9LA 3F1NA 2GNXA 3VMAA 1YLJA 2W1TB 3QHYA 1NRJA 4JLFA 1NLYA 2KDKA 2EWVA 3GR2A 1W79A 4HH2A 4E6XA 3F1OB 3ZYTA 2ZOIA 3UB9A 2L4RA 2HDQA 4Y0UA 5A92A 2JBFA 1GHIA 2PU4A 2JN7A 2RL3A 2XFSA 2ZC3B 2VGLM 4KZ6A 3VOLA 3BY8A 1PWCA 3E2LA 1NRFA 3MQ0A 3QNBA 5DJUA 2ZQCA 2GJ3A 1X0OA 4CLCB 4GHIB 3LEZA 4HNBA 5TR7A 1CEFA 1ALQA 1E25A 2M7VA 4OP8A 1IELA 2LB5A 3MZDA 4X6TA 1ES5A 3BRMA 3CJMA 3AGFA 3VE3A 2ZMAA 3OPLA 3ZQ5A 5AVEA 3A3JA 4E3OA 4MBFA 1K6RA 2P9VA 3UB6A 3PBSA 4KZ8A 2XEPA 2WADA 1K54C 2X71A 5E2FA 5LBRA 4HP9A 3EQUA 4OPZA 4GD6A 4EESA 3S7NA 3ITAA 3L9KA 5TGFA 3IXDA 4O01A 4MCWA 3T4OA 2EX8A 5I5LA 1BLCA 4R4SA 1XJ2A 4PKYG 4GOGA 2XF3A 3GVBA 1T1CA 2Y2QA 2VLGA 1K38A 2E8JA 4LCLA 1OTEA 3TRCA 1NXYA 4GCZA 4QJGA 4U0TA 1K0KA 1YPRA 5C5KA 5FQIA 1XFQA 4R3BA 1KE3A 5CXWA 2W3FA 3WS4A 2PRFA 4E3JA 3BWLA 4M3KA 3CAXA 3VSLA 3MQOA 4OOMA 4GLQA 1ONGA 3HREA 2Q9NA 3RXWA 3C38A 4PHTA 1GSXA 3TG9A 3PBRA 3UB8A 2ZMFA 1PNEA 1H8YA 5J4EA 3HUMA 3UMDA 1U60A 2H5SA 3ZFZA 3T50A 2A3UA 1K6SA 1EW0A 4R3AA 4R70A 2JE5A 1XP4A 4LGWA 3HLDA 4JGOA 1PRQA 1QMFA 2XD5A 2J3WA 2WGVA 1Q2PA 2VZWA 3CPTA 3KSHA 2FFYA 3DBAA 1K56A 4D60A 4JF6A 2HJEA 2I72A 4JXSA 4EQ1A 3LI8A 1S67L 2IWCA 2H0YA 2CC1A 4IUHA 5HAPA 2WZZA 3W8KA 3QP2A 1FIKA 3PAGA 3SOIA 1VETA 1LSWA 4KZ4A 4LRXC 5L07A 4R0QA 1TF1A
chains in the Genus database with same CATH topology
2ZC4B 4HBUA 4GD8A 4P6BA 1FR6A 2C6WB 3D4FA 2J7VA 3FKWA 1TDGA 1KGEA 4EWFA 3SH9A 3UPOA 5FATA 4XUXA 4ZTKA 1FCNA 5FAOA 5EE8A 3N4IA 1LI9A 1H5XA 3NDEA 4FH4A 1S6RA 4LCMA 4OQHA 3S4XA 3VOYA 4P87A 5FI2A 4BL2A 1KDWA 1MWSA 3MZEA 1HVBA 2XR0A 4DE2A 1CI8A 3IHBA 3ZVWA 3OC2A 2FFFB 1HD8A 2EFXA 5CHMA 5EPHA 3MZFA 5GL9A 1MKIA 1GCEA 2ZJ9A 3HL9A 4WZ4A 1K57C 1EROA 1LI0A 4HBTA 4KZ9A 5I94A 5DTKA 4R4RA 1PI4A 1L0EA 2C5WB 2WGWA 2HDUA 1JTDA 3M6BA 4ZBEA 1YM1A 2EX9A 4PM8A 4ZJ1A 1NJ4A 5IHVA 4KZ3A 2J9OA 1N4OA 1DJAA 3ITBA 1XKZA 3M2KA 1PZPA 3PAEA 3Q7VA 4KENB 4MEZA 4OH0A 5EVIB 5FQJA 5DF9A 3BECA 3SH8A 2Y91A 4R1GA 5CHUA 5J8XA 1WE4A 5DF8A 4ZJ3A 3ZVTA 3ZG8B 5A90A 1OMEA 3UDIA 4PMAA 4Y0OA 4RX3A 2HDRA 4ZAMA 1DJBA 1WYCA 3P09A 5FDHA 4OPQA 2HP9A 3DWKA 5TFQA 3NBLA 3HLCA 3GMWA 1ZKJA 2P9VB 2VGKA 2WK0A 2WUQA 3UE1A 3ZNTA 5FAQA 2V1ZA 1FOFA 5EECA 5KZHA 3G4PA 1CI9A 1I5QA 2Y2PA 3HBRA 4DXBA 4WM9A 3Q1FA 4KZ7A 3ISGA 3V39A 1LHYA 4GKUA 4KQRA 1W7FA 3LY3A 2G2WA 3N7WA 1KE0A 3VP0A 2Z2LB 4P0MA 3IXGA 4OONA 3SH7A 2Y2KA 3A3DA 4OPRA 2QPNA 2DCFA 3OPPA 4GZBA 3LCEA 3DW0A 1XGIA 1PWGA 2WGIA 2ZQ9A 4FSFA 4NETA 5FAPA 4S2LA 3VP4A 5CEDA 2WAFA 1MY8A 2BLSA 2XFTA 3BLMA 3BFDA 4OKPA 3WRZA 4U0XA 1NYMA 3WRTA 4KQOA 2QMIA 5E2HA 4KG6A 1KE4A 1NYYA 4S2NC 3NI9A 4GDBA 1N9BA 5CTMA 4BJPA 1IKGA 5CRFA 2Y2MA 5GLCA 2WKHA 1BUEA 1BLHA 2H10A 4FH2A 3UY6A 1E3UA 1EI5A 2R9WA 5F82A 5M19A 3HLBA 1SKFA 2RCXA 4IBXA 3ZG7B 1J9MA 2V2FF 4MLLA 3G30A 1TEMA 3NCKA 2X01A 2Z2MB 4S2NA 4WZ5A 5CECA 4D2OA 5BOHA 3UDXA 1H8ZA 1XX2A 2PU2A 2Y2LA 4X55A 2ZQAA 5CGXA 5EVLA 1XGJA 4OLDA 2XH9A 2A49A 3CG5A 4RA7A 1TDLA 3PBTA 2ZM8A 5HFOA 4FCFA 1HZOA 3FYZA 4DDYA 3GRJA 1LL9A 4E6WA 1YLZA 4H8RA 3AGDA 5FQMA 3TOIA 5EVIC 1PYYA 5GLDA 3UPPA 5FASA 1FSWA 5E2GA 1ES3A 4BL3A 1ESUA 3MBZA 4E3IA 4WMCD 2DNSA 3IXHA 3IWQA 5EOEA 4IVIA 1GA9A 3HUOA 1SDNA 3PBOA 4OQIA 1K4EA 1JWPA 1L0GA 3HUNA 5GHZA 2Y59A 1GHPA 4JXGA 4E3NA 4R23A 2Y2OA 4X68A 3G34A 3QNCA 5AQAA 3JYIA 1IYPA 2HPBA 5FI6A 1KDSA 1S0WA 3BFCA 4C6YA 4KZAA 5GLBA 1IEMA 3Q82A 1AXBA 4LV3A 2IWBA 3OCNA 4DKIA 3BYDA 2V20A 3IT9A 3VP3A 4K0WA 4BLMA 1MWRA 2PBYA 3OCLA 1PZOA 4QD4A 4BD0A 2ZQDA 4P85A 3OPHA 3V3SA 4L0LA 1I2WA 1PW1A 4S2PA 2EXAA 5CGSA 2EX2A 1SCWA 1Y54A 3BFGA 3G2YA 3WS0A 1VM1A 1Z6FA 4JXWA 4MBHA 5CERA 2GDNA 4DF6A 5HW3A 4GN2A 4JF4A 1HTZA 3G31A 2HDSA 2R9XA 4BD1A 4HESA 1KGGA 4DDSA 4EUZA 2E8IA 3VOZA 3C7UA 3CZDA 5G18A 5GHYA 5CEBA 3O88A 4Q8IA 1W8QA 4WEKA 1G68A 2ZQ8A 5CGWA 1PI5A 3G35A 3M6HA 2Y2IA 5FQKA 3G2ZA 4S2OA 1W5DA 1PIOA 5FI7A 3BFEA 4OQGA 2Y4AA 1YT4A 4X56A 3UDFA 4XXRA 1O7EA 5U47A 4C75A 1M6KA 1TVFA 1L0DA 4DE0A 4EBLA 3RJUA 3P98A 1PWDA 3IQAA 1K57A 2BG1A 5F83A 3C7VA 3HLFA 4K0XA 2ZC6B 2WKIA 1RCJA 5DVAA 3V5MA 1DY6A 5HX9A 1O07A 2ZM0A 3IF6C 3GSGA 3MFDA 2OV5A 2IWDA 2EX6A 1K55C 1YMSA 3VFHA 3VFFA 1FQGA 3E2KA 5DTSA 5AQ9A 3EQVA 3GTCA 2VGJA 3BM6A 1ES4A 2Q9MA 4K91A 2OLUA 3HVFA 3NDGA 3IH8A 3SS3A 3BLSA 1YQSA 4PPRA 1YLTA 1G6AA 4DE1A 3PBNA 2Y2NA 1SHVA 3C4PA 4PM9A 1GA0A 1K25A 1SDEA 4DRTA 3I7JA 2ZD8A 4LV2A 3RXXA 4QB8A 1CEGA 4S2IA 5FA7A 4EV4A 1Q2QA 4N9LA 1RGZA 4EBNA 4IEDA 3FZCA 3VMAA 1YLJA 4UHUA 1FSYA 3QHYA 4JLFA 1NZUA 3LY4A 2XQZA 3GR2A 2OLVA 1W79A 4KG2A 2ZC5B 4E6XA 1YMXA 3NY4A 1ZG4A 4KZ5A 5E2EA 2G2UA 2Y55A 4N1HA 3VP2A 3ZG5A 4N1XA 4HEFA 1ZC2A 4RVAA 5A92A 2HDQA 4Y0UA 3M2JA 4KZBA 2JBFA 4IVKA 1XXMA 5GHXA 1GHIA 5AQBA 2PU4A 3S22A 4X69A 1YLWA 1ESIA 1BLPA 2XFSA 2RL3A 2ZC7A 2ZC3B 1FR1A 3IF6B 3MXSA 4XUZA 3WS5A 3N8LA 5KMWA 4KZ6A 3NC8A 3ZCZA 3ZG0A 3W4PA 3NIAA 1C3BA 1PWCA 3E2LA 4B4ZA 4X53A 1NRFA 3QNBA 3WWXA 2ZQCA 4ID4A 1BT5A 1KGFA 3VP1A 1MBLA 4B4XA 3LEZA 5TR7A 2XGNA 1CEFA 4WMCA 4Y0TA 3Q07A 5EOOA 1ALQA 1E25A 4R3JA 3Q7ZA 4OP8A 5F1GA 3UPNA 1IELA 3MZDA 3W4QA 4WEJA 1W8YA 1K56D 4X6TA 5EVIA 4MBKA 1ES5A 3BRMA 4E3LA 3CJMA 4OLGA 1BLSA 4LENA 3AGFA 1KVLA 3ZGAB 4GDNA 2ZMAA 3OPLA 1IKIA 4OOYA 3UE3A 3BFFA 1NY0A 3A3JA 4E3OA 4MBFA 3IWIA 4LV0A 1K6RA 4MNRA 5CTNA 4E3KA 2ZLYA 2P9VA 3LO7A 4ZJ2A 3PBSA 2JCHA 3MKEA 4GB7A 3C5AA 4KZ8A 3HLEA 5D3OA 4OOLA 2XEPA 1LLBA 4WYYA 4YFMA 2WADA 4OPYA 1K4FA 1K54C 2EFUA 3O86A 2X71A 4PM7A 2Y2JA 5E2FA 4S2KA 2DRWA 4OP5A 5AQ7A 3OZHA 3C4OA 3OPRA 4UA9A 2XDMA 4FD8A 4A5RA 1E4DA 1I2SA 2B5RA 3N8SA 5A93A 3AGEA 3EQUA 4N9KA 3DTMA 1ERMA 2WYXA 4OPZA 4GD6A 3FWLA 4Y7PA 1GHMA 4UA7A 4OQ0A 4F94A 1QMEA 4OVDA 3IXBA 1K54A 3MXRA 3ITAA 5JYOA 4Z9QA 4RX2A 5TGFA 1BULA 3IXDA 1ERQA 1BSGA 1CK3A 4KQQA 4BQMA 3WS1A 2J8YA 2P74A 4CJNA 4UAAA 2EX8A 2QZ6A 2Y2HA 1BLCA 4R4SA 4S2MA 5A91A 1ONHA 1MWTA 1KVMA 4GOGA 2XF3A 3GVBA 1M40A 4O7DA 3PBQA 3Q81A 2Y2QA 1JTGA 2OSUA 5F1FA 2Y2GA 3WS2A 4DE3A 1K38A 1MXOA 4LCLA 4YINA 5FSRA 1IYQA 1NXYA 3BEBA 1L0FA 3CMZA 4QJGA 4U0TA 5HARA 1LL5A 5E43A 3IF6A 3PTEA 5FQQA 1K55A 2XD1A 5DF7A 5FQIA 3V3RA 2ZM2A 4EQIA 1JWVA 2HP6A 4R3BA 5M1AA 1KE3A 3ZG9B 3UN7A 4QHCA 5CXWA 3UE0A 3UO9A 2WGWB 4GNUA 1XPBA 3SS5A 3N6IA 4C3QA 4QY6A 1FCMA 1JVJA 4QU3A 3B3XA 3Q7VB 3WS4A 4ZDXA 3FKVA 4EBPA 4WBGA 4E3JA 4M3KA 1EWZA 3IH9A 3VSLA 2WAEA 4OOMA 1ONGA 3IWOA 5CHJA 3UNWA 3HREA 5KSHA 2Q9NA 4WZ5C 1PW8A 3RXWA 2EXBA 4PM6A 4BENA 4U3TA 1YLYA 2J9PA 3PBRA 4KG5A 3TG9A 3DWZA 1DJCA 2HP5A 1E3UD 1BTLA 2WKEA 4NK3A 5JYPA 3S1YA 4WELA 5HL1A 1H8YA 3HUMA 1U60A 3ZHHA 1FCOA 2H5SA 1NZOA 3ZFZA 4JF5A 3G32A 2X02A 1XA7A 3A3FA 3A3EA 5HAIA 4JPMA 2A3UA 1K6SA 3HLWA 5DTTA 3SS4A 2JE5A 1XP4A 3HLDA 4JKTA 3TSGA 4S2JA 5EUAA 1MWUA 3A3IA 4UA6A 5FQ9A 2H0TA 2JC7A 5GLAA 5M18A 3V50A 1RP5A 2WZXA 3GQZA 3HLGA 1QMFA 1VQQA 4PM5A 3N8RA 2XD5A 2XK1A 4JBFA 2WGVA 4DXCA 1MPLA 1RGYA 5KSCA 1Q2PA 3VSKA 1IYOA 3GV9A 1IYSA 2FFYA 4JXVA 1ES2A 1BZAA 1K56A 4JF6A 2XLNA 1L2SA 3O87A 1ZG6A 2I72A 4CPKA 4JXSA 5HAQA 4B88A 4QY5A 1XA1A 2IWCA 2H0YA 4LV1A 2CC1A 4N92A 1JWZA 5HAPA 2WZZA 4RYEA 1WYBA 1YLPA 5EVID 3W8KA 2UWXA 2ZQ7A 4E3MA 3W4OA 3IF5A 3FV7A 3IHAA 5L2FA 3ZNYA 3O3VA 4IBRA 3PAGA 3SOIA 4KZ4A 3ZDJA 3MKFA 4R0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZC4 B;  4HBU A;  4GD8 A;  4P6B A;  1FR6 A;  2C6W B;  3D4F A;  2J7V A;  3FKW A;  1TDG A;  1KGE A;  4EWF A;  3SH9 A;  3UPO A;  5FAT A;  4XUX A;  4ZTK A;  1FCN A;  5FAO A;  5EE8 A;  3N4I A;  1LI9 A;  1H5X A;  3NDE A;  4FH4 A;  1S6R A;  4LCM A;  4OQH A;  3S4X A;  3VOY A;  4P87 A;  5FI2 A;  4BL2 A;  1KDW A;  1MWS A;  3MZE A;  1HVB A;  2XR0 A;  4DE2 A;  1CI8 A;  3IHB A;  3ZVW A;  3OC2 A;  2FFF B;  1HD8 A;  2EFX A;  5CHM A;  5EPH A;  3MZF A;  5GL9 A;  1MKI A;  1GCE A;  2ZJ9 A;  3HL9 A;  4WZ4 A;  1K57 C;  1ERO A;  1LI0 A;  4HBT A;  4KZ9 A;  5I94 A;  5DTK A;  4R4R A;  1PI4 A;  1L0E A;  2C5W B;  2WGW A;  2HDU A;  1JTD A;  3M6B A;  4ZBE A;  1YM1 A;  2EX9 A;  4PM8 A;  4ZJ1 A;  1NJ4 A;  5IHV A;  4KZ3 A;  2J9O A;  1N4O A;  1DJA A;  3ITB A;  1XKZ A;  3M2K A;  1PZP A;  3PAE A;  3Q7V A;  4KEN B;  4MEZ A;  4OH0 A;  5EVI B;  5FQJ A;  5DF9 A;  3BEC A;  3SH8 A;  2Y91 A;  4R1G A;  5CHU A;  5J8X A;  1WE4 A;  5DF8 A;  4ZJ3 A;  3ZVT A;  3ZG8 B;  5A90 A;  1OME A;  3UDI A;  4PMA A;  4Y0O A;  4RX3 A;  2HDR A;  4ZAM A;  1DJB A;  1WYC A;  3P09 A;  5FDH A;  4OPQ A;  2HP9 A;  3DWK A;  5TFQ A;  3NBL A;  3HLC A;  3GMW A;  1ZKJ A;  2P9V B;  2VGK A;  2WK0 A;  2WUQ A;  3UE1 A;  3ZNT A;  5FAQ A;  2V1Z A;  1FOF A;  5EEC A;  5KZH A;  3G4P A;  1CI9 A;  1I5Q A;  2Y2P A;  3HBR A;  4DXB A;  4WM9 A;  3Q1F A;  4KZ7 A;  3ISG A;  3V39 A;  1LHY A;  4GKU A;  4KQR A;  1W7F A;  3LY3 A;  2G2W A;  3N7W A;  1KE0 A;  3VP0 A;  2Z2L B;  4P0M A;  3IXG A;  4OON A;  3SH7 A;  2Y2K A;  3A3D A;  4OPR A;  2QPN A;  2DCF A;  3OPP A;  4GZB A;  3LCE A;  3DW0 A;  1XGI A;  1PWG A;  2WGI A;  2ZQ9 A;  4FSF A;  4NET A;  5FAP A;  4S2L A;  3VP4 A;  5CED A;  2WAF A;  1MY8 A;  2BLS A;  2XFT A;  3BLM A;  3BFD A;  4OKP A;  3WRZ A;  4U0X A;  1NYM A;  3WRT A;  4KQO A;  2QMI A;  5E2H A;  4KG6 A;  1KE4 A;  1NYY A;  4S2N C;  3NI9 A;  4GDB A;  1N9B A;  5CTM A;  4BJP A;  1IKG A;  5CRF A;  2Y2M A;  5GLC A;  2WKH A;  1BUE A;  1BLH A;  2H10 A;  4FH2 A;  3UY6 A;  1E3U A;  1EI5 A;  2R9W A;  5F82 A;  5M19 A;  3HLB A;  1SKF A;  2RCX A;  4IBX A;  3ZG7 B;  1J9M A;  2V2F F;  4MLL A;  3G30 A;  1TEM A;  3NCK A;  2X01 A;  2Z2M B;  4S2N A;  4WZ5 A;  5CEC A;  4D2O A;  5BOH A;  3UDX A;  1H8Z A;  1XX2 A;  2PU2 A;  2Y2L A;  4X55 A;  2ZQA A;  5CGX A;  5EVL A;  1XGJ A;  4OLD A;  2XH9 A;  2A49 A;  3CG5 A;  4RA7 A;  1TDL A;  3PBT A;  2ZM8 A;  5HFO A;  4FCF A;  1HZO A;  3FYZ A;  4DDY A;  3GRJ A;  1LL9 A;  4E6W A;  1YLZ A;  4H8R A;  3AGD A;  5FQM A;  3TOI A;  5EVI C;  1PYY A;  5GLD A;  3UPP A;  5FAS A;  1FSW A;  5E2G A;  1ES3 A;  4BL3 A;  1ESU A;  3MBZ A;  4E3I A;  4WMC D;  2DNS A;  3IXH A;  3IWQ A;  5EOE A;  4IVI A;  1GA9 A;  3HUO A;  1SDN A;  3PBO A;  4OQI A;  1K4E A;  1JWP A;  1L0G A;  3HUN A;  5GHZ A;  2Y59 A;  1GHP A;  4JXG A;  4E3N A;  4R23 A;  2Y2O A;  4X68 A;  3G34 A;  3QNC A;  5AQA A;  3JYI A;  1IYP A;  2HPB A;  5FI6 A;  1KDS A;  1S0W A;  3BFC A;  4C6Y A;  4KZA A;  5GLB A;  1IEM A;  3Q82 A;  1AXB A;  4LV3 A;  2IWB A;  3OCN A;  4DKI A;  3BYD A;  2V20 A;  3IT9 A;  3VP3 A;  4K0W A;  4BLM A;  1MWR A;  2PBY A;  3OCL A;  1PZO A;  4QD4 A;  4BD0 A;  2ZQD A;  4P85 A;  3OPH A;  3V3S A;  4L0L A;  1I2W A;  1PW1 A;  4S2P A;  2EXA A;  5CGS A;  2EX2 A;  1SCW A;  1Y54 A;  3BFG A;  3G2Y A;  3WS0 A;  1VM1 A;  1Z6F A;  4JXW A;  4MBH A;  5CER A;  2GDN A;  4DF6 A;  5HW3 A;  4GN2 A;  4JF4 A;  1HTZ A;  3G31 A;  2HDS A;  2R9X A;  4BD1 A;  4HES A;  1KGG A;  4DDS A;  4EUZ A;  2E8I A;  3VOZ A;  3C7U A;  3CZD A;  5G18 A;  5GHY A;  5CEB A;  3O88 A;  4Q8I A;  1W8Q A;  4WEK A;  1G68 A;  2ZQ8 A;  5CGW A;  1PI5 A;  3G35 A;  3M6H A;  2Y2I A;  5FQK A;  3G2Z A;  4S2O A;  1W5D A;  1PIO A;  5FI7 A;  3BFE A;  4OQG A;  2Y4A A;  1YT4 A;  4X56 A;  3UDF A;  4XXR A;  1O7E A;  5U47 A;  4C75 A;  1M6K A;  1TVF A;  1L0D A;  4DE0 A;  4EBL A;  3RJU A;  3P98 A;  1PWD A;  3IQA A;  1K57 A;  2BG1 A;  5F83 A;  3C7V A;  3HLF A;  4K0X A;  2ZC6 B;  2WKI A;  1RCJ A;  5DVA A;  3V5M A;  1DY6 A;  5HX9 A;  1O07 A;  2ZM0 A;  3IF6 C;  3GSG A;  3MFD A;  2OV5 A;  2IWD A;  2EX6 A;  1K55 C;  1YMS A;  3VFH A;  3VFF A;  1FQG A;  3E2K A;  5DTS A;  5AQ9 A;  3EQV A;  3GTC A;  2VGJ A;  3BM6 A;  1ES4 A;  2Q9M A;  4K91 A;  2OLU A;  3HVF A;  3NDG A;  3IH8 A;  3SS3 A;  3BLS A;  1YQS A;  4PPR A;  1YLT A;  1G6A A;  4DE1 A;  3PBN A;  2Y2N A;  1SHV A;  3C4P A;  4PM9 A;  1GA0 A;  1K25 A;  1SDE A;  4DRT A;  3I7J A;  2ZD8 A;  4LV2 A;  3RXX A;  4QB8 A;  1CEG A;  4S2I A;  5FA7 A;  4EV4 A;  1Q2Q A;  4N9L A;  1RGZ A;  4EBN A;  4IED A;  3FZC A;  3VMA A;  1YLJ A;  4UHU A;  1FSY A;  3QHY A;  4JLF A;  1NZU A;  3LY4 A;  2XQZ A;  3GR2 A;  2OLV A;  1W79 A;  4KG2 A;  2ZC5 B;  4E6X A;  1YMX A;  3NY4 A;  1ZG4 A;  4KZ5 A;  5E2E A;  2G2U A;  2Y55 A;  4N1H A;  3VP2 A;  3ZG5 A;  4N1X A;  4HEF A;  1ZC2 A;  4RVA A;  5A92 A;  2HDQ A;  4Y0U A;  3M2J A;  4KZB A;  2JBF A;  4IVK A;  1XXM A;  5GHX A;  1GHI A;  5AQB A;  2PU4 A;  3S22 A;  4X69 A;  1YLW A;  1ESI A;  1BLP A;  2XFS A;  2RL3 A;  2ZC7 A;  2ZC3 B;  1FR1 A;  3IF6 B;  3MXS A;  4XUZ A;  3WS5 A;  3N8L A;  5KMW A;  4KZ6 A;  3NC8 A;  3ZCZ A;  3ZG0 A;  3W4P A;  3NIA A;  1C3B A;  1PWC A;  3E2L A;  4B4Z A;  4X53 A;  1NRF A;  3QNB A;  3WWX A;  2ZQC A;  4ID4 A;  1BT5 A;  1KGF A;  3VP1 A;  1MBL A;  4B4X A;  3LEZ A;  5TR7 A;  2XGN A;  1CEF A;  4WMC A;  4Y0T A;  3Q07 A;  5EOO A;  1ALQ A;  1E25 A;  4R3J A;  3Q7Z A;  4OP8 A;  5F1G A;  3UPN A;  1IEL A;  3MZD A;  3W4Q A;  4WEJ A;  1W8Y A;  1K56 D;  4X6T A;  5EVI A;  4MBK A;  1ES5 A;  3BRM A;  4E3L A;  3CJM A;  4OLG A;  1BLS A;  4LEN A;  3AGF A;  1KVL A;  3ZGA B;  4GDN A;  2ZMA A;  3OPL A;  1IKI A;  4OOY A;  3UE3 A;  3BFF A;  1NY0 A;  3A3J A;  4E3O A;  4MBF A;  3IWI A;  4LV0 A;  1K6R A;  4MNR A;  5CTN A;  4E3K A;  2ZLY A;  2P9V A;  3LO7 A;  4ZJ2 A;  3PBS A;  2JCH A;  3MKE A;  4GB7 A;  3C5A A;  4KZ8 A;  3HLE A;  5D3O A;  4OOL A;  2XEP A;  1LLB A;  4WYY A;  4YFM A;  2WAD A;  4OPY A;  1K4F A;  1K54 C;  2EFU A;  3O86 A;  2X71 A;  4PM7 A;  2Y2J A;  5E2F A;  4S2K A;  2DRW A;  4OP5 A;  5AQ7 A;  3OZH A;  3C4O A;  3OPR A;  4UA9 A;  2XDM A;  4FD8 A;  4A5R A;  1E4D A;  1I2S A;  2B5R A;  3N8S A;  5A93 A;  3AGE A;  3EQU A;  4N9K A;  3DTM A;  1ERM A;  2WYX A;  4OPZ A;  4GD6 A;  3FWL A;  4Y7P A;  1GHM A;  4UA7 A;  4OQ0 A;  4F94 A;  1QME A;  4OVD A;  3IXB A;  1K54 A;  3MXR A;  3ITA A;  5JYO A;  4Z9Q A;  4RX2 A;  5TGF A;  1BUL A;  3IXD A;  1ERQ A;  1BSG A;  1CK3 A;  4KQQ A;  4BQM A;  3WS1 A;  2J8Y A;  2P74 A;  4CJN A;  4UAA A;  2EX8 A;  2QZ6 A;  2Y2H A;  1BLC A;  4R4S A;  4S2M A;  5A91 A;  1ONH A;  1MWT A;  1KVM A;  4GOG A;  2XF3 A;  3GVB A;  1M40 A;  4O7D A;  3PBQ A;  3Q81 A;  2Y2Q A;  1JTG A;  2OSU A;  5F1F A;  2Y2G A;  3WS2 A;  4DE3 A;  1K38 A;  1MXO A;  4LCL A;  4YIN A;  5FSR A;  1IYQ A;  1NXY A;  3BEB A;  1L0F A;  3CMZ A;  4QJG A;  4U0T A;  5HAR A;  1LL5 A;  5E43 A;  3IF6 A;  3PTE A;  5FQQ A;  1K55 A;  2XD1 A;  5DF7 A;  5FQI A;  3V3R A;  2ZM2 A;  4EQI A;  1JWV A;  2HP6 A;  4R3B A;  5M1A A;  1KE3 A;  3ZG9 B;  3UN7 A;  4QHC A;  5CXW A;  3UE0 A;  3UO9 A;  2WGW B;  4GNU A;  1XPB A;  3SS5 A;  3N6I A;  4C3Q A;  4QY6 A;  1FCM A;  1JVJ A;  4QU3 A;  3B3X A;  3Q7V B;  3WS4 A;  4ZDX A;  3FKV A;  4EBP A;  4WBG A;  4E3J A;  4M3K A;  1EWZ A;  3IH9 A;  3VSL A;  2WAE A;  4OOM A;  1ONG A;  3IWO A;  5CHJ A;  3UNW A;  3HRE A;  5KSH A;  2Q9N A;  4WZ5 C;  1PW8 A;  3RXW A;  2EXB A;  4PM6 A;  4BEN A;  4U3T A;  1YLY A;  2J9P A;  3PBR A;  4KG5 A;  3TG9 A;  3DWZ A;  1DJC A;  2HP5 A;  1E3U D;  1BTL A;  2WKE A;  4NK3 A;  5JYP A;  3S1Y A;  4WEL A;  5HL1 A;  1H8Y A;  3HUM A;  1U60 A;  3ZHH A;  1FCO A;  2H5S A;  1NZO A;  3ZFZ A;  4JF5 A;  3G32 A;  2X02 A;  1XA7 A;  3A3F A;  3A3E A;  5HAI A;  4JPM A;  2A3U A;  1K6S A;  3HLW A;  5DTT A;  3SS4 A;  2JE5 A;  1XP4 A;  3HLD A;  4JKT A;  3TSG A;  4S2J A;  5EUA A;  1MWU A;  3A3I A;  4UA6 A;  5FQ9 A;  2H0T A;  2JC7 A;  5GLA A;  5M18 A;  3V50 A;  1RP5 A;  2WZX A;  3GQZ A;  3HLG A;  1QMF A;  1VQQ A;  4PM5 A;  3N8R A;  2XD5 A;  2XK1 A;  4JBF A;  2WGV A;  4DXC A;  1MPL A;  1RGY A;  5KSC A;  1Q2P A;  3VSK A;  1IYO A;  3GV9 A;  1IYS A;  2FFY A;  4JXV A;  1ES2 A;  1BZA A;  1K56 A;  4JF6 A;  2XLN A;  1L2S A;  3O87 A;  1ZG6 A;  2I72 A;  4CPK A;  4JXS A;  5HAQ A;  4B88 A;  4QY5 A;  1XA1 A;  2IWC A;  2H0Y A;  4LV1 A;  2CC1 A;  4N92 A;  1JWZ A;  5HAP A;  2WZZ A;  4RYE A;  1WYB A;  1YLP A;  5EVI D;  3W8K A;  2UWX A;  2ZQ7 A;  4E3M A;  3W4O A;  3IF5 A;  3FV7 A;  3IHA A;  5L2F A;  3ZNY A;  3O3V A;  4IBR A;  3PAG A;  3SOI A;  4KZ4 A;  3ZDJ A;  3MKF A;  4R0Q A; 
#chains in the Genus database with same CATH topology
 3EWK A;  4GD8 A;  3FKW A;  5AVF A;  1TDG A;  1KGE A;  3T1R A;  4QWO A;  3SH9 A;  4ZTK A;  1FCN A;  5EE8 A;  3S4X A;  4Z1W A;  1KDW A;  1OTA A;  3MZE A;  1HVB A;  3FG8 A;  1CI8 A;  3ZVW A;  5HD5 A;  5DKK A;  4WZ4 A;  1XJ3 A;  1K57 C;  2W1T A;  3MF0 A;  5DTK A;  2CMN A;  4R4R A;  2C5W B;  1L0E A;  4M4X A;  1JTD A;  2V1B A;  3M6B A;  4O8G A;  1CQA A;  4L9G A;  4ZJ1 A;  1NJ4 A;  4KZ3 A;  3UNW A;  1N4O A;  4MEZ A;  3M2K A;  1KOU A;  4Y17 A;  3E4P A;  2VGL S;  2ZMV A;  3BEC A;  2QJ5 A;  4R1G A;  3P7N A;  1WE4 A;  4ZJ3 A;  4DJ3 A;  3ZVT A;  2HDR A;  4I39 A;  5HPF A;  1ZKJ A;  2WUQ A;  5FAQ A;  3T4K A;  1LHY A;  4KQR A;  3LY3 A;  4GHI A;  2B95 A;  1WA9 A;  4P0M A;  2VJW A;  2XA7 S;  3OPP A;  4GZB A;  3LCE A;  2K31 A;  1PWG A;  2XRN A;  5FAP A;  4NET A;  3VP4 A;  3LIC A;  2WAF A;  1MY8 A;  4U0X A;  3WRT A;  3U4L P;  5E2H A;  2ZBB A;  5CTM A;  3HJI A;  2OAP 1;  4X1L A;  4EEU A;  1BUE A;  1ZHH B;  1BLH A;  3H82 A;  1VHM A;  1SZV A;  3UY6 A;  1EI5 A;  4H6J A;  5M19 A;  4MMN A;  4MLL A;  3G30 A;  1TEM A;  4S2N A;  5CEC A;  2HF6 A;  1XX2 A;  4X55 A;  3JVV A;  2A49 A;  4MN7 A;  2K7S A;  1F5M A;  1LL9 A;  4E6W A;  3T1X A;  4NKP A;  5J7E A;  1PFL A;  5FQM A;  5GLD A;  1FSW A;  3LIE A;  1ES3 A;  4BL3 A;  5J3W A;  1TS6 A;  4EEP A;  3IWQ A;  3DTI A;  1GA9 A;  4IVI A;  1SDN A;  1K4E A;  4JXG A;  3L7H A;  4X68 A;  5FI6 A;  1KDS A;  2UV0 E;  4Y3I A;  5GLB A;  4LV3 A;  2IWB A;  3OCN A;  3BYD A;  2V20 A;  4FUW A;  3OCL A;  4QD4 A;  4P85 A;  3BJN A;  3ULF A;  4S2P A;  5CGS A;  1SCW A;  3BFG A;  3G2Y A;  4MBH A;  1HTZ A;  3B42 A;  1KGG A;  3VOZ A;  5CEB A;  4Q8I A;  1W8Q A;  4WEK A;  2ZQ8 A;  3M6H A;  3G35 A;  2PR5 A;  2ZL1 A;  4YOF A;  1IOU A;  2V9A A;  1M6K A;  3K3C A;  3RJU A;  5F6A A;  1UWN X;  2WKQ A;  3JPU A;  3CWF A;  2QWS A;  3C7V A;  4K0X A;  3EGX C;  3GSG A;  3VFF A;  5FEG A;  1FQG A;  3DTK A;  3E2K A;  4HJ6 A;  5DTS A;  3D3O A;  2VGJ A;  2OLU A;  3HVF A;  3A0V A;  4PPR A;  4CLC C;  1G6A A;  2Z6D A;  3S7O A;  1V9Z A;  5EV0 A;  2DMW A;  1N9L A;  1SHV A;  4PM9 A;  5FDS A;  3UB7 A;  2HV1 A;  2ZD8 A;  5F68 A;  2VV6 A;  4QB8 A;  1CEG A;  4S2I A;  1Q2Q A;  2L0W A;  4UHU A;  1FSY A;  2OLV A;  4KG2 A;  4KZ5 A;  1ZG4 A;  4N1H A;  3ZG5 A;  1ZC2 A;  1OTB A;  4RVA A;  3HCY A;  4KZB A;  4IVK A;  5GHX A;  5AQB A;  2H28 A;  1YLW A;  3WS5 A;  3MXS A;  5HDC A;  3ZG0 A;  3NIA A;  4WN5 A;  3P01 A;  3K2N A;  1MBL A;  4B4X A;  2XGN A;  4WMC A;  4I3I A;  4R3J A;  5F1G A;  3UPN A;  4HH3 A;  3VV4 A;  1K56 D;  2Y8H A;  4OLG A;  4JGR A;  1KVL A;  3LR0 A;  1ACF A;  3BFF A;  3KSG A;  1NY0 A;  4LV0 A;  5IT5 A;  2ZLY A;  2JCH A;  3HLE A;  1N9O A;  5D3O A;  1LLB A;  1FIL A;  2EFU A;  4DJ2 A;  4B93 A;  4S2K A;  5AQ7 A;  5HWV A;  3OZH A;  4FD8 A;  2LB9 A;  3D72 A;  4ME4 A;  3CPT B;  1I2S A;  2B5R A;  3N8S A;  3AGE A;  4HY8 A;  3FC7 A;  4ETX A;  3DTM A;  2WYX A;  1GHM A;  4F94 A;  4O0P A;  1QME A;  4OVD A;  3IXB A;  1K54 A;  3MXR A;  2WKR A;  1BUL A;  1CK3 A;  2OWH A;  3LUQ A;  3WS1 A;  2J8Y A;  5HD3 A;  4CJN A;  1VET B;  2QZ6 A;  2GZA A;  4YWZ A;  4PAU A;  3Q81 A;  1JTG A;  1DRM A;  3O5Y A;  1L0F A;  5DFX A;  3PTE A;  4EQI A;  3DAV A;  4QPR A;  2QHK A;  4IHQ A;  3KYQ A;  5M1A A;  1GSW A;  3UO9 A;  4GNU A;  1XPB A;  3SS5 A;  4C3Q A;  4QY6 A;  4NXG A;  4QU3 A;  4ZDX A;  3FKV A;  2WAE A;  2PR6 A;  5K5B A;  3D9Y A;  1PW8 A;  1W63 Q;  4KG5 A;  5JYP A;  4WEL A;  2Y79 A;  3H7W A;  1YKD A;  2X02 A;  3A3F A;  3A3E A;  4JPM A;  5DTT A;  2AVX A;  4JKT A;  3TSG A;  5EUA A;  1MWU A;  5M18 A;  2H0T A;  3E4Q A;  3V50 A;  1RP5 A;  3GQZ A;  3N8R A;  2XK1 A;  4DXC A;  1RGY A;  3VSK A;  1IYO A;  4IJG A;  3GV9 A;  1ES2 A;  3EGD C;  3UME A;  4EUV A;  3O87 A;  3LR3 A;  1ZG6 A;  4Y15 A;  5HAQ A;  4Y5F A;  3H82 B;  3NHQ A;  4H6J B;  4MN6 A;  5EVI D;  2UWX A;  2ZQ7 A;  3W4O A;  3MFX A;  1SKO A;  4BMW A;  3MKF A;  4Y2F A;  4P6B A;  3D4F A;  2C6W B;  5EM0 A;  2J7V A;  4EWF A;  2VA0 A;  3N4I A;  1XJ6 A;  1H5X A;  4OQH A;  4LCM A;  4P87 A;  3IHB A;  1CF0 A;  5CHM A;  1MKI A;  1GCE A;  2EA9 A;  1ERO A;  3B33 A;  5MC7 A;  2HDU A;  5IHV A;  1PZP A;  3Q7V A;  4JGP A;  5EVI B;  4HJ4 A;  3SH8 A;  5J8X A;  1YAX A;  3NOT C;  5DF8 A;  2R78 A;  1JNU A;  4PMA A;  2BTF P;  1OT6 A;  2QYB A;  1WYC A;  2D01 A;  5TFQ A;  4WLA A;  2QJ7 A;  4G3V A;  1N9N A;  3UE6 A;  5F5Y A;  1I5Q A;  1L3L A;  4KZ7 A;  3ISG A;  4UEY A;  5KIZ A;  1W7F A;  2G2W A;  3VP0 A;  1KE0 A;  2Z2L B;  2ZL1 B;  4HOI A;  4OON A;  3A3D A;  2DCF A;  2ZQ9 A;  2XFT A;  3SW1 A;  3BFD A;  1NYM A;  1TS7 A;  1F9I A;  2QMI A;  3LIA A;  1N9B A;  4GS9 A;  5CRF A;  3T1S A;  2JKT M;  4EET B;  1E3U A;  5F82 A;  2PAV P;  2V2F F;  4PKY A;  2Z2M B;  4WZ5 A;  5A8B A;  4KUO A;  2JKF A;  2PU2 A;  4OLD A;  4RA7 A;  3CG5 A;  2XSS A;  4HHD A;  3LIF A;  1YSP A;  2ZM8 A;  1HZO A;  3GRJ A;  4H8R A;  1V9Y A;  3TOI A;  3LI9 A;  3LR5 A;  1ESU A;  4WMC D;  3MJQ A;  4WUJ A;  3IXH A;  5TJJ A;  3HUO A;  5GHZ A;  1T1A A;  3RH8 B;  2O9A A;  2P08 A;  1S0W A;  5EVE A;  1AXB A;  3T1Q B;  3KYZ A;  3IT9 A;  1Z09 A;  3VP3 A;  4K0W A;  4BLM A;  3RTY A;  3NJA A;  1T18 A;  4ETZ A;  4L0L A;  2W3D A;  2EXA A;  3QP6 A;  3WS0 A;  4GN2 A;  4JF4 A;  3G31 A;  4BD1 A;  4EUZ A;  3C7U A;  3CZD A;  3U2A A;  4EU0 A;  3O88 A;  5FQK A;  3G2Z A;  4S2O A;  4WF0 A;  1T19 A;  1W5D A;  5FI7 A;  3PXP A;  4GW9 A;  4I3A A;  4ARZ A;  4R6L A;  3MS6 A;  4X56 A;  1L0D A;  4EBL A;  3P98 A;  2WKP A;  2W3G A;  2J3T D;  4DMZ A;  3QP8 A;  1VEU A;  5DVA A;  3V5M A;  1O07 A;  2ZM0 A;  2OV5 A;  3BW6 A;  1YMS A;  3GTC A;  5HZH A;  2Q9M A;  3NDG A;  4WL9 A;  1LSV A;  1G28 A;  3BLS A;  4BBT A;  1YLT A;  1J3W A;  3PBN A;  2PDR A;  3PYP A;  1OTI A;  3C4P A;  4DRT A;  3I7J A;  4Q0J A;  3NUL A;  4RQ9 A;  1OJG A;  3FZC A;  5TBM A;  3TW8 A;  1F2K A;  1NZU A;  2XQZ A;  1YMX A;  3NY4 A;  1S66 L;  5E2E A;  2Y55 A;  3VP2 A;  4E04 A;  4N1X A;  1OTD A;  3M2J A;  3E4O A;  2A24 A;  3S22 A;  3BQA A;  4X69 A;  1BLP A;  2ZC7 A;  3HJK A;  3T4J A;  1D7E A;  5KMW A;  1Y4O A;  1C3B A;  2M1C A;  4B4Z A;  3WWX A;  4ID4 A;  1KGF A;  1GSV A;  1STZ A;  4Y0T A;  3IX4 A;  3Q07 A;  5EOO A;  2ZOH A;  5EVI A;  4KQD A;  3JVU A;  1BLS A;  4LEN A;  2O99 A;  3A0R A;  3ZGA B;  3IBJ A;  4L9E A;  4OOY A;  1UGU A;  3H7W B;  5CTN A;  4E3K A;  4Y13 A;  3MKE A;  3VE4 A;  2ACG A;  2PYP A;  4OOL A;  3CUE A;  4WYY A;  4YFM A;  4OPY A;  3IBR A;  1K4F A;  4B9O A;  3O86 A;  4PM7 A;  3S7P A;  4OP5 A;  3T4Q A;  3C4O A;  3OPR A;  2B02 A;  2NUP C;  1MZU A;  4A5R A;  5A93 A;  4N9K A;  5HWW A;  1ERM A;  1Y28 A;  4OQ0 A;  5JYO A;  3QP5 A;  4RX2 A;  1ERQ A;  1BSG A;  3KO6 A;  3QP1 A;  1SKO B;  3IS2 B;  4IUK A;  5A91 A;  1ONH A;  1KVM A;  2V8C A;  2L1M A;  2Y2G A;  4LPZ A;  4DE3 A;  5FSR A;  3BEB A;  3CMZ A;  5HAR A;  5IS1 A;  1D1J A;  1LL5 A;  3C8C A;  5E43 A;  3IF6 A;  2P7J A;  1K55 A;  2XD1 A;  1JWV A;  3B47 A;  4K08 A;  2HP6 A;  3ZG9 B;  3UN7 A;  4QHC A;  3UE0 A;  2P04 A;  3N6I A;  1FCM A;  1JVJ A;  3DTE A;  3Q7V B;  4X1M A;  4EBP A;  4WBG A;  2EXB A;  4U3T A;  1YLY A;  2J9P A;  2HP5 A;  2WKE A;  1E3U D;  4Q0H A;  5HL1 A;  3ZHH A;  1FCO A;  1NZO A;  1S1Y A;  1ZTU A;  4JF5 A;  5HAI A;  4F3L A;  3HLW A;  3A3I A;  4UA6 A;  4KUK A;  2OAQ 1;  2WZX A;  3HLG A;  1VQQ A;  3OBF A;  2PYR A;  4JBF A;  1MPL A;  5KSC A;  4JXV A;  4GS9 B;  4I5S A;  2XLN A;  1L2S A;  2HJ9 C;  4I38 A;  3FPV A;  4P6Z M;  1IFQ A;  3CI6 A;  4N92 A;  1JWZ A;  3GDI A;  1LL8 A;  3A0S A;  3G6O A;  4LFU A;  4RYE A;  5HPI A;  1YLP A;  3IHA A;  5L2F A;  3ZNY A;  2O9B A;  3EEH A;  3O3V A;  4IBR A;  3ZDJ A;  3LEQ A;  4HBU A;  4HQA A;  1FR6 A;  2VEA A;  2KX6 A;  5FAT A;  4XUX A;  4EXO A;  3NDE A;  1LI9 A;  1S6R A;  1XJ4 A;  1H3Q A;  5FI2 A;  4BL2 A;  3K3D A;  1VB6 A;  3OC2 A;  2FFF B;  1AWI A;  3MZF A;  5GL9 A;  3HL9 A;  2JKT I;  4KZ9 A;  5I94 A;  1PI4 A;  2WGW A;  4ZBE A;  2EX9 A;  3ITB A;  1XKZ A;  3PAE A;  4OH0 A;  5FQJ A;  3LYX A;  2VX8 A;  3ZG8 B;  3UDI A;  4RX3 A;  4ZAM A;  1DJB A;  3P09 A;  5FDH A;  3OOV A;  4OPQ A;  2HP9 A;  1TS8 A;  3NBL A;  3HLC A;  3GMW A;  2VGK A;  2O0Y A;  3UE1 A;  3ZNT A;  4MN5 A;  1FOF A;  4NXB A;  5KZH A;  3HBR A;  4DXB A;  3Q1F A;  3V39 A;  3LID A;  3C30 A;  4GKU A;  3IXG A;  3SH7 A;  2Y2K A;  2FZ0 A;  4OPR A;  2QPN A;  4ARZ B;  3DW0 A;  1XGI A;  4FSF A;  4S2L A;  5CED A;  4HJ3 A;  3CHW P;  4KQO A;  4MDZ A;  4KG6 A;  1NYY A;  3NI9 A;  4GDB A;  4CLC D;  1IKG A;  4LRZ E;  2Y2M A;  2WKH A;  3T12 B;  3KX0 X;  2QKP A;  1VEU B;  2R9W A;  2MJ6 A;  3HLB A;  1SKF A;  1P9W A;  1J9M A;  2X01 A;  4D2O A;  5BOH A;  1H8Z A;  2M7U A;  2Y2L A;  4I3J A;  3TJZ C;  2ZQA A;  5CGX A;  5EVL A;  1XGJ A;  2XH9 A;  2JKG A;  1TDL A;  4AFI A;  1P9R A;  5HFO A;  4DDY A;  1PYY A;  5FAS A;  3UPP A;  5E2G A;  1OPX A;  5TBM B;  4E3I A;  2DNS A;  5EOE A;  1OT9 A;  3PBO A;  4OQI A;  5HDS A;  1JWP A;  1L0G A;  2JKR M;  2PBD P;  5DKL A;  2Y2O A;  3QNC A;  3JYI A;  1IYP A;  3BFC A;  4XT2 A;  3Q82 A;  3IS2 A;  2XRO A;  1MWR A;  2A24 B;  2PBY A;  1PZO A;  4BD0 A;  3FPW A;  1G5U A;  3OPH A;  2XA7 M;  3V3S A;  1PW1 A;  5DFY A;  2Q0O A;  2EX2 A;  1Y54 A;  1VM1 A;  4JXW A;  5CER A;  4DF6 A;  2INW A;  2HDS A;  2YKH A;  2R9X A;  4HES A;  4DDS A;  2E8I A;  4UQI M;  1G68 A;  1PI5 A;  1W63 M;  2J3T C;  1A0K A;  5G4Y A;  2Y4A A;  2V1A A;  3H9W A;  5U47 A;  1YSQ A;  4DE0 A;  2BAS A;  3F1P B;  4ZRR A;  3IQA A;  5FEF A;  1K57 A;  4HIA A;  1TS0 A;  3HLF A;  2ZC6 B;  2WKI A;  1NWZ A;  3SZT A;  2PHY A;  2IWD A;  3VFH A;  4K91 A;  1ES4 A;  3SS3 A;  2JHE A;  2KOI A;  4P6Z S;  4NXF A;  1GA0 A;  3RXX A;  5FA7 A;  4EV4 A;  1RGZ A;  4EBN A;  4IED A;  3T4T A;  1T1B A;  3KSF A;  3OLO A;  2GX5 A;  3LY4 A;  3MSH A;  2ZC5 B;  5EFW A;  5HDD A;  2G2U A;  4HEF A;  1XXM A;  1ESI A;  3R4K A;  1FR1 A;  1LT0 A;  3IF6 B;  4XUZ A;  3N8L A;  1DP9 A;  3NC8 A;  4NXE A;  5IU1 A;  3ZCZ A;  3W4P A;  4ESP A;  4X53 A;  3NOU C;  1BT5 A;  1S4R A;  3VP1 A;  3LFV A;  2Z6C A;  5L10 A;  3BY9 A;  3Q7Z A;  3W4Q A;  4JGQ A;  4WEJ A;  1W8Y A;  4MBK A;  1D06 A;  4E3L A;  4GDN A;  2A2L A;  3UE3 A;  1IKI A;  3R7W A;  2V0U A;  1TD5 A;  3IWI A;  4MNR A;  4Q0I A;  4F3L B;  3LO7 A;  4ZJ2 A;  2W27 A;  3GEC A;  4GB7 A;  3C5A A;  2W3E A;  1H8M A;  2D02 A;  2Y2J A;  2DRW A;  4UA9 A;  2XDM A;  1E4D A;  1ODV A;  1P0Z A;  1P97 A;  2FH5 A;  3ICY A;  4GJ4 A;  1OJ5 A;  4LLO B;  4Y7P A;  1BYW A;  3FWL A;  3BQ8 A;  4UA7 A;  3MR0 A;  2I9V A;  4Z9Q A;  5EM1 A;  4KQQ A;  4BQM A;  2P74 A;  1LSX A;  4UAA A;  2Y2H A;  3LR4 A;  4S2M A;  1MWT A;  5HSQ A;  3F1O A;  2W0N A;  2VV7 A;  1M40 A;  4O7D A;  3PBQ A;  3QP4 A;  2OSU A;  5F1F A;  3WS2 A;  4YIN A;  1MXO A;  1IYQ A;  4DN0 A;  4BWI A;  2B18 A;  3PHY A;  5FQQ A;  5DF7 A;  3V3R A;  2OOL A;  2ZM2 A;  4R38 A;  2V8F A;  2G7U A;  4CLC A;  2WGW B;  2KLI A;  3B3X A;  3CLO A;  1EWZ A;  3IH9 A;  3IWO A;  5CHJ A;  5KSH A;  4WZ5 C;  4NEE D;  4PM6 A;  4BEN A;  3EEA A;  3DWZ A;  1DJC A;  4II7 A;  1BTL A;  4NK3 A;  5FL3 A;  3S1Y A;  4UQI S;  5AJG A;  4BBU A;  3LGO A;  3G32 A;  1XA7 A;  3SS4 A;  1NLZ A;  4S2J A;  5GLA A;  5FQ9 A;  2JC7 A;  1G6O A;  5L8M A;  4PM5 A;  3NEC A;  4HI4 A;  1S4S A;  2K2N A;  3E98 A;  1IYS A;  3F1N B;  5L09 A;  1BZA A;  3UB5 P;  3F1P A;  3T4S A;  4EER A;  4CPK A;  3MQQ A;  4B88 A;  4QY5 A;  1XA1 A;  4LV1 A;  3MXQ A;  4FTX A;  1WYB A;  4E3M A;  3IF5 A;  3FV7 A;  2IA2 A;  3PR6 A;  2VK3 A;  2ZC4 B;  3IX3 A;  4FOF A;  3CIT A;  2NUT C;  3UPO A;  3TE8 A;  5FAO A;  4FH4 A;  3VOY A;  3KYE A;  5F69 A;  1MWS A;  2XR0 A;  4DE2 A;  2O9C A;  1HD8 A;  2EFX A;  5EPH A;  2ZJ9 A;  5HL6 A;  1LI0 A;  2PT7 A;  4HBT A;  4CQH A;  1YM1 A;  5DJT A;  4PM8 A;  4XT2 B;  2J9O A;  1DJA A;  4KEN B;  1H0M A;  3IX8 A;  5DF9 A;  2Y91 A;  2YKF A;  5CHU A;  2EWW A;  3E0Y A;  5G4Z A;  1F98 A;  4BBV A;  1DP6 A;  3V67 A;  5A90 A;  1OME A;  3NOP C;  4Y0O A;  2HZ5 A;  3DWK A;  2P9V B;  2WK0 A;  2V1Z A;  5EEC A;  3G4P A;  4G3W A;  1CI9 A;  2Y2P A;  4G3K A;  4WM9 A;  3N7W A;  2JKR I;  2W3H A;  1CJF A;  2WGI A;  4OKP A;  2BLS A;  3WRZ A;  3BLM A;  4S2N C;  1KE4 A;  4YNR A;  4BJP A;  5GLC A;  3T4L A;  2H10 A;  2W1R A;  4FH2 A;  4LRY C;  1HLU P;  2RCX A;  4IBX A;  3ZG7 B;  3MMH A;  4L9F A;  3KSI A;  3NCK A;  3UDX A;  2OWJ A;  3PBT A;  2J80 A;  4FCF A;  3FYZ A;  3LIB A;  1YLZ A;  4NG2 A;  3AGD A;  5EVI C;  3MBZ A;  1UWP X;  3EOI A;  4CLC E;  3HUN A;  2Y59 A;  1GHP A;  5HWT A;  4E3N A;  4R23 A;  3G34 A;  5AQA A;  2HPB A;  2VKS A;  4C6Y A;  4KZA A;  1IEM A;  1XFN A;  2V0W A;  4DKI A;  1MKM A;  3CUE C;  2ZQD A;  1S1Z A;  1I2W A;  3C2W A;  1Z6F A;  2GDN A;  5HW3 A;  4HP4 A;  2VV8 A;  4X25 A;  4EW7 A;  5G18 A;  5GHY A;  5CGW A;  2Y2I A;  1PIO A;  3BFE A;  4OQG A;  1YT4 A;  3UDF A;  4XXR A;  1O7E A;  4C75 A;  1TVF A;  2PD7 A;  1PWD A;  3RFB A;  3R7W B;  2BG1 A;  5F83 A;  1MC0 A;  1RCJ A;  1DY6 A;  5HX9 A;  3IF6 C;  3MFD A;  2EX6 A;  1K55 C;  3S7Q A;  5AQ9 A;  3EQV A;  3BM6 A;  3IH8 A;  1YQS A;  2HGV A;  4DE1 A;  2PD8 A;  2Y2N A;  5CX7 A;  1K25 A;  1DP8 A;  1SDE A;  3W2Z A;  4LV2 A;  4N9L A;  3F1N A;  2GNX A;  3VMA A;  1YLJ A;  2W1T B;  3QHY A;  1NRJ A;  4JLF A;  1NLY A;  2KDK A;  2EWV A;  3GR2 A;  1W79 A;  4HH2 A;  4E6X A;  3F1O B;  3ZYT A;  2ZOI A;  3UB9 A;  2L4R A;  2HDQ A;  4Y0U A;  5A92 A;  2JBF A;  1GHI A;  2PU4 A;  2JN7 A;  2RL3 A;  2XFS A;  2ZC3 B;  2VGL M;  4KZ6 A;  3VOL A;  3BY8 A;  1PWC A;  3E2L A;  1NRF A;  3MQ0 A;  3QNB A;  5DJU A;  2ZQC A;  2GJ3 A;  1X0O A;  4CLC B;  4GHI B;  3LEZ A;  4HNB A;  5TR7 A;  1CEF A;  1ALQ A;  1E25 A;  2M7V A;  4OP8 A;  1IEL A;  2LB5 A;  3MZD A;  4X6T A;  1ES5 A;  3BRM A;  3CJM A;  3AGF A;  3VE3 A;  2ZMA A;  3OPL A;  3ZQ5 A;  5AVE A;  3A3J A;  4E3O A;  4MBF A;  1K6R A;  2P9V A;  3UB6 A;  3PBS A;  4KZ8 A;  2XEP A;  2WAD A;  1K54 C;  2X71 A;  5E2F A;  5LBR A;  4HP9 A;  3EQU A;  4OPZ A;  4GD6 A;  4EES A;  3S7N A;  3ITA A;  3L9K A;  5TGF A;  3IXD A;  4O01 A;  4MCW A;  3T4O A;  2EX8 A;  5I5L A;  1BLC A;  4R4S A;  1XJ2 A;  4PKY G;  4GOG A;  2XF3 A;  3GVB A;  1T1C A;  2Y2Q A;  2VLG A;  1K38 A;  2E8J A;  4LCL A;  1OTE A;  3TRC A;  1NXY A;  4GCZ A;  4QJG A;  4U0T A;  1K0K A;  1YPR A;  5C5K A;  5FQI A;  1XFQ A;  4R3B A;  1KE3 A;  5CXW A;  2W3F A;  3WS4 A;  2PRF A;  4E3J A;  3BWL A;  4M3K A;  3CAX A;  3VSL A;  3MQO A;  4OOM A;  4GLQ A;  1ONG A;  3HRE A;  2Q9N A;  3RXW A;  3C38 A;  4PHT A;  1GSX A;  3TG9 A;  3PBR A;  3UB8 A;  2ZMF A;  1PNE A;  1H8Y A;  5J4E A;  3HUM A;  3UMD A;  1U60 A;  2H5S A;  3ZFZ A;  3T50 A;  2A3U A;  1K6S A;  1EW0 A;  4R3A A;  4R70 A;  2JE5 A;  1XP4 A;  4LGW A;  3HLD A;  4JGO A;  1PRQ A;  1QMF A;  2XD5 A;  2J3W A;  2WGV A;  1Q2P A;  2VZW A;  3CPT A;  3KSH A;  2FFY A;  3DBA A;  1K56 A;  4D60 A;  4JF6 A;  2HJE A;  2I72 A;  4JXS A;  4EQ1 A;  3LI8 A;  1S67 L;  2IWC A;  2H0Y A;  2CC1 A;  4IUH A;  5HAP A;  2WZZ A;  3W8K A;  3QP2 A;  1FIK A;  3PAG A;  3SOI A;  1VET A;  1LSW A;  4KZ4 A;  4LRX C;  5L07 A;  4R0Q A;  1TF1 A; 
#chains in the Genus database with same CATH homology
 2ZC4 B;  4HBU A;  4GD8 A;  4P6B A;  1FR6 A;  2C6W B;  3D4F A;  2J7V A;  3FKW A;  1TDG A;  1KGE A;  4EWF A;  3SH9 A;  3UPO A;  5FAT A;  4XUX A;  4ZTK A;  1FCN A;  5FAO A;  5EE8 A;  3N4I A;  1LI9 A;  1H5X A;  3NDE A;  4FH4 A;  1S6R A;  4LCM A;  4OQH A;  3S4X A;  3VOY A;  4P87 A;  5FI2 A;  4BL2 A;  1KDW A;  1MWS A;  3MZE A;  1HVB A;  2XR0 A;  4DE2 A;  1CI8 A;  3IHB A;  3ZVW A;  3OC2 A;  2FFF B;  1HD8 A;  2EFX A;  5CHM A;  5EPH A;  3MZF A;  5GL9 A;  1MKI A;  1GCE A;  2ZJ9 A;  3HL9 A;  4WZ4 A;  1K57 C;  1ERO A;  1LI0 A;  4HBT A;  4KZ9 A;  5I94 A;  5DTK A;  4R4R A;  1PI4 A;  1L0E A;  2C5W B;  2WGW A;  2HDU A;  1JTD A;  3M6B A;  4ZBE A;  1YM1 A;  2EX9 A;  4PM8 A;  4ZJ1 A;  1NJ4 A;  5IHV A;  4KZ3 A;  2J9O A;  1N4O A;  1DJA A;  3ITB A;  1XKZ A;  3M2K A;  1PZP A;  3PAE A;  3Q7V A;  4KEN B;  4MEZ A;  4OH0 A;  5EVI B;  5FQJ A;  5DF9 A;  3BEC A;  3SH8 A;  2Y91 A;  4R1G A;  5CHU A;  5J8X A;  1WE4 A;  5DF8 A;  4ZJ3 A;  3ZVT A;  3ZG8 B;  5A90 A;  1OME A;  3UDI A;  4PMA A;  4Y0O A;  4RX3 A;  2HDR A;  4ZAM A;  1DJB A;  1WYC A;  3P09 A;  5FDH A;  4OPQ A;  2HP9 A;  3DWK A;  5TFQ A;  3NBL A;  3HLC A;  3GMW A;  1ZKJ A;  2P9V B;  2VGK A;  2WK0 A;  2WUQ A;  3UE1 A;  3ZNT A;  5FAQ A;  2V1Z A;  1FOF A;  5EEC A;  5KZH A;  3G4P A;  1CI9 A;  1I5Q A;  2Y2P A;  3HBR A;  4DXB A;  4WM9 A;  3Q1F A;  4KZ7 A;  3ISG A;  3V39 A;  1LHY A;  4GKU A;  4KQR A;  1W7F A;  3LY3 A;  2G2W A;  3N7W A;  1KE0 A;  3VP0 A;  2Z2L B;  4P0M A;  3IXG A;  4OON A;  3SH7 A;  2Y2K A;  3A3D A;  4OPR A;  2QPN A;  2DCF A;  3OPP A;  4GZB A;  3LCE A;  3DW0 A;  1XGI A;  1PWG A;  2WGI A;  2ZQ9 A;  4FSF A;  4NET A;  5FAP A;  4S2L A;  3VP4 A;  5CED A;  2WAF A;  1MY8 A;  2BLS A;  2XFT A;  3BLM A;  3BFD A;  4OKP A;  3WRZ A;  4U0X A;  1NYM A;  3WRT A;  4KQO A;  2QMI A;  5E2H A;  4KG6 A;  1KE4 A;  1NYY A;  4S2N C;  3NI9 A;  4GDB A;  1N9B A;  5CTM A;  4BJP A;  1IKG A;  5CRF A;  2Y2M A;  5GLC A;  2WKH A;  1BUE A;  1BLH A;  2H10 A;  4FH2 A;  3UY6 A;  1E3U A;  1EI5 A;  2R9W A;  5F82 A;  5M19 A;  3HLB A;  1SKF A;  2RCX A;  4IBX A;  3ZG7 B;  1J9M A;  2V2F F;  4MLL A;  3G30 A;  1TEM A;  3NCK A;  2X01 A;  2Z2M B;  4S2N A;  4WZ5 A;  5CEC A;  4D2O A;  5BOH A;  3UDX A;  1H8Z A;  1XX2 A;  2PU2 A;  2Y2L A;  4X55 A;  2ZQA A;  5CGX A;  5EVL A;  1XGJ A;  4OLD A;  2XH9 A;  2A49 A;  3CG5 A;  4RA7 A;  1TDL A;  3PBT A;  2ZM8 A;  5HFO A;  4FCF A;  1HZO A;  3FYZ A;  4DDY A;  3GRJ A;  1LL9 A;  4E6W A;  1YLZ A;  4H8R A;  3AGD A;  5FQM A;  3TOI A;  5EVI C;  1PYY A;  5GLD A;  3UPP A;  5FAS A;  1FSW A;  5E2G A;  1ES3 A;  4BL3 A;  1ESU A;  3MBZ A;  4E3I A;  4WMC D;  2DNS A;  3IXH A;  3IWQ A;  5EOE A;  4IVI A;  1GA9 A;  3HUO A;  1SDN A;  3PBO A;  4OQI A;  1K4E A;  1JWP A;  1L0G A;  3HUN A;  5GHZ A;  2Y59 A;  1GHP A;  4JXG A;  4E3N A;  4R23 A;  2Y2O A;  4X68 A;  3G34 A;  3QNC A;  5AQA A;  3JYI A;  1IYP A;  2HPB A;  5FI6 A;  1KDS A;  1S0W A;  3BFC A;  4C6Y A;  4KZA A;  5GLB A;  1IEM A;  3Q82 A;  1AXB A;  4LV3 A;  2IWB A;  3OCN A;  4DKI A;  3BYD A;  2V20 A;  3IT9 A;  3VP3 A;  4K0W A;  4BLM A;  1MWR A;  2PBY A;  3OCL A;  1PZO A;  4QD4 A;  4BD0 A;  2ZQD A;  4P85 A;  3OPH A;  3V3S A;  4L0L A;  1I2W A;  1PW1 A;  4S2P A;  2EXA A;  5CGS A;  2EX2 A;  1SCW A;  1Y54 A;  3BFG A;  3G2Y A;  3WS0 A;  1VM1 A;  1Z6F A;  4JXW A;  4MBH A;  5CER A;  2GDN A;  4DF6 A;  5HW3 A;  4GN2 A;  4JF4 A;  1HTZ A;  3G31 A;  2HDS A;  2R9X A;  4BD1 A;  4HES A;  1KGG A;  4DDS A;  4EUZ A;  2E8I A;  3VOZ A;  3C7U A;  3CZD A;  5G18 A;  5GHY A;  5CEB A;  3O88 A;  4Q8I A;  1W8Q A;  4WEK A;  1G68 A;  2ZQ8 A;  5CGW A;  1PI5 A;  3G35 A;  3M6H A;  2Y2I A;  5FQK A;  3G2Z A;  4S2O A;  1W5D A;  1PIO A;  5FI7 A;  3BFE A;  4OQG A;  2Y4A A;  1YT4 A;  4X56 A;  3UDF A;  4XXR A;  1O7E A;  5U47 A;  4C75 A;  1M6K A;  1TVF A;  1L0D A;  4DE0 A;  4EBL A;  3RJU A;  3P98 A;  1PWD A;  3IQA A;  1K57 A;  2BG1 A;  5F83 A;  3C7V A;  3HLF A;  4K0X A;  2ZC6 B;  2WKI A;  1RCJ A;  5DVA A;  3V5M A;  1DY6 A;  5HX9 A;  1O07 A;  2ZM0 A;  3IF6 C;  3GSG A;  3MFD A;  2OV5 A;  2IWD A;  2EX6 A;  1K55 C;  1YMS A;  3VFH A;  3VFF A;  1FQG A;  3E2K A;  5DTS A;  5AQ9 A;  3EQV A;  3GTC A;  2VGJ A;  3BM6 A;  1ES4 A;  2Q9M A;  4K91 A;  2OLU A;  3HVF A;  3NDG A;  3IH8 A;  3SS3 A;  3BLS A;  1YQS A;  4PPR A;  1YLT A;  1G6A A;  4DE1 A;  3PBN A;  2Y2N A;  1SHV A;  3C4P A;  4PM9 A;  1GA0 A;  1K25 A;  1SDE A;  4DRT A;  3I7J A;  2ZD8 A;  4LV2 A;  3RXX A;  4QB8 A;  1CEG A;  4S2I A;  5FA7 A;  4EV4 A;  1Q2Q A;  4N9L A;  1RGZ A;  4EBN A;  4IED A;  3FZC A;  3VMA A;  1YLJ A;  4UHU A;  1FSY A;  3QHY A;  4JLF A;  1NZU A;  3LY4 A;  2XQZ A;  3GR2 A;  2OLV A;  1W79 A;  4KG2 A;  2ZC5 B;  4E6X A;  1YMX A;  3NY4 A;  1ZG4 A;  4KZ5 A;  5E2E A;  2G2U A;  2Y55 A;  4N1H A;  3VP2 A;  3ZG5 A;  4N1X A;  4HEF A;  1ZC2 A;  4RVA A;  5A92 A;  2HDQ A;  4Y0U A;  3M2J A;  4KZB A;  2JBF A;  4IVK A;  1XXM A;  5GHX A;  1GHI A;  5AQB A;  2PU4 A;  3S22 A;  4X69 A;  1YLW A;  1ESI A;  1BLP A;  2XFS A;  2RL3 A;  2ZC7 A;  2ZC3 B;  1FR1 A;  3IF6 B;  3MXS A;  4XUZ A;  3WS5 A;  3N8L A;  5KMW A;  4KZ6 A;  3NC8 A;  3ZCZ A;  3ZG0 A;  3W4P A;  3NIA A;  1C3B A;  1PWC A;  3E2L A;  4B4Z A;  4X53 A;  1NRF A;  3QNB A;  3WWX A;  2ZQC A;  4ID4 A;  1BT5 A;  1KGF A;  3VP1 A;  1MBL A;  4B4X A;  3LEZ A;  5TR7 A;  2XGN A;  1CEF A;  4WMC A;  4Y0T A;  3Q07 A;  5EOO A;  1ALQ A;  1E25 A;  4R3J A;  3Q7Z A;  4OP8 A;  5F1G A;  3UPN A;  1IEL A;  3MZD A;  3W4Q A;  4WEJ A;  1W8Y A;  1K56 D;  4X6T A;  5EVI A;  4MBK A;  1ES5 A;  3BRM A;  4E3L A;  3CJM A;  4OLG A;  1BLS A;  4LEN A;  3AGF A;  1KVL A;  3ZGA B;  4GDN A;  2ZMA A;  3OPL A;  1IKI A;  4OOY A;  3UE3 A;  3BFF A;  1NY0 A;  3A3J A;  4E3O A;  4MBF A;  3IWI A;  4LV0 A;  1K6R A;  4MNR A;  5CTN A;  4E3K A;  2ZLY A;  2P9V A;  3LO7 A;  4ZJ2 A;  3PBS A;  2JCH A;  3MKE A;  4GB7 A;  3C5A A;  4KZ8 A;  3HLE A;  5D3O A;  4OOL A;  2XEP A;  1LLB A;  4WYY A;  4YFM A;  2WAD A;  4OPY A;  1K4F A;  1K54 C;  2EFU A;  3O86 A;  2X71 A;  4PM7 A;  2Y2J A;  5E2F A;  4S2K A;  2DRW A;  4OP5 A;  5AQ7 A;  3OZH A;  3C4O A;  3OPR A;  4UA9 A;  2XDM A;  4FD8 A;  4A5R A;  1E4D A;  1I2S A;  2B5R A;  3N8S A;  5A93 A;  3AGE A;  3EQU A;  4N9K A;  3DTM A;  1ERM A;  2WYX A;  4OPZ A;  4GD6 A;  3FWL A;  4Y7P A;  1GHM A;  4UA7 A;  4OQ0 A;  4F94 A;  1QME A;  4OVD A;  3IXB A;  1K54 A;  3MXR A;  3ITA A;  5JYO A;  4Z9Q A;  4RX2 A;  5TGF A;  1BUL A;  3IXD A;  1ERQ A;  1BSG A;  1CK3 A;  4KQQ A;  4BQM A;  3WS1 A;  2J8Y A;  2P74 A;  4CJN A;  4UAA A;  2EX8 A;  2QZ6 A;  2Y2H A;  1BLC A;  4R4S A;  4S2M A;  5A91 A;  1ONH A;  1MWT A;  1KVM A;  4GOG A;  2XF3 A;  3GVB A;  1M40 A;  4O7D A;  3PBQ A;  3Q81 A;  2Y2Q A;  1JTG A;  2OSU A;  5F1F A;  2Y2G A;  3WS2 A;  4DE3 A;  1K38 A;  1MXO A;  4LCL A;  4YIN A;  5FSR A;  1IYQ A;  1NXY A;  3BEB A;  1L0F A;  3CMZ A;  4QJG A;  4U0T A;  5HAR A;  1LL5 A;  5E43 A;  3IF6 A;  3PTE A;  5FQQ A;  1K55 A;  2XD1 A;  5DF7 A;  5FQI A;  3V3R A;  2ZM2 A;  4EQI A;  1JWV A;  2HP6 A;  4R3B A;  5M1A A;  1KE3 A;  3ZG9 B;  3UN7 A;  4QHC A;  5CXW A;  3UE0 A;  3UO9 A;  2WGW B;  4GNU A;  1XPB A;  3SS5 A;  3N6I A;  4C3Q A;  4QY6 A;  1FCM A;  1JVJ A;  4QU3 A;  3B3X A;  3Q7V B;  3WS4 A;  4ZDX A;  3FKV A;  4EBP A;  4WBG A;  4E3J A;  4M3K A;  1EWZ A;  3IH9 A;  3VSL A;  2WAE A;  4OOM A;  1ONG A;  3IWO A;  5CHJ A;  3UNW A;  3HRE A;  5KSH A;  2Q9N A;  4WZ5 C;  1PW8 A;  3RXW A;  2EXB A;  4PM6 A;  4BEN A;  4U3T A;  1YLY A;  2J9P A;  3PBR A;  4KG5 A;  3TG9 A;  3DWZ A;  1DJC A;  2HP5 A;  1E3U D;  1BTL A;  2WKE A;  4NK3 A;  5JYP A;  3S1Y A;  4WEL A;  5HL1 A;  1H8Y A;  3HUM A;  1U60 A;  3ZHH A;  1FCO A;  2H5S A;  1NZO A;  3ZFZ A;  4JF5 A;  3G32 A;  2X02 A;  1XA7 A;  3A3F A;  3A3E A;  5HAI A;  4JPM A;  2A3U A;  1K6S A;  3HLW A;  5DTT A;  3SS4 A;  2JE5 A;  1XP4 A;  3HLD A;  4JKT A;  3TSG A;  4S2J A;  5EUA A;  1MWU A;  3A3I A;  4UA6 A;  5FQ9 A;  2H0T A;  2JC7 A;  5GLA A;  5M18 A;  3V50 A;  1RP5 A;  2WZX A;  3GQZ A;  3HLG A;  1QMF A;  1VQQ A;  4PM5 A;  3N8R A;  2XD5 A;  2XK1 A;  4JBF A;  2WGV A;  4DXC A;  1MPL A;  1RGY A;  5KSC A;  1Q2P A;  3VSK A;  1IYO A;  3GV9 A;  1IYS A;  2FFY A;  4JXV A;  1ES2 A;  1BZA A;  1K56 A;  4JF6 A;  2XLN A;  1L2S A;  3O87 A;  1ZG6 A;  2I72 A;  4CPK A;  4JXS A;  5HAQ A;  4B88 A;  4QY5 A;  1XA1 A;  2IWC A;  2H0Y A;  4LV1 A;  2CC1 A;  4N92 A;  1JWZ A;  5HAP A;  2WZZ A;  4RYE A;  1WYB A;  1YLP A;  5EVI D;  3W8K A;  2UWX A;  2ZQ7 A;  4E3M A;  3W4O A;  3IF5 A;  3FV7 A;  3IHA A;  5L2F A;  3ZNY A;  3O3V A;  4IBR A;  3PAG A;  3SOI A;  4KZ4 A;  3ZDJ A;  3MKF A;  4R0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...