3SHDA

Crystal structure of nudix hydrolase orf153, ymfb, from escherichia coli k-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
MFKPHVTVACVVHAEGKFLVVEETINGKALWNQPAGHLEADETLVEAAARELWEETGISAQPQHFIRMHQWIAPDKTPFLRFLFAIELEQICPTQPHDSDIDCCRWVSAEEILQASNLRSPLVAESIRCYQSGQRYPLEMIGDFNWPFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatase nudJ
publication title Structure and atypical hydrolysis mechanism of the Nudix hydrolase Orf153 (YmfB) from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 37
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.1.-:
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3shdA00
3X0LA 2J8QA 1RYAA 1XSAA 1VK6A 5FSKA 2Q9PA 1NFSA 3BHOA 4ILQA 1V8UA 1HX3A 2G74A 2VNPA 5FSMA 3X0JA 4N1TA 3QSJA 1MK1A 1PPWA 4KTBA 3FFUA 3P5TA 1SOIA 2GB5A 3ZR0A 5ISYA 3WHWA 2FVVA 1V8SA 4JZSA 3I7VA 1MQEA 1X84A 4NFXA 5DDGA 5C7QA 1PVFA 2A8TA 3G0QA 2ICKA 1I9AA 3EXQA 1PUNA 1V8VA 2I8TA 2YYHA 2A8RA 3ACAA 3FK9A 5DEQA 5ANWA 3O6ZA 4ZG0A 1NFZA 1V8YA 3X0SA 3Q2TA 1G9QA 3FCMA 1SJYA 3MDGA 2QJTA 1JRKA 2G73A 2YVPA 2A6TA 3AC9A 2YVMA 3L85A 1KT9A 5FSNA 5CFIA 1PPVA 1PUSA 2B06A 4HFQA 3GRNA 2PNYA 4KG4A 3BAPA 5LPGA 3OGAA 4KG3A 1PPXA 1K26A 1NQYA 3HYQA 1Q27A 4ICKA 3MDIA 3I9XA 5FSOA 1NQZA 3X0PA 1KHZA 5ANTA 1GA7A 1HZTA 5C7TA 1R67A 2DSCA 5IW5A 4JZUA 1Q54A 2CL3A 4JZVA 2YVOA 4NFWA 1VRLA 3Q93A 1IRYA 3BM4A 2QKMB 1PUQA 5GHQA 4S2VA 1V8NA 3GZ8A 2GT4A 3A6UA 3N77A 1MQWA 2FKBA 3EESA 2DUKA 4MPOA 5GHNA 3EF5A 2PQVA 3X0OA 3FSPA 2FMLA 2VNQA 2B2KA 1VIQA 3E57A 2I6KA 3DUPA 5HZXA 1VC8A 1RRQA 1V8RA 1SZ3A 5BONA 3GWYA 3R03A 2O1CA 4HVYA 5GHJA 3RH7A 3O8SA 3I7UA 3GZ6A 3ZR1A 1G0SA 3CNGA 3Q1PA 3MCFA 3X0IA 3GZ5A 3MGMA 3O52A 1V8WA 2DSBA 3ID9A 3J7Ye 5ANSA 2I8UA 3A6VA 3KVHA 5FSLA 1KTGA 1JKNA 5GHIA 1F3YA 1V8TA 3A6TA 5ANVA 3DKUA 3U53A 3HHJA 3X0QA 5GHPA 2A8PA 1Q33A 5C8LA 2A8QA 5DD4A 1SU2A 3A6SA 1VHZA 3O69A 5BS6A 4KYXA 4V14A 4JZTA 1X83A 2XSQA 5ANUA 2RRKA 3F6AA 5IW4A 3FJYA 4IJXA 3X0KA 2W4EA 3Q4IA 3N9UA 2ICJA 4YOQA 2JVBA 3COUA 1TUMA 3O61A 3SMDA 4S2YA 3EEUA 2B0VA 3P6YA 1QVJA 1V8MA 1X51A 3Q2SA 1VIUA 1VC9A 1V8IA 3GG6A 1OW2A 4S2XA 1VHGA 3SHDA 3F13A 4C9XA 5FSIA 2O5FA 5CFJA 1MUTA 1XSCA 3H95A 2AZWA 2A8SA 4DYWA 1MR2A 5I8UA 1VCDA 5DPKA 4S2WA 4N1UA 1RRSA 2DHOA 3X0NA 2KDVA 1XSBA 3Q91A 5GHOA 4YPHA 2O5WA 4K6EA 2R5WA 1V8LA 3SONA 1U20A 1MP2A 2GT2A 2QJOA 3X0MA 4C9WA 3X0RA 2YVNA 2KDWA 5GHMA 4YPRA 1K2EA 2DSDA
chains in the Genus database with same CATH superfamily
3X0LA 2J8QA 1RYAA 1XSAA 1VK6A 5FSKA 2Q9PA 1NFSA 3BHOA 4ILQA 1V8UA 1HX3A 2G74A 2VNPA 5FSMA 3X0JA 4N1TA 3QSJA 1MK1A 1PPWA 4KTBA 3FFUA 3P5TA 1SOIA 2GB5A 3ZR0A 5ISYA 3WHWA 2FVVA 1V8SA 4JZSA 3I7VA 1MQEA 1X84A 4NFXA 5DDGA 5C7QA 1PVFA 2A8TA 3G0QA 2ICKA 1I9AA 3EXQA 1PUNA 1V8VA 2I8TA 2YYHA 2A8RA 3ACAA 3FK9A 5DEQA 5ANWA 3O6ZA 4ZG0A 1NFZA 1V8YA 3X0SA 3Q2TA 1G9QA 3FCMA 1SJYA 3MDGA 2QJTA 1JRKA 2G73A 2YVPA 2A6TA 3AC9A 2YVMA 3L85A 1KT9A 5FSNA 5CFIA 1PPVA 1PUSA 2B06A 4HFQA 3GRNA 2PNYA 4KG4A 3BAPA 5LPGA 3OGAA 4KG3A 1PPXA 1K26A 1NQYA 3HYQA 1Q27A 4ICKA 3MDIA 3I9XA 5FSOA 1NQZA 3X0PA 1KHZA 5ANTA 1GA7A 1HZTA 5C7TA 1R67A 2DSCA 5IW5A 4JZUA 1Q54A 4J7HA 2CL3A 4JZVA 2YVOA 4NFWA 1VRLA 3Q93A 1IRYA 3BM4A 2QKMB 1PUQA 5GHQA 4S2VA 1V8NA 3GZ8A 2GT4A 3A6UA 3N77A 4J7GA 1MQWA 2CZRA 2FKBA 3EESA 2DUKA 4MPOA 5GHNA 3EF5A 2PQVA 3X0OA 3FSPA 2FMLA 2VNQA 2B2KA 1VIQA 3E57A 2I6KA 3DUPA 5HZXA 1VC8A 1RRQA 1V8RA 1SZ3A 5BONA 3GWYA 3R03A 2O1CA 4HVYA 5GHJA 3RH7A 3O8SA 3I7UA 3GZ6A 3ZR1A 1G0SA 3CNGA 3Q1PA 3MCFA 3X0IA 3GZ5A 3MGMA 3O52A 1V8WA 2DSBA 3ID9A 3J7Ye 5ANSA 2I8UA 3A6VA 3KVHA 5FSLA 1KTGA 1JKNA 5GHIA 1F3YA 1V8TA 3A6TA 5ANVA 3DKUA 3U53A 3HHJA 3X0QA 5GHPA 2A8PA 1Q33A 5C8LA 2A8QA 5DD4A 1SU2A 3A6SA 1VHZA 3O69A 5BS6A 4KYXA 4V14A 4JZTA 1X83A 2XSQA 5ANUA 2RRKA 3F6AA 5IW4A 3FJYA 4IJXA 3X0KA 2W4EA 3Q4IA 3N9UA 2ICJA 4YOQA 2JVBA 3COUA 1TUMA 3O61A 3SMDA 4S2YA 3EEUA 2B0VA 3P6YA 1QVJA 1V8MA 1X51A 3Q2SA 1VIUA 1VC9A 1V8IA 3GG6A 1OW2A 4S2XA 1VHGA 3SHDA 3F13A 4C9XA 5FSIA 2O5FA 5CFJA 1MUTA 1XSCA 3H95A 2AZWA 2A8SA 4DYWA 1MR2A 5I8UA 1VCDA 5DPKA 4S2WA 4N1UA 1RRSA 2DHOA 3X0NA 2KDVA 1XSBA 3Q91A 5GHOA 4YPHA 2O5WA 4K6EA 2R5WA 1V8LA 3SONA 1U20A 1MP2A 2GT2A 2QJOA 3X0MA 4C9WA 3X0RA 2YVNA 2KDWA 5GHMA 4YPRA 1K2EA 2DSDA
chains in the Genus database with same CATH topology
3X0LA 2J8QA 1RYAA 1XSAA 1VK6A 5FSKA 2Q9PA 1NFSA 3BHOA 4ILQA 1V8UA 1HX3A 2G74A 2VNPA 5FSMA 3X0JA 4N1TA 3QSJA 1MK1A 1PPWA 4KTBA 3FFUA 3P5TA 1SOIA 2GB5A 3ZR0A 5ISYA 3WHWA 2FVVA 1V8SA 4JZSA 3I7VA 1MQEA 1X84A 4NFXA 5DDGA 5C7QA 1PVFA 2A8TA 3G0QA 2ICKA 1I9AA 3EXQA 1PUNA 1V8VA 2I8TA 2YYHA 2A8RA 3ACAA 3FK9A 5DEQA 5ANWA 3O6ZA 4ZG0A 1NFZA 1V8YA 3X0SA 3Q2TA 1G9QA 3FCMA 1SJYA 3MDGA 2QJTA 1JRKA 2G73A 2YVPA 2A6TA 3AC9A 2YVMA 3L85A 1KT9A 5FSNA 5CFIA 1PPVA 1PUSA 2B06A 4HFQA 3GRNA 2PNYA 4KG4A 3BAPA 5LPGA 3OGAA 4KG3A 1PPXA 1K26A 1NQYA 3HYQA 1Q27A 4ICKA 3MDIA 3I9XA 5FSOA 1NQZA 3X0PA 1KHZA 5ANTA 1GA7A 1HZTA 5C7TA 1R67A 2DSCA 5IW5A 4JZUA 1Q54A 4J7HA 2CL3A 4JZVA 2YVOA 4NFWA 1VRLA 3Q93A 1IRYA 3BM4A 2QKMB 1PUQA 5GHQA 4S2VA 1V8NA 3GZ8A 2GT4A 3A6UA 3N77A 4J7GA 1MQWA 2CZRA 2FKBA 3EESA 2DUKA 4MPOA 5GHNA 3EF5A 2PQVA 3X0OA 3FSPA 2FMLA 2VNQA 2B2KA 1VIQA 3E57A 2I6KA 3DUPA 5HZXA 1VC8A 1RRQA 1V8RA 1SZ3A 5BONA 3GWYA 3R03A 2O1CA 4HVYA 5GHJA 3RH7A 3O8SA 3I7UA 3GZ6A 3ZR1A 1G0SA 3CNGA 3Q1PA 3MCFA 3X0IA 3GZ5A 3MGMA 3O52A 1V8WA 2DSBA 3ID9A 3J7Ye 5ANSA 2I8UA 3A6VA 3KVHA 5FSLA 1KTGA 1JKNA 5GHIA 1F3YA 1V8TA 3A6TA 5ANVA 3DKUA 3U53A 3HHJA 3X0QA 5GHPA 2A8PA 1Q33A 5C8LA 2A8QA 5DD4A 1SU2A 3A6SA 1VHZA 3O69A 5BS6A 4KYXA 4V14A 4JZTA 1X83A 2XSQA 5ANUA 2RRKA 3F6AA 5IW4A 3FJYA 4IJXA 3X0KA 2W4EA 3Q4IA 3N9UA 2ICJA 4YOQA 2JVBA 3COUA 1TUMA 3O61A 3SMDA 4S2YA 3EEUA 2B0VA 3P6YA 1QVJA 1V8MA 1X51A 3Q2SA 1VIUA 1VC9A 1V8IA 3GG6A 1OW2A 4S2XA 1VHGA 3SHDA 3F13A 4C9XA 5FSIA 2O5FA 5CFJA 1MUTA 1XSCA 3H95A 2AZWA 2A8SA 4DYWA 1MR2A 5I8UA 1VCDA 5DPKA 4S2WA 4N1UA 1RRSA 2DHOA 3X0NA 2KDVA 1XSBA 3Q91A 5GHOA 4YPHA 2O5WA 4K6EA 2R5WA 1V8LA 3SONA 1U20A 1MP2A 2GT2A 2QJOA 3X0MA 4C9WA 3X0RA 2YVNA 2KDWA 5GHMA 4YPRA 1K2EA 2DSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X0L A;  2J8Q A;  1RYA A;  1XSA A;  1VK6 A;  5FSK A;  2Q9P A;  1NFS A;  3BHO A;  4ILQ A;  1V8U A;  1HX3 A;  2G74 A;  2VNP A;  5FSM A;  3X0J A;  4N1T A;  3QSJ A;  1MK1 A;  1PPW A;  4KTB A;  3FFU A;  3P5T A;  1SOI A;  2GB5 A;  3ZR0 A;  5ISY A;  3WHW A;  2FVV A;  1V8S A;  4JZS A;  3I7V A;  1MQE A;  1X84 A;  4NFX A;  5DDG A;  5C7Q A;  1PVF A;  2A8T A;  3G0Q A;  2ICK A;  1I9A A;  3EXQ A;  1PUN A;  1V8V A;  2I8T A;  2YYH A;  2A8R A;  3ACA A;  3FK9 A;  5DEQ A;  5ANW A;  3O6Z A;  4ZG0 A;  1NFZ A;  1V8Y A;  3X0S A;  3Q2T A;  1G9Q A;  3FCM A;  1SJY A;  3MDG A;  2QJT A;  1JRK A;  2G73 A;  2YVP A;  2A6T A;  3AC9 A;  2YVM A;  3L85 A;  1KT9 A;  5FSN A;  5CFI A;  1PPV A;  1PUS A;  2B06 A;  4HFQ A;  3GRN A;  2PNY A;  4KG4 A;  3BAP A;  5LPG A;  3OGA A;  4KG3 A;  1PPX A;  1K26 A;  1NQY A;  3HYQ A;  1Q27 A;  4ICK A;  3MDI A;  3I9X A;  5FSO A;  1NQZ A;  3X0P A;  1KHZ A;  5ANT A;  1GA7 A;  1HZT A;  5C7T A;  1R67 A;  2DSC A;  5IW5 A;  4JZU A;  1Q54 A;  2CL3 A;  4JZV A;  2YVO A;  4NFW A;  1VRL A;  3Q93 A;  1IRY A;  3BM4 A;  2QKM B;  1PUQ A;  5GHQ A;  4S2V A;  1V8N A;  3GZ8 A;  2GT4 A;  3A6U A;  3N77 A;  1MQW A;  2FKB A;  3EES A;  2DUK A;  4MPO A;  5GHN A;  3EF5 A;  2PQV A;  3X0O A;  3FSP A;  2FML A;  2VNQ A;  2B2K A;  1VIQ A;  3E57 A;  2I6K A;  3DUP A;  5HZX A;  1VC8 A;  1RRQ A;  1V8R A;  1SZ3 A;  5BON A;  3GWY A;  3R03 A;  2O1C A;  4HVY A;  5GHJ A;  3RH7 A;  3O8S A;  3I7U A;  3GZ6 A;  3ZR1 A;  1G0S A;  3CNG A;  3Q1P A;  3MCF A;  3X0I A;  3GZ5 A;  3MGM A;  3O52 A;  1V8W A;  2DSB A;  3ID9 A;  3J7Y e;  5ANS A;  2I8U A;  3A6V A;  3KVH A;  5FSL A;  1KTG A;  1JKN A;  5GHI A;  1F3Y A;  1V8T A;  3A6T A;  5ANV A;  3DKU A;  3U53 A;  3HHJ A;  3X0Q A;  5GHP A;  2A8P A;  1Q33 A;  5C8L A;  2A8Q A;  5DD4 A;  1SU2 A;  3A6S A;  1VHZ A;  3O69 A;  5BS6 A;  4KYX A;  4V14 A;  4JZT A;  1X83 A;  2XSQ A;  5ANU A;  2RRK A;  3F6A A;  5IW4 A;  3FJY A;  4IJX A;  3X0K A;  2W4E A;  3Q4I A;  3N9U A;  2ICJ A;  4YOQ A;  2JVB A;  3COU A;  1TUM A;  3O61 A;  3SMD A;  4S2Y A;  3EEU A;  2B0V A;  3P6Y A;  1QVJ A;  1V8M A;  1X51 A;  3Q2S A;  1VIU A;  1VC9 A;  1V8I A;  3GG6 A;  1OW2 A;  4S2X A;  1VHG A;  3SHD A;  3F13 A;  4C9X A;  5FSI A;  2O5F A;  5CFJ A;  1MUT A;  1XSC A;  3H95 A;  2AZW A;  2A8S A;  4DYW A;  1MR2 A;  5I8U A;  1VCD A;  5DPK A;  4S2W A;  4N1U A;  1RRS A;  2DHO A;  3X0N A;  2KDV A;  1XSB A;  3Q91 A;  5GHO A;  4YPH A;  2O5W A;  4K6E A;  2R5W A;  1V8L A;  3SON A;  1U20 A;  1MP2 A;  2GT2 A;  2QJO A;  3X0M A;  4C9W A;  3X0R A;  2YVN A;  2KDW A;  5GHM A;  4YPR A;  1K2E A;  2DSD A; 
#chains in the Genus database with same CATH topology
 3X0L A;  2J8Q A;  1RYA A;  1XSA A;  1VK6 A;  5FSK A;  2Q9P A;  1NFS A;  3BHO A;  4ILQ A;  1V8U A;  1HX3 A;  2G74 A;  2VNP A;  5FSM A;  3X0J A;  4N1T A;  3QSJ A;  1MK1 A;  1PPW A;  4KTB A;  3FFU A;  3P5T A;  1SOI A;  2GB5 A;  3ZR0 A;  5ISY A;  3WHW A;  2FVV A;  1V8S A;  4JZS A;  3I7V A;  1MQE A;  1X84 A;  4NFX A;  5DDG A;  5C7Q A;  1PVF A;  2A8T A;  3G0Q A;  2ICK A;  1I9A A;  3EXQ A;  1PUN A;  1V8V A;  2I8T A;  2YYH A;  2A8R A;  3ACA A;  3FK9 A;  5DEQ A;  5ANW A;  3O6Z A;  4ZG0 A;  1NFZ A;  1V8Y A;  3X0S A;  3Q2T A;  1G9Q A;  3FCM A;  1SJY A;  3MDG A;  2QJT A;  1JRK A;  2G73 A;  2YVP A;  2A6T A;  3AC9 A;  2YVM A;  3L85 A;  1KT9 A;  5FSN A;  5CFI A;  1PPV A;  1PUS A;  2B06 A;  4HFQ A;  3GRN A;  2PNY A;  4KG4 A;  3BAP A;  5LPG A;  3OGA A;  4KG3 A;  1PPX A;  1K26 A;  1NQY A;  3HYQ A;  1Q27 A;  4ICK A;  3MDI A;  3I9X A;  5FSO A;  1NQZ A;  3X0P A;  1KHZ A;  5ANT A;  1GA7 A;  1HZT A;  5C7T A;  1R67 A;  2DSC A;  5IW5 A;  4JZU A;  1Q54 A;  4J7H A;  2CL3 A;  4JZV A;  2YVO A;  4NFW A;  1VRL A;  3Q93 A;  1IRY A;  3BM4 A;  2QKM B;  1PUQ A;  5GHQ A;  4S2V A;  1V8N A;  3GZ8 A;  2GT4 A;  3A6U A;  3N77 A;  4J7G A;  1MQW A;  2CZR A;  2FKB A;  3EES A;  2DUK A;  4MPO A;  5GHN A;  3EF5 A;  2PQV A;  3X0O A;  3FSP A;  2FML A;  2VNQ A;  2B2K A;  1VIQ A;  3E57 A;  2I6K A;  3DUP A;  5HZX A;  1VC8 A;  1RRQ A;  1V8R A;  1SZ3 A;  5BON A;  3GWY A;  3R03 A;  2O1C A;  4HVY A;  5GHJ A;  3RH7 A;  3O8S A;  3I7U A;  3GZ6 A;  3ZR1 A;  1G0S A;  3CNG A;  3Q1P A;  3MCF A;  3X0I A;  3GZ5 A;  3MGM A;  3O52 A;  1V8W A;  2DSB A;  3ID9 A;  3J7Y e;  5ANS A;  2I8U A;  3A6V A;  3KVH A;  5FSL A;  1KTG A;  1JKN A;  5GHI A;  1F3Y A;  1V8T A;  3A6T A;  5ANV A;  3DKU A;  3U53 A;  3HHJ A;  3X0Q A;  5GHP A;  2A8P A;  1Q33 A;  5C8L A;  2A8Q A;  5DD4 A;  1SU2 A;  3A6S A;  1VHZ A;  3O69 A;  5BS6 A;  4KYX A;  4V14 A;  4JZT A;  1X83 A;  2XSQ A;  5ANU A;  2RRK A;  3F6A A;  5IW4 A;  3FJY A;  4IJX A;  3X0K A;  2W4E A;  3Q4I A;  3N9U A;  2ICJ A;  4YOQ A;  2JVB A;  3COU A;  1TUM A;  3O61 A;  3SMD A;  4S2Y A;  3EEU A;  2B0V A;  3P6Y A;  1QVJ A;  1V8M A;  1X51 A;  3Q2S A;  1VIU A;  1VC9 A;  1V8I A;  3GG6 A;  1OW2 A;  4S2X A;  1VHG A;  3SHD A;  3F13 A;  4C9X A;  5FSI A;  2O5F A;  5CFJ A;  1MUT A;  1XSC A;  3H95 A;  2AZW A;  2A8S A;  4DYW A;  1MR2 A;  5I8U A;  1VCD A;  5DPK A;  4S2W A;  4N1U A;  1RRS A;  2DHO A;  3X0N A;  2KDV A;  1XSB A;  3Q91 A;  5GHO A;  4YPH A;  2O5W A;  4K6E A;  2R5W A;  1V8L A;  3SON A;  1U20 A;  1MP2 A;  2GT2 A;  2QJO A;  3X0M A;  4C9W A;  3X0R A;  2YVN A;  2KDW A;  5GHM A;  4YPR A;  1K2E A;  2DSD A; 
#chains in the Genus database with same CATH homology
 3X0L A;  2J8Q A;  1RYA A;  1XSA A;  1VK6 A;  5FSK A;  2Q9P A;  1NFS A;  3BHO A;  4ILQ A;  1V8U A;  1HX3 A;  2G74 A;  2VNP A;  5FSM A;  3X0J A;  4N1T A;  3QSJ A;  1MK1 A;  1PPW A;  4KTB A;  3FFU A;  3P5T A;  1SOI A;  2GB5 A;  3ZR0 A;  5ISY A;  3WHW A;  2FVV A;  1V8S A;  4JZS A;  3I7V A;  1MQE A;  1X84 A;  4NFX A;  5DDG A;  5C7Q A;  1PVF A;  2A8T A;  3G0Q A;  2ICK A;  1I9A A;  3EXQ A;  1PUN A;  1V8V A;  2I8T A;  2YYH A;  2A8R A;  3ACA A;  3FK9 A;  5DEQ A;  5ANW A;  3O6Z A;  4ZG0 A;  1NFZ A;  1V8Y A;  3X0S A;  3Q2T A;  1G9Q A;  3FCM A;  1SJY A;  3MDG A;  2QJT A;  1JRK A;  2G73 A;  2YVP A;  2A6T A;  3AC9 A;  2YVM A;  3L85 A;  1KT9 A;  5FSN A;  5CFI A;  1PPV A;  1PUS A;  2B06 A;  4HFQ A;  3GRN A;  2PNY A;  4KG4 A;  3BAP A;  5LPG A;  3OGA A;  4KG3 A;  1PPX A;  1K26 A;  1NQY A;  3HYQ A;  1Q27 A;  4ICK A;  3MDI A;  3I9X A;  5FSO A;  1NQZ A;  3X0P A;  1KHZ A;  5ANT A;  1GA7 A;  1HZT A;  5C7T A;  1R67 A;  2DSC A;  5IW5 A;  4JZU A;  1Q54 A;  4J7H A;  2CL3 A;  4JZV A;  2YVO A;  4NFW A;  1VRL A;  3Q93 A;  1IRY A;  3BM4 A;  2QKM B;  1PUQ A;  5GHQ A;  4S2V A;  1V8N A;  3GZ8 A;  2GT4 A;  3A6U A;  3N77 A;  4J7G A;  1MQW A;  2CZR A;  2FKB A;  3EES A;  2DUK A;  4MPO A;  5GHN A;  3EF5 A;  2PQV A;  3X0O A;  3FSP A;  2FML A;  2VNQ A;  2B2K A;  1VIQ A;  3E57 A;  2I6K A;  3DUP A;  5HZX A;  1VC8 A;  1RRQ A;  1V8R A;  1SZ3 A;  5BON A;  3GWY A;  3R03 A;  2O1C A;  4HVY A;  5GHJ A;  3RH7 A;  3O8S A;  3I7U A;  3GZ6 A;  3ZR1 A;  1G0S A;  3CNG A;  3Q1P A;  3MCF A;  3X0I A;  3GZ5 A;  3MGM A;  3O52 A;  1V8W A;  2DSB A;  3ID9 A;  3J7Y e;  5ANS A;  2I8U A;  3A6V A;  3KVH A;  5FSL A;  1KTG A;  1JKN A;  5GHI A;  1F3Y A;  1V8T A;  3A6T A;  5ANV A;  3DKU A;  3U53 A;  3HHJ A;  3X0Q A;  5GHP A;  2A8P A;  1Q33 A;  5C8L A;  2A8Q A;  5DD4 A;  1SU2 A;  3A6S A;  1VHZ A;  3O69 A;  5BS6 A;  4KYX A;  4V14 A;  4JZT A;  1X83 A;  2XSQ A;  5ANU A;  2RRK A;  3F6A A;  5IW4 A;  3FJY A;  4IJX A;  3X0K A;  2W4E A;  3Q4I A;  3N9U A;  2ICJ A;  4YOQ A;  2JVB A;  3COU A;  1TUM A;  3O61 A;  3SMD A;  4S2Y A;  3EEU A;  2B0V A;  3P6Y A;  1QVJ A;  1V8M A;  1X51 A;  3Q2S A;  1VIU A;  1VC9 A;  1V8I A;  3GG6 A;  1OW2 A;  4S2X A;  1VHG A;  3SHD A;  3F13 A;  4C9X A;  5FSI A;  2O5F A;  5CFJ A;  1MUT A;  1XSC A;  3H95 A;  2AZW A;  2A8S A;  4DYW A;  1MR2 A;  5I8U A;  1VCD A;  5DPK A;  4S2W A;  4N1U A;  1RRS A;  2DHO A;  3X0N A;  2KDV A;  1XSB A;  3Q91 A;  5GHO A;  4YPH A;  2O5W A;  4K6E A;  2R5W A;  1V8L A;  3SON A;  1U20 A;  1MP2 A;  2GT2 A;  2QJO A;  3X0M A;  4C9W A;  3X0R A;  2YVN A;  2KDW A;  5GHM A;  4YPR A;  1K2E A;  2DSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...