3SHGB

Vbht fic protein from bartonella schoenbuchensis in complex with vbha antitoxin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
61
structure length
61
Chain Sequence
VLSEEEIEYRRRDARNALASQRLEGLEPDPQVVAQMERVVVGELETSDVIKDLMERIKREE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VbhT
publication title Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins.
pubmed doi rcsb
source organism Bartonella schoenbuchensis r1
molecule tags Transferase/protein binding
total genus 25
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18495 VbhA Antitoxin VbhA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1050 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3shgB00
3ZC7B 3SHGB 3ZCBB
chains in the Genus database with same CATH superfamily
2YR0A 3A42A 4G3OA 3LQRA 1Q3CA 3TQSA 2OOAA 1DGGA 5ITQA 4B3TM 3U61B 4LRTA 3CGWA 2DXIA 2JZ1A 1JR3E 1G4AE 3GRUA 4KODA 2VQEM 3TPZA 3KS4A 1OIPA 3KDSE 1I94M 3B7NA 3FTEA 2KRKA 4BLCA 1N36M 4QNMA 1ZQ9A 2CE7A 2VIIA 3HJ8A 3J80S 5EP4A 4AW4A 1OFHA 5IREB 1NVMA 1XXHB 3CF2A 7CATA 4DV7M 4R3DA 3SFZA 1Y8GA 3KOZE 1IBKM 1IN7A 2XFTA 3VK8A 2JUJA 3K9OA 3D8LA 5ITTA 1NNUC 3FE3A 3I4YA 4I81A 1NJFA 4G4QA 2M5ZA 2EUCA 4REZA 1GJSA 1SXJB 3AOEA 1QVRA 4DV5M 5EXXA 1K3XA 3HZJA 1TDHA 4FCTA 3UK6A 1VDDA 3GQ3A 3HU1A 1KYIA 4JI7M 1MJGM 5E6JA 4GKJM 4GC9A 2FE8A 4GITA 4IBEA 1E9RA 4LF7M 2UUCM 2R4EA 2HCBA 2FH0A 1A5TA 1GABA 4AKIA 3KSJA 2KNVA 2ZM6M 3E9SA 3VDUA 4LF6M 2DWMA 3AOEC 2J5YA 3NWLA 4WP2A 4TUWA 1E9SA 1QAOA 2L2DA 3C3DA 2K47A 2XFSA 1IXRC 4XBOA 2ERCA 4LF9M 1FNNA 3JAMS 1R2YA 3QYBA 2R44A 4NSRA 3GLIE 3E46A 4JV5M 2JP7A 2N35A 4LJ8A 4FW9A 4S12A 3KOWE 1J7KA 2O01F 2RGHA 3UMMA 2GNOA 3H4MA 2KXEA 3HHZA 2FFJA 2R4JA 4PCZA 1K82A 4RF0A 3VK7A 1J5EM 3TE6A 4L4UA 1X37A 1GL6A 3GLIB 2LHCA 3BOSA 3LW5F 1XHBA 3SAUA 2EJSA 1TDZA 4D82A 2QZ4A 4NL4H 4P16A 4RF1A 3A98B 5KPRA 1WGNA 4P17A 2I7PA 1WXQA 1IBMM 4LFAM 2G8LA 2X49A 1R7RA 5KO3A 5FTKA 1FJGM 3J7BA 5EP2A 4ANRA 3F92A 2CFOA 1L1ZA 4G4NA 3K9PA 2Z4SA 3FUTA 4NC6A 3GPPA 2XLJA 4JI3M 2RRUA 3LCVB 2OO9A 2LBCA 2DKLA 2VF7A 4LCBA 2NQ8C 2QNJA 5IZ7D 3GRVA 1R2ZA 1HT2E 3AV0A 4JXJA 3M0EA 3K92A 3CTWB 2L6OA 2FNAA 4FWHA 4CHTB 3T1HM 1G8PA 1N75A 1WGLA 4KO8A 3DZDA 5C1BA 2QBYA 4PT5A 3BBZA 3GRRA 3GLFA 3U60A 5ITXA 3IG8A 1K3WA 2EKKA 4X66M 5BR8M 4BBAA 3MJ5A 2BNKA 3M6AA 4GKKM 3U6LA 1IXSA 1YLAA 2D7GA 1G59A 3THGA 1VEJA 2CHVA 4LF8M 3L28A 4JI4M 2XSZD 2XH9A 2BJVA 1NJGA 3AJIB 3M7GA 1C7YA 2F5OA 4LJ4A 2APLA 1OJLA 1TH4A 3AOGA 3HWSA 3QWLA 3C3EA 4B3RM 1N78A 2UUBM 3WHKA 3L29A 4LZZA 5EXSA 1WR1B 3GLGA 1H6UA 1R6BX 4PD2A 2QCUA 1LV7A 3W67A 3NBXX 4DV3M 2BJWA 1HNWM 3KS8A 2XSZA 1N33M 4OVZB 1PGYA 2UXDM 1NNJA 1XXHE 2DAEA 2K6BA 3CF6E 3HHXA 4MH0E 1WJ7A 3GQ5A 4IBJA 2XZFA 4B7GA 4JI8M 4D80A 3JR4A 3MMPA 1TF0B 1VEGA 2J7NA 1PJJA 1AUAA 1JR3D 3FUUA 3Q8XA 2MR9A 3HHYA 2A5YB 1IY2A 1SXJE 1VEKA 3KXEC 4B08A 4DR1M 5E26A 5JI2E 1S3SA 3VLFB 1QYRA 3VKGA 4YY3M 3LVWA 2MJ5B 2O5RA 2FS1A 3LMMA 3U6MA 1J09A 2L7IA 2Y21A 4NOOB 4QNRA 2MROB 2CEAA 1JR3A 2C96A 5EXTA 2C99A 5FTJA 1PJTA 3B74A 2DZOB 1RU3A 2DI0A 4HLQA 3VFDA 1NY6A 4DV1M 1JB0F 2K9DA 1HQCA 2V6ZM 3I01M 3SASA 4AG5A 2HKJA 3HY5A 2KNAA 1D0LA 3J81S 2DWLA 1NHGC 1KSFX 4KLNA 5DYGA 4MGIE 3GLHE 4GEWA 3T15A 2Z3XA 4B7FA 2WSCF 1HR0M 1JQJC 1NV8A 1Q3BA 4DUZM 1NHWC 2JY5A 1MN3A 1NO1A 1OFIA 1L8QA 2ZTDA 3HJQA 4LJ9A 3GRYA 3PNYA 1XC8A 4DR7M 3U6CA 4LJ7A 1V33A 2VF8A 2V1UA 2Z7JA 2J7OA 4L6V6 3OTOM 4JN6A 3GLHB 3U6QA 2EKFA 1Q02A 4IBFA 1SXJC 1ZMWA 3FKEA 4R71A 1Z5CA 1QAQA 1HNXM 2DWZB 1V92A 3J27B 1IFYA 2Q2EB 1GLNA 3T1YM 4DV4M 4L78A 4JI0M 4G4OA 2EA0A 5ITYA 1OAOC 1Z5AA 2XGNA 2EO2A 3IG5A 1G41A 1GL7A 5FLXS 2DAKA 3SAWA 3KVWA 1HQYE 2UU9M 1E32A 4CISA 1BVSA 4PDIA 3FUVA 3C58A 2D7EA 2KW0A 3KFUG 2DAIA 2DAGA 2Z4RA 1EIJA 4IBBA 2XEPA 3DOAA 3SYKA 4CJ6A 3SYLA 1YSYA 1HJPA 4M9ZA 3FRHA 3K8ZA 1QUTA 3SMPA 4NSOB 3E4RA 1L2CA 2D7HA 1IY1A 4LJAA 4LY6A 4QHTA 3BXWA 2LWXA 2F4VM 2BWEA 4LG2A 4AQYM 1OAIA 1GJTA 1VG5A 3L26A 4MGKE 1W5TA 2L4EA 3U5ZA 3LVVA 2C9CA 2DZLA 4WURA 3R8FA 1ZAEA 3KP0E 4K0KM 3TWMA 4LJ5A 4GH9A 4M0DA 2LHGA 3LCUA 4XGIA 1D0KA 4LZJA 3IECA 3RGPA 4AG6A 4OW0A 2O25A 1IN4A 2FOIC 2W82A 3AKZA 4MB7A 3LQQA 2LVAA 4MGZE 2LXEA 1SG9A 2ZANA 1D0MA 1G71A 1OIZA 3HU2A 5DYIA 1PJIA 1NY5A 2H5XA 4IBCA 4AI6A 3E21A 1AIPC 2WSEF 3KW6A 1N77A 3U6OA 1PJQA 2ZAMA 3AL0C 2V1CA 2G5GX 1PJSA 3RE8A 1KFVA 3AFHA 1GKIA 2LVPC 4M0WA 5EP3A 1ORYB 5L8RF 3SAVA 2RKOA 3MHVC 4LGYA 3TWKA 3GPUA 2QSFX 2DZNB 3FUWA 1TTEA 5FTNA 4HL4A 3I4VA 3L25A 1XMQM 2QBYB 2L4FA 4Z6YA 4IJEA 2VQFM 2ZTCA 2KDLA 1LTMA 2L09A 3GLFB 3U60B 2Y0QA 3GP1A 1MX0A 2JNHA 2VDBB 4L8RC 3ZCBB 2JWSA 2QQ8A 4G4RA 4GMQA 1IN6A 3EIHA 1DGHA 4NXMM 2MGWA 5KPZA 2JZ0A 1IXZA 4JI5M 3J2PB 2QHOB 2AHMA 1QANA 2B3TA 2R18A 5FSWA 2X8AA 2KNZA 4LGMA 1UM8A 4IBIA 1DO0A 1P3QQ 3FTCA 4RKUF 3SHGB 3TWLA 3HX3A 2UUAM 5ITUA 3W0LB 1DGBA 3U61A 3ZQJA 4CGYB 4DR5M 2XZUA 4PDGA 3DFZA 3U6EA 1MU5A 3GLGB 3J7AS 4W5WA 4AZFA 3HJSA 2CV0A 2UXBM 2BWBA 5LMNM 3DA1A 2HAKA 4FD2A 5EQTA 4DR3M 3ZH9B 2L7HA 2GQFA 2JY7A 1Z59A 1W5SA 2DNAA 2HL7A 4LRSA 1SXJD 4MGHA 5DFLA 5C18A 4FWGA 1N32M 1IY0A 4GRIA 4M9SA 4YHHM 2JY6B 1XXHA 3T6PA 3C9PA 1NV9A 1CUKA 3RFWA 4CIZA 3I04M 3PFIA 1UFZA 4F2LA 1QZMA 3FD9A 1ZMVA 4GHAA 1Z6TA 4KT0F 2C9OA 1IN5A 4F1IA 1XB2B 4M9XA 2ZBKB 3SC3A 4IBKA 1TH3A 4FCWA 4R7GA 1D2NA 2KRUA 2QPAA 2YFQA 3ILKA 1SXJA 2R6FA 3U6PA 4LF4M 4LFBM 4DR2M 4AKGA 2CV2A 5KQ8A 3QAUA 2QP9X 5H37D 2LTUA 3KOYE 1XWIA 1OTRA 5KQDA 5FTMA 3HU3A 4B3SM 3UGJA 4I4LA 1Z5BA 4GHLA 4X62M 4MGYE 2RGOA 1YE9A 2CUZA 5A2QS 3GO8A 1QZEA 4II7A 4NXNM 3EIEA 4DV6M 5IT9S 2JY8A 4LJ6A 2OOBA 3GLHA 4I8OA 2OQ4A 3TL4X 2KHHA 4ITQA 3T38A 1YUBA 3I51A 2Y0TA 1VDLA 5EXPA 2Y20A 3IHPA 1N34M 4NRVA 5JI3E 1QAMA 3PVSA 4G6ZA 5FTLA 4DR4M 3FYCA 2E5LM 2DVWB 4RNAA 4DV0M 3HGIA 2CRUA 2R0IA 4DUYM 3B89A 1HT1E 3KP1E 3GPXA 3L2AA 2F5NA 1L1TA 5F3WA 1IM2A 1TH2A 3FTDA 4I5SA 5ITRA 5IWAM 3W0FA 2F5SA 1ZV1A 2YQZA 3CF0A 2LNHC 4FWDA 4JI2M 1I4WA 1DV0A 3GLIA 1QDTA 1WHCA 2M60A 3PXGA 4Z8XA 1T3TA 2G3QA 3FRIA 1NSFA 3ZC7B 4DV2M 2R65A 2KZSA 2LVNC 1XMOM 2XF3A 3B7QA 3HHWA 4GIPA 1TR8A 3V76A 1R4GA 2DENA 4ZPXA 1OKSA 4FCVA 2X4AA 3QYEA 1L2BA 2I7NA 4KHPM 2CP8A 3B7ZA 3KSXA 5EP1A 2QENA 5GKNA 2LVOC 3GQ4A 1Q39A 1G3IA 4QOSA 4QHSA 3VDPA 5EJCA 1OQYA 4OU7A 1GO5A 4GC5A 2K0BX 2MH8A 4FVMA 4WW0A 3U5ZB 3K1JA 4JI1M 2DWNA 1R5LA 4DR6M 3RGSA 1GVNA 2Z8YM 2YNMD 2KEBA 3FTFA 2WSFF 4IIWA 5DNYA 3R9XB 3NBIA 4MM3B 4JI6M 3FUXA 4HEOA 2UXCM 1HNZM 2H1RA 1IN8A 1WIVA 4Q7JA 3GLFE 2C5RA 2F5QA 1QQWA 1V34A 3VKHA 4BB9A 2DHYA 5ITXE 2CHGA 1C1KA 1IQPA 4IBDA 3U6DA 2P5TA 1EE8A 2JA2A 3SARA 4LF5M 4L15A 3Q8GA 4L16A 2JXNA 3U6SA 3HKPA 2CWBA 2OPFA 2HWJA 4A3VB 2WZJA 4Y28F 4QOZC 1ZMUA 2C98A 3SMSA 3SHFA 5KPTA 3H4JA 2DAMA 5LMUM 4AKHA 1T6OA 3JR5A 3KOXE 1XNRM 2HHHM 3GPYA 1DGFA 3UJNA 4NRWA 4D81A 1XNQM 2LH0A 2CHQA 3W68A 4XK8F 4DBGB 3GLGE 1VQ1A 4IBGA 5BPVA 3WHLA 1IXSB 4LFCM 1PM5A 2KA6B 1IBLM 4IJFA 2F5PA 4OX9M 1TGUA 3MK6A 3D8BA 4B3MM 2ZAOA 4OVZA 4EIWA 2R46A 3B9PA 8CATA 1F4IA 4X65M 3A46A 1QDRA 3UZUA 4X64M 1L2DA 2KZUA 4JYAM 3FYDA 2LVQD 3L27A 1PRBA 2R45A 4UN2B 3SBJA 3A45A 1EFUB 1E94E 1DO2A 3K2LA 1QUSA 2CV1A 3PNVA 3SATA 1DGHB 1T43A 2R62A 4B7HA 2DHRA
chains in the Genus database with same CATH topology
2YR0A 3A42A 3LQRA 1Q3CA 3TQSA 1DGGA 5ITQA 4B3TM 3U61B 4LRTA 2DXIA 1G4AE 3GRUA 4KODA 2VQEM 3TPZA 3KS4A 3KDSE 1I94M 3FTEA 2KRKA 4BLCA 1N36M 4QNMA 1ZQ9A 2CE7A 2VIIA 3HJ8A 3J80S 5EP4A 4AW4A 1OFHA 5IREB 1NVMA 1XXHB 3CF2A 7CATA 4DV7M 4R3DA 3SFZA 3KOZE 1IBKM 1IN7A 2XFTA 3VK8A 3D8LA 5ITTA 1NNUC 3I4YA 4I81A 1NJFA 4G4QA 2M5ZA 2EUCA 4REZA 1SXJB 3AOEA 1QVRA 4DV5M 5EXXA 1K3XA 1TDHA 4FCTA 3UK6A 1VDDA 3GQ3A 3HU1A 1KYIA 4JI7M 5E6JA 4GKJM 4GC9A 2FE8A 4GITA 4IBEA 1E9RA 4LF7M 2UUCM 2R4EA 2HCBA 4AKIA 3KSJA 2ZM6M 3E9SA 3VDUA 4LF6M 2DWMA 3AOEC 4TUWA 3NWLA 1E9SA 1QAOA 2K47A 2XFSA 1IXRC 4XBOA 2ERCA 4LF9M 1FNNA 3JAMS 1R2YA 4NSRA 4JV5M 4LJ8A 4FW9A 4S12A 3KOWE 1J7KA 2RGHA 3UMMA 3H4MA 2KXEA 3HHZA 2FFJA 2R4JA 4PCZA 1K82A 4RF0A 3VK7A 1J5EM 3TE6A 4L4UA 1X37A 1GL6A 3GLIB 3BOSA 1XHBA 3SAUA 1TDZA 4D82A 2QZ4A 4NL4H 4P16A 4RF1A 3A98B 5KPRA 2I7PA 1WXQA 1IBMM 4LFAM 2G8LA 2X49A 1R7RA 5KO3A 5FTKA 1FJGM 3J7BA 5EP2A 2CFOA 1L1ZA 4G4NA 2Z4SA 3FUTA 3GPPA 2XLJA 4JI3M 4LCBA 2NQ8C 5IZ7D 3GRVA 1R2ZA 1HT2E 3AV0A 4JXJA 3M0EA 3K92A 3CTWB 2L6OA 2FNAA 4FWHA 4CHTB 3T1HM 1G8PA 1N75A 4KO8A 3DZDA 5C1BA 2QBYA 4PT5A 3GRRA 3GLFA 3U60A 5ITXA 3IG8A 1K3WA 4X66M 5BR8M 4BBAA 3MJ5A 2BNKA 3M6AA 4GKKM 3U6LA 2D7GA 1G59A 3THGA 2CHVA 4LF8M 3L28A 4JI4M 2XSZD 2XH9A 2BJVA 1NJGA 3AJIB 3M7GA 2F5OA 4LJ4A 1OJLA 1TH4A 3AOGA 3HWSA 3QWLA 4B3RM 1N78A 2UUBM 3WHKA 3L29A 4LZZA 5EXSA 3GLGA 1H6UA 1R6BX 4PD2A 2QCUA 1LV7A 4DV3M 2BJWA 1HNWM 3KS8A 2XSZA 1N33M 4OVZB 2UXDM 1NNJA 3HHXA 3CF6E 4MH0E 2XZFA 3GQ5A 4IBJA 4B7GA 4JI8M 4D80A 3JR4A 2J7NA 1PJJA 1JR3D 3FUUA 3Q8XA 3HHYA 2A5YB 1IY2A 1SXJE 3KXEC 4B08A 4DR1M 5E26A 5JI2E 1S3SA 3VLFB 1QYRA 3VKGA 4YY3M 3LVWA 2O5RA 3LMMA 3U6MA 1J09A 2L7IA 2Y21A 4NOOB 4QNRA 2CEAA 1JR3A 2C96A 5EXTA 2C99A 5FTJA 4HLQA 2DZOB 4DV1M 3VFDA 1NY6A 1HQCA 2V6ZM 3SASA 4AG5A 2HKJA 3J81S 2DWLA 1NHGC 1KSFX 4KLNA 5DYGA 4MGIE 1HR0M 3T15A 2Z3XA 4B7FA 1JQJC 1Q3BA 4DUZM 1NHWC 1OFIA 1L8QA 4DR7M 3HJQA 4LJ9A 3GRYA 3PNYA 1XC8A 3U6CA 4LJ7A 2V1UA 2Z7JA 2J7OA 3OTOM 4JN6A 3GLHB 3U6QA 4IBFA 1SXJC 3FKEA 1Z5CA 1QAQA 1HNXM 2DWZB 3J27B 2Q2EB 1GLNA 3T1YM 4DV4M 4L78A 4JI0M 4G4OA 2EA0A 5ITYA 1Z5AA 2XGNA 2EO2A 3IG5A 1G41A 1GL7A 5FLXS 3SAWA 3KVWA 1HQYE 2UU9M 1E32A 4CISA 4PDIA 3FUVA 3C58A 2D7EA 2KW0A 3KFUG 2Z4RA 4IBBA 2XEPA 3DOAA 3SYKA 3SYLA 1YSYA 4M9ZA 3K8ZA 3SMPA 4NSOB 3E4RA 1L2CA 2D7HA 1IY1A 4LJAA 4LY6A 4QHTA 2LWXA 2F4VM 4LG2A 4AQYM 3L26A 4MGKE 1W5TA 3U5ZA 3LVVA 2C9CA 4WURA 3R8FA 1ZAEA 3KP0E 4K0KM 3TWMA 4LJ5A 4GH9A 4M0DA 4XGIA 4LZJA 3RGPA 4AG6A 4OW0A 1IN4A 2FOIC 2W82A 3AKZA 4MB7A 3LQQA 4MGZE 2LXEA 2ZANA 3HU2A 5DYIA 1PJIA 1NY5A 4IBCA 4AI6A 3KW6A 1N77A 3U6OA 2ZAMA 3AL0C 2V1CA 2G5GX 3RE8A 1KFVA 3AFHA 1GKIA 5EP3A 4M0WA 1ORYB 3SAVA 2RKOA 3MHVC 4LGYA 3TWKA 3GPUA 3FUWA 2DZNB 5FTNA 4HL4A 3I4VA 3L25A 1XMQM 2QBYB 4Z6YA 4IJEA 2VQFM 2L09A 3GLFB 3U60B 2Y0QA 3GP1A 1MX0A 4L8RC 3ZCBB 4G4RA 4GMQA 1IN6A 3EIHA 1DGHA 4NXMM 5KPZA 4JI5M 1IXZA 3J2PB 2AHMA 1QANA 2R18A 5FSWA 2X8AA 4LGMA 1UM8A 4IBIA 1DO0A 3FTCA 3SHGB 3TWLA 2UUAM 5ITUA 3W0LB 1DGBA 3U61A 4CGYB 4DR5M 2XZUA 4PDGA 3DFZA 3U6EA 1MU5A 3GLGB 3J7AS 4W5WA 4AZFA 3HJSA 2CV0A 2UXBM 5LMNM 3DA1A 5EQTA 4FD2A 4DR3M 3ZH9B 2L7HA 1Z59A 1W5SA 2HL7A 4LRSA 4MGHA 1SXJD 5C18A 4FWGA 1N32M 1IY0A 4GRIA 4M9SA 4YHHM 1XXHA 3RFWA 3PFIA 1QZMA 3FD9A 4GHAA 1Z6TA 2C9OA 1IN5A 4M9XA 2ZBKB 3SC3A 4IBKA 1TH3A 4FCWA 4R7GA 1D2NA 2KRUA 2QPAA 2YFQA 3ILKA 1SXJA 3U6PA 4LF4M 4LFBM 4DR2M 4AKGA 2CV2A 5KQ8A 3QAUA 2QP9X 5H37D 3KOYE 1XWIA 5KQDA 5FTMA 3HU3A 4B3SM 3UGJA 4I4LA 1Z5BA 4GHLA 4X62M 4MGYE 2RGOA 1YE9A 2CUZA 5A2QS 3GO8A 4II7A 4NXNM 3EIEA 4DV6M 5IT9S 4LJ6A 3GLHA 4I8OA 2OQ4A 3TL4X 4ITQA 3T38A 1YUBA 3I51A 2Y0TA 5EXPA 2Y20A 1N34M 4NRVA 5JI3E 1QAMA 3PVSA 4G6ZA 5FTLA 4DR4M 3FYCA 2E5LM 2DVWB 4RNAA 4DV0M 3HGIA 4DUYM 1HT1E 3KP1E 3GPXA 3L2AA 2F5NA 1L1TA 5F3WA 1IM2A 1TH2A 3FTDA 4I5SA 5ITRA 5IWAM 3W0FA 2F5SA 3CF0A 2YQZA 4JI2M 2LNHC 4FWDA 1I4WA 3GLIA 2M60A 3PXGA 4Z8XA 1T3TA 1NSFA 3ZC7B 4DV2M 2R65A 2KZSA 1L2BA 1XMOM 2XF3A 3HHWA 4GIPA 4ZPXA 4FCVA 2X4AA 2I7NA 4KHPM 3KSXA 5EP1A 2QENA 5GKNA 3GQ4A 1Q39A 1G3IA 4QOSA 4QHSA 3VDPA 5EJCA 4OU7A 4GC5A 4FVMA 4JI1M 4WW0A 3U5ZB 3K1JA 2DWNA 4DR6M 3RGSA 1GVNA 2YNMD 2KEBA 3FTFA 5DNYA 4IIWA 3R9XB 3NBIA 4MM3B 4JI6M 3FUXA 2UXCM 1HNZM 2H1RA 1IN8A 2C5RA 2F5QA 1QQWA 3VKHA 4BB9A 5ITXE 2CHGA 1C1KA 1IQPA 4IBDA 3U6DA 2P5TA 1EE8A 2JA2A 3SARA 4LF5M 4L15A 4L16A 3U6SA 3HKPA 2OPFA 4QOZC 2C98A 3SMSA 3SHFA 5KPTA 4AKHA 5LMUM 3JR5A 3KOXE 1XNRM 2HHHM 3GPYA 1DGFA 3UJNA 4NRWA 4D81A 1XNQM 2LH0A 2CHQA 4IBGA 5BPVA 3WHLA 1IXSB 4LFCM 1PM5A 2KA6B 1IBLM 4IJFA 2F5PA 4OX9M 1TGUA 3MK6A 3D8BA 4B3MM 2ZAOA 4OVZA 4EIWA 2R46A 3B9PA 8CATA 4X65M 3A46A 4X64M 3UZUA 1L2DA 2KZUA 4JYAM 3FYDA 3L27A 2R45A 3SBJA 3A45A 1E94E 1DO2A 3K2LA 2CV1A 3SATA 3PNVA 1DGHB 4A3VB 2R62A 4B7HA 2DHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZC7 B;  3SHG B;  3ZCB B; 
#chains in the Genus database with same CATH topology
 2YR0 A;  3A42 A;  4G3O A;  3LQR A;  1Q3C A;  3TQS A;  2OOA A;  1DGG A;  5ITQ A;  4B3T M;  3U61 B;  4LRT A;  3CGW A;  2DXI A;  2JZ1 A;  1JR3 E;  1G4A E;  3GRU A;  4KOD A;  2VQE M;  3TPZ A;  3KS4 A;  1OIP A;  3KDS E;  1I94 M;  3B7N A;  3FTE A;  2KRK A;  4BLC A;  1N36 M;  4QNM A;  1ZQ9 A;  2CE7 A;  2VII A;  3HJ8 A;  3J80 S;  5EP4 A;  4AW4 A;  1OFH A;  5IRE B;  1NVM A;  1XXH B;  3CF2 A;  7CAT A;  4DV7 M;  4R3D A;  3SFZ A;  1Y8G A;  3KOZ E;  1IBK M;  1IN7 A;  2XFT A;  3VK8 A;  2JUJ A;  3K9O A;  3D8L A;  5ITT A;  1NNU C;  3FE3 A;  3I4Y A;  4I81 A;  1NJF A;  4G4Q A;  2M5Z A;  2EUC A;  4REZ A;  1GJS A;  1SXJ B;  3AOE A;  1QVR A;  4DV5 M;  5EXX A;  1K3X A;  3HZJ A;  1TDH A;  4FCT A;  3UK6 A;  1VDD A;  3GQ3 A;  3HU1 A;  1KYI A;  4JI7 M;  1MJG M;  5E6J A;  4GKJ M;  4GC9 A;  2FE8 A;  4GIT A;  4IBE A;  1E9R A;  4LF7 M;  2UUC M;  2R4E A;  2HCB A;  2FH0 A;  1A5T A;  1GAB A;  4AKI A;  3KSJ A;  2KNV A;  2ZM6 M;  3E9S A;  3VDU A;  4LF6 M;  2DWM A;  3AOE C;  2J5Y A;  3NWL A;  4WP2 A;  4TUW A;  1E9S A;  1QAO A;  2L2D A;  3C3D A;  2K47 A;  2XFS A;  1IXR C;  4XBO A;  2ERC A;  4LF9 M;  1FNN A;  3JAM S;  1R2Y A;  3QYB A;  2R44 A;  4NSR A;  3GLI E;  3E46 A;  4JV5 M;  2JP7 A;  2N35 A;  4LJ8 A;  4FW9 A;  4S12 A;  3KOW E;  1J7K A;  2O01 F;  2RGH A;  3UMM A;  2GNO A;  3H4M A;  2KXE A;  3HHZ A;  2FFJ A;  2R4J A;  4PCZ A;  1K82 A;  4RF0 A;  3VK7 A;  1J5E M;  3TE6 A;  4L4U A;  1X37 A;  1GL6 A;  3GLI B;  2LHC A;  3BOS A;  3LW5 F;  1XHB A;  3SAU A;  2EJS A;  1TDZ A;  4D82 A;  2QZ4 A;  4NL4 H;  4P16 A;  4RF1 A;  3A98 B;  5KPR A;  1WGN A;  4P17 A;  2I7P A;  1WXQ A;  1IBM M;  4LFA M;  2G8L A;  2X49 A;  1R7R A;  5KO3 A;  5FTK A;  1FJG M;  3J7B A;  5EP2 A;  4ANR A;  3F92 A;  2CFO A;  1L1Z A;  4G4N A;  3K9P A;  2Z4S A;  3FUT A;  4NC6 A;  3GPP A;  2XLJ A;  4JI3 M;  2RRU A;  3LCV B;  2OO9 A;  2LBC A;  2DKL A;  2VF7 A;  4LCB A;  2NQ8 C;  2QNJ A;  5IZ7 D;  3GRV A;  1R2Z A;  1HT2 E;  3AV0 A;  4JXJ A;  3M0E A;  3K92 A;  3CTW B;  2L6O A;  2FNA A;  4FWH A;  4CHT B;  3T1H M;  1G8P A;  1N75 A;  1WGL A;  4KO8 A;  3DZD A;  5C1B A;  2QBY A;  4PT5 A;  3BBZ A;  3GRR A;  3GLF A;  3U60 A;  5ITX A;  3IG8 A;  1K3W A;  2EKK A;  4X66 M;  5BR8 M;  4BBA A;  3MJ5 A;  2BNK A;  3M6A A;  4GKK M;  3U6L A;  1IXS A;  1YLA A;  2D7G A;  1G59 A;  3THG A;  1VEJ A;  2CHV A;  4LF8 M;  3L28 A;  4JI4 M;  2XSZ D;  2XH9 A;  2BJV A;  1NJG A;  3AJI B;  3M7G A;  1C7Y A;  2F5O A;  4LJ4 A;  2APL A;  1OJL A;  1TH4 A;  3AOG A;  3HWS A;  3QWL A;  3C3E A;  4B3R M;  1N78 A;  2UUB M;  3WHK A;  3L29 A;  4LZZ A;  5EXS A;  1WR1 B;  3GLG A;  1H6U A;  1R6B X;  4PD2 A;  2QCU A;  1LV7 A;  3W67 A;  3NBX X;  4DV3 M;  2BJW A;  1HNW M;  3KS8 A;  2XSZ A;  1N33 M;  4OVZ B;  1PGY A;  2UXD M;  1NNJ A;  1XXH E;  2DAE A;  2K6B A;  3CF6 E;  3HHX A;  4MH0 E;  1WJ7 A;  3GQ5 A;  4IBJ A;  2XZF A;  4B7G A;  4JI8 M;  4D80 A;  3JR4 A;  3MMP A;  1TF0 B;  1VEG A;  2J7N A;  1PJJ A;  1AUA A;  1JR3 D;  3FUU A;  3Q8X A;  2MR9 A;  3HHY A;  2A5Y B;  1IY2 A;  1SXJ E;  1VEK A;  3KXE C;  4B08 A;  4DR1 M;  5E26 A;  5JI2 E;  1S3S A;  3VLF B;  1QYR A;  3VKG A;  4YY3 M;  3LVW A;  2MJ5 B;  2O5R A;  2FS1 A;  3LMM A;  3U6M A;  1J09 A;  2L7I A;  2Y21 A;  4NOO B;  4QNR A;  2MRO B;  2CEA A;  1JR3 A;  2C96 A;  5EXT A;  2C99 A;  5FTJ A;  1PJT A;  3B74 A;  2DZO B;  1RU3 A;  2DI0 A;  4HLQ A;  3VFD A;  1NY6 A;  4DV1 M;  1JB0 F;  2K9D A;  1HQC A;  2V6Z M;  3I01 M;  3SAS A;  4AG5 A;  2HKJ A;  3HY5 A;  2KNA A;  1D0L A;  3J81 S;  2DWL A;  1NHG C;  1KSF X;  4KLN A;  5DYG A;  4MGI E;  3GLH E;  4GEW A;  3T15 A;  2Z3X A;  4B7F A;  2WSC F;  1HR0 M;  1JQJ C;  1NV8 A;  1Q3B A;  4DUZ M;  1NHW C;  2JY5 A;  1MN3 A;  1NO1 A;  1OFI A;  1L8Q A;  2ZTD A;  3HJQ A;  4LJ9 A;  3GRY A;  3PNY A;  1XC8 A;  4DR7 M;  3U6C A;  4LJ7 A;  1V33 A;  2VF8 A;  2V1U A;  2Z7J A;  2J7O A;  4L6V 6;  3OTO M;  4JN6 A;  3GLH B;  3U6Q A;  2EKF A;  1Q02 A;  4IBF A;  1SXJ C;  1ZMW A;  3FKE A;  4R71 A;  1Z5C A;  1QAQ A;  1HNX M;  2DWZ B;  1V92 A;  3J27 B;  1IFY A;  2Q2E B;  1GLN A;  3T1Y M;  4DV4 M;  4L78 A;  4JI0 M;  4G4O A;  2EA0 A;  5ITY A;  1OAO C;  1Z5A A;  2XGN A;  2EO2 A;  3IG5 A;  1G41 A;  1GL7 A;  5FLX S;  2DAK A;  3SAW A;  3KVW A;  1HQY E;  2UU9 M;  1E32 A;  4CIS A;  1BVS A;  4PDI A;  3FUV A;  3C58 A;  2D7E A;  2KW0 A;  3KFU G;  2DAI A;  2DAG A;  2Z4R A;  1EIJ A;  4IBB A;  2XEP A;  3DOA A;  3SYK A;  4CJ6 A;  3SYL A;  1YSY A;  1HJP A;  4M9Z A;  3FRH A;  3K8Z A;  1QUT A;  3SMP A;  4NSO B;  3E4R A;  1L2C A;  2D7H A;  1IY1 A;  4LJA A;  4LY6 A;  4QHT A;  3BXW A;  2LWX A;  2F4V M;  2BWE A;  4LG2 A;  4AQY M;  1OAI A;  1GJT A;  1VG5 A;  3L26 A;  4MGK E;  1W5T A;  2L4E A;  3U5Z A;  3LVV A;  2C9C A;  2DZL A;  4WUR A;  3R8F A;  1ZAE A;  3KP0 E;  4K0K M;  3TWM A;  4LJ5 A;  4GH9 A;  4M0D A;  2LHG A;  3LCU A;  4XGI A;  1D0K A;  4LZJ A;  3IEC A;  3RGP A;  4AG6 A;  4OW0 A;  2O25 A;  1IN4 A;  2FOI C;  2W82 A;  3AKZ A;  4MB7 A;  3LQQ A;  2LVA A;  4MGZ E;  2LXE A;  1SG9 A;  2ZAN A;  1D0M A;  1G71 A;  1OIZ A;  3HU2 A;  5DYI A;  1PJI A;  1NY5 A;  2H5X A;  4IBC A;  4AI6 A;  3E21 A;  1AIP C;  2WSE F;  3KW6 A;  1N77 A;  3U6O A;  1PJQ A;  2ZAM A;  3AL0 C;  2V1C A;  2G5G X;  1PJS A;  3RE8 A;  1KFV A;  3AFH A;  1GKI A;  2LVP C;  4M0W A;  5EP3 A;  1ORY B;  5L8R F;  3SAV A;  2RKO A;  3MHV C;  4LGY A;  3TWK A;  3GPU A;  2QSF X;  2DZN B;  3FUW A;  1TTE A;  5FTN A;  4HL4 A;  3I4V A;  3L25 A;  1XMQ M;  2QBY B;  2L4F A;  4Z6Y A;  4IJE A;  2VQF M;  2ZTC A;  2KDL A;  1LTM A;  2L09 A;  3GLF B;  3U60 B;  2Y0Q A;  3GP1 A;  1MX0 A;  2JNH A;  2VDB B;  4L8R C;  3ZCB B;  2JWS A;  2QQ8 A;  4G4R A;  4GMQ A;  1IN6 A;  3EIH A;  1DGH A;  4NXM M;  2MGW A;  5KPZ A;  2JZ0 A;  1IXZ A;  4JI5 M;  3J2P B;  2QHO B;  2AHM A;  1QAN A;  2B3T A;  2R18 A;  5FSW A;  2X8A A;  2KNZ A;  4LGM A;  1UM8 A;  4IBI A;  1DO0 A;  1P3Q Q;  3FTC A;  4RKU F;  3SHG B;  3TWL A;  3HX3 A;  2UUA M;  5ITU A;  3W0L B;  1DGB A;  3U61 A;  3ZQJ A;  4CGY B;  4DR5 M;  2XZU A;  4PDG A;  3DFZ A;  3U6E A;  1MU5 A;  3GLG B;  3J7A S;  4W5W A;  4AZF A;  3HJS A;  2CV0 A;  2UXB M;  2BWB A;  5LMN M;  3DA1 A;  2HAK A;  4FD2 A;  5EQT A;  4DR3 M;  3ZH9 B;  2L7H A;  2GQF A;  2JY7 A;  1Z59 A;  1W5S A;  2DNA A;  2HL7 A;  4LRS A;  1SXJ D;  4MGH A;  5DFL A;  5C18 A;  4FWG A;  1N32 M;  1IY0 A;  4GRI A;  4M9S A;  4YHH M;  2JY6 B;  1XXH A;  3T6P A;  3C9P A;  1NV9 A;  1CUK A;  3RFW A;  4CIZ A;  3I04 M;  3PFI A;  1UFZ A;  4F2L A;  1QZM A;  3FD9 A;  1ZMV A;  4GHA A;  1Z6T A;  4KT0 F;  2C9O A;  1IN5 A;  4F1I A;  1XB2 B;  4M9X A;  2ZBK B;  3SC3 A;  4IBK A;  1TH3 A;  4FCW A;  4R7G A;  1D2N A;  2KRU A;  2QPA A;  2YFQ A;  3ILK A;  1SXJ A;  2R6F A;  3U6P A;  4LF4 M;  4LFB M;  4DR2 M;  4AKG A;  2CV2 A;  5KQ8 A;  3QAU A;  2QP9 X;  5H37 D;  2LTU A;  3KOY E;  1XWI A;  1OTR A;  5KQD A;  5FTM A;  3HU3 A;  4B3S M;  3UGJ A;  4I4L A;  1Z5B A;  4GHL A;  4X62 M;  4MGY E;  2RGO A;  1YE9 A;  2CUZ A;  5A2Q S;  3GO8 A;  1QZE A;  4II7 A;  4NXN M;  3EIE A;  4DV6 M;  5IT9 S;  2JY8 A;  4LJ6 A;  2OOB A;  3GLH A;  4I8O A;  2OQ4 A;  3TL4 X;  2KHH A;  4ITQ A;  3T38 A;  1YUB A;  3I51 A;  2Y0T A;  1VDL A;  5EXP A;  2Y20 A;  3IHP A;  1N34 M;  4NRV A;  5JI3 E;  1QAM A;  3PVS A;  4G6Z A;  5FTL A;  4DR4 M;  3FYC A;  2E5L M;  2DVW B;  4RNA A;  4DV0 M;  3HGI A;  2CRU A;  2R0I A;  4DUY M;  3B89 A;  1HT1 E;  3KP1 E;  3GPX A;  3L2A A;  2F5N A;  1L1T A;  5F3W A;  1IM2 A;  1TH2 A;  3FTD A;  4I5S A;  5ITR A;  5IWA M;  3W0F A;  2F5S A;  1ZV1 A;  2YQZ A;  3CF0 A;  2LNH C;  4FWD A;  4JI2 M;  1I4W A;  1DV0 A;  3GLI A;  1QDT A;  1WHC A;  2M60 A;  3PXG A;  4Z8X A;  1T3T A;  2G3Q A;  3FRI A;  1NSF A;  3ZC7 B;  4DV2 M;  2R65 A;  2KZS A;  2LVN C;  1XMO M;  2XF3 A;  3B7Q A;  3HHW A;  4GIP A;  1TR8 A;  3V76 A;  1R4G A;  2DEN A;  4ZPX A;  1OKS A;  4FCV A;  2X4A A;  3QYE A;  1L2B A;  2I7N A;  4KHP M;  2CP8 A;  3B7Z A;  3KSX A;  5EP1 A;  2QEN A;  5GKN A;  2LVO C;  3GQ4 A;  1Q39 A;  1G3I A;  4QOS A;  4QHS A;  3VDP A;  5EJC A;  1OQY A;  4OU7 A;  1GO5 A;  4GC5 A;  2K0B X;  2MH8 A;  4FVM A;  4WW0 A;  3U5Z B;  3K1J A;  4JI1 M;  2DWN A;  1R5L A;  4DR6 M;  3RGS A;  1GVN A;  2Z8Y M;  2YNM D;  2KEB A;  3FTF A;  2WSF F;  4IIW A;  5DNY A;  3R9X B;  3NBI A;  4MM3 B;  4JI6 M;  3FUX A;  4HEO A;  2UXC M;  1HNZ M;  2H1R A;  1IN8 A;  1WIV A;  4Q7J A;  3GLF E;  2C5R A;  2F5Q A;  1QQW A;  1V34 A;  3VKH A;  4BB9 A;  2DHY A;  5ITX E;  2CHG A;  1C1K A;  1IQP A;  4IBD A;  3U6D A;  2P5T A;  1EE8 A;  2JA2 A;  3SAR A;  4LF5 M;  4L15 A;  3Q8G A;  4L16 A;  2JXN A;  3U6S A;  3HKP A;  2CWB A;  2OPF A;  2HWJ A;  4A3V B;  2WZJ A;  4Y28 F;  4QOZ C;  1ZMU A;  2C98 A;  3SMS A;  3SHF A;  5KPT A;  3H4J A;  2DAM A;  5LMU M;  4AKH A;  1T6O A;  3JR5 A;  3KOX E;  1XNR M;  2HHH M;  3GPY A;  1DGF A;  3UJN A;  4NRW A;  4D81 A;  1XNQ M;  2LH0 A;  2CHQ A;  3W68 A;  4XK8 F;  4DBG B;  3GLG E;  1VQ1 A;  4IBG A;  5BPV A;  3WHL A;  1IXS B;  4LFC M;  1PM5 A;  2KA6 B;  1IBL M;  4IJF A;  2F5P A;  4OX9 M;  1TGU A;  3MK6 A;  3D8B A;  4B3M M;  2ZAO A;  4OVZ A;  4EIW A;  2R46 A;  3B9P A;  8CAT A;  1F4I A;  4X65 M;  3A46 A;  1QDR A;  3UZU A;  4X64 M;  1L2D A;  2KZU A;  4JYA M;  3FYD A;  2LVQ D;  3L27 A;  1PRB A;  2R45 A;  4UN2 B;  3SBJ A;  3A45 A;  1EFU B;  1E94 E;  1DO2 A;  3K2L A;  1QUS A;  2CV1 A;  3PNV A;  3SAT A;  1DGH B;  1T43 A;  2R62 A;  4B7H A;  2DHR A; 
#chains in the Genus database with same CATH homology
 2YR0 A;  3A42 A;  3LQR A;  1Q3C A;  3TQS A;  1DGG A;  5ITQ A;  4B3T M;  3U61 B;  4LRT A;  2DXI A;  1G4A E;  3GRU A;  4KOD A;  2VQE M;  3TPZ A;  3KS4 A;  3KDS E;  1I94 M;  3FTE A;  2KRK A;  4BLC A;  1N36 M;  4QNM A;  1ZQ9 A;  2CE7 A;  2VII A;  3HJ8 A;  3J80 S;  5EP4 A;  4AW4 A;  1OFH A;  5IRE B;  1NVM A;  1XXH B;  3CF2 A;  7CAT A;  4DV7 M;  4R3D A;  3SFZ A;  3KOZ E;  1IBK M;  1IN7 A;  2XFT A;  3VK8 A;  3D8L A;  5ITT A;  1NNU C;  3I4Y A;  4I81 A;  1NJF A;  4G4Q A;  2M5Z A;  2EUC A;  4REZ A;  1SXJ B;  3AOE A;  1QVR A;  4DV5 M;  5EXX A;  1K3X A;  1TDH A;  4FCT A;  3UK6 A;  1VDD A;  3GQ3 A;  3HU1 A;  1KYI A;  4JI7 M;  5E6J A;  4GKJ M;  4GC9 A;  2FE8 A;  4GIT A;  4IBE A;  1E9R A;  4LF7 M;  2UUC M;  2R4E A;  2HCB A;  4AKI A;  3KSJ A;  2ZM6 M;  3E9S A;  3VDU A;  4LF6 M;  2DWM A;  3AOE C;  4TUW A;  3NWL A;  1E9S A;  1QAO A;  2K47 A;  2XFS A;  1IXR C;  4XBO A;  2ERC A;  4LF9 M;  1FNN A;  3JAM S;  1R2Y A;  4NSR A;  4JV5 M;  4LJ8 A;  4FW9 A;  4S12 A;  3KOW E;  1J7K A;  2RGH A;  3UMM A;  3H4M A;  2KXE A;  3HHZ A;  2FFJ A;  2R4J A;  4PCZ A;  1K82 A;  4RF0 A;  3VK7 A;  1J5E M;  3TE6 A;  4L4U A;  1X37 A;  1GL6 A;  3GLI B;  3BOS A;  1XHB A;  3SAU A;  1TDZ A;  4D82 A;  2QZ4 A;  4NL4 H;  4P16 A;  4RF1 A;  3A98 B;  5KPR A;  2I7P A;  1WXQ A;  1IBM M;  4LFA M;  2G8L A;  2X49 A;  1R7R A;  5KO3 A;  5FTK A;  1FJG M;  3J7B A;  5EP2 A;  2CFO A;  1L1Z A;  4G4N A;  2Z4S A;  3FUT A;  3GPP A;  2XLJ A;  4JI3 M;  4LCB A;  2NQ8 C;  5IZ7 D;  3GRV A;  1R2Z A;  1HT2 E;  3AV0 A;  4JXJ A;  3M0E A;  3K92 A;  3CTW B;  2L6O A;  2FNA A;  4FWH A;  4CHT B;  3T1H M;  1G8P A;  1N75 A;  4KO8 A;  3DZD A;  5C1B A;  2QBY A;  4PT5 A;  3GRR A;  3GLF A;  3U60 A;  5ITX A;  3IG8 A;  1K3W A;  4X66 M;  5BR8 M;  4BBA A;  3MJ5 A;  2BNK A;  3M6A A;  4GKK M;  3U6L A;  2D7G A;  1G59 A;  3THG A;  2CHV A;  4LF8 M;  3L28 A;  4JI4 M;  2XSZ D;  2XH9 A;  2BJV A;  1NJG A;  3AJI B;  3M7G A;  2F5O A;  4LJ4 A;  1OJL A;  1TH4 A;  3AOG A;  3HWS A;  3QWL A;  4B3R M;  1N78 A;  2UUB M;  3WHK A;  3L29 A;  4LZZ A;  5EXS A;  3GLG A;  1H6U A;  1R6B X;  4PD2 A;  2QCU A;  1LV7 A;  4DV3 M;  2BJW A;  1HNW M;  3KS8 A;  2XSZ A;  1N33 M;  4OVZ B;  2UXD M;  1NNJ A;  3HHX A;  3CF6 E;  4MH0 E;  2XZF A;  3GQ5 A;  4IBJ A;  4B7G A;  4JI8 M;  4D80 A;  3JR4 A;  2J7N A;  1PJJ A;  1JR3 D;  3FUU A;  3Q8X A;  3HHY A;  2A5Y B;  1IY2 A;  1SXJ E;  3KXE C;  4B08 A;  4DR1 M;  5E26 A;  5JI2 E;  1S3S A;  3VLF B;  1QYR A;  3VKG A;  4YY3 M;  3LVW A;  2O5R A;  3LMM A;  3U6M A;  1J09 A;  2L7I A;  2Y21 A;  4NOO B;  4QNR A;  2CEA A;  1JR3 A;  2C96 A;  5EXT A;  2C99 A;  5FTJ A;  4HLQ A;  2DZO B;  4DV1 M;  3VFD A;  1NY6 A;  1HQC A;  2V6Z M;  3SAS A;  4AG5 A;  2HKJ A;  3J81 S;  2DWL A;  1NHG C;  1KSF X;  4KLN A;  5DYG A;  4MGI E;  1HR0 M;  3T15 A;  2Z3X A;  4B7F A;  1JQJ C;  1Q3B A;  4DUZ M;  1NHW C;  1OFI A;  1L8Q A;  4DR7 M;  3HJQ A;  4LJ9 A;  3GRY A;  3PNY A;  1XC8 A;  3U6C A;  4LJ7 A;  2V1U A;  2Z7J A;  2J7O A;  3OTO M;  4JN6 A;  3GLH B;  3U6Q A;  4IBF A;  1SXJ C;  3FKE A;  1Z5C A;  1QAQ A;  1HNX M;  2DWZ B;  3J27 B;  2Q2E B;  1GLN A;  3T1Y M;  4DV4 M;  4L78 A;  4JI0 M;  4G4O A;  2EA0 A;  5ITY A;  1Z5A A;  2XGN A;  2EO2 A;  3IG5 A;  1G41 A;  1GL7 A;  5FLX S;  3SAW A;  3KVW A;  1HQY E;  2UU9 M;  1E32 A;  4CIS A;  4PDI A;  3FUV A;  3C58 A;  2D7E A;  2KW0 A;  3KFU G;  2Z4R A;  4IBB A;  2XEP A;  3DOA A;  3SYK A;  3SYL A;  1YSY A;  4M9Z A;  3K8Z A;  3SMP A;  4NSO B;  3E4R A;  1L2C A;  2D7H A;  1IY1 A;  4LJA A;  4LY6 A;  4QHT A;  2LWX A;  2F4V M;  4LG2 A;  4AQY M;  3L26 A;  4MGK E;  1W5T A;  3U5Z A;  3LVV A;  2C9C A;  4WUR A;  3R8F A;  1ZAE A;  3KP0 E;  4K0K M;  3TWM A;  4LJ5 A;  4GH9 A;  4M0D A;  4XGI A;  4LZJ A;  3RGP A;  4AG6 A;  4OW0 A;  1IN4 A;  2FOI C;  2W82 A;  3AKZ A;  4MB7 A;  3LQQ A;  4MGZ E;  2LXE A;  2ZAN A;  3HU2 A;  5DYI A;  1PJI A;  1NY5 A;  4IBC A;  4AI6 A;  3KW6 A;  1N77 A;  3U6O A;  2ZAM A;  3AL0 C;  2V1C A;  2G5G X;  3RE8 A;  1KFV A;  3AFH A;  1GKI A;  5EP3 A;  4M0W A;  1ORY B;  3SAV A;  2RKO A;  3MHV C;  4LGY A;  3TWK A;  3GPU A;  3FUW A;  2DZN B;  5FTN A;  4HL4 A;  3I4V A;  3L25 A;  1XMQ M;  2QBY B;  4Z6Y A;  4IJE A;  2VQF M;  2L09 A;  3GLF B;  3U60 B;  2Y0Q A;  3GP1 A;  1MX0 A;  4L8R C;  3ZCB B;  4G4R A;  4GMQ A;  1IN6 A;  3EIH A;  1DGH A;  4NXM M;  5KPZ A;  4JI5 M;  1IXZ A;  3J2P B;  2AHM A;  1QAN A;  2R18 A;  5FSW A;  2X8A A;  4LGM A;  1UM8 A;  4IBI A;  1DO0 A;  3FTC A;  3SHG B;  3TWL A;  2UUA M;  5ITU A;  3W0L B;  1DGB A;  3U61 A;  4CGY B;  4DR5 M;  2XZU A;  4PDG A;  3DFZ A;  3U6E A;  1MU5 A;  3GLG B;  3J7A S;  4W5W A;  4AZF A;  3HJS A;  2CV0 A;  2UXB M;  5LMN M;  3DA1 A;  5EQT A;  4FD2 A;  4DR3 M;  3ZH9 B;  2L7H A;  1Z59 A;  1W5S A;  2HL7 A;  4LRS A;  4MGH A;  1SXJ D;  5C18 A;  4FWG A;  1N32 M;  1IY0 A;  4GRI A;  4M9S A;  4YHH M;  1XXH A;  3RFW A;  3PFI A;  1QZM A;  3FD9 A;  4GHA A;  1Z6T A;  2C9O A;  1IN5 A;  4M9X A;  2ZBK B;  3SC3 A;  4IBK A;  1TH3 A;  4FCW A;  4R7G A;  1D2N A;  2KRU A;  2QPA A;  2YFQ A;  3ILK A;  1SXJ A;  3U6P A;  4LF4 M;  4LFB M;  4DR2 M;  4AKG A;  2CV2 A;  5KQ8 A;  3QAU A;  2QP9 X;  5H37 D;  3KOY E;  1XWI A;  5KQD A;  5FTM A;  3HU3 A;  4B3S M;  3UGJ A;  4I4L A;  1Z5B A;  4GHL A;  4X62 M;  4MGY E;  2RGO A;  1YE9 A;  2CUZ A;  5A2Q S;  3GO8 A;  4II7 A;  4NXN M;  3EIE A;  4DV6 M;  5IT9 S;  4LJ6 A;  3GLH A;  4I8O A;  2OQ4 A;  3TL4 X;  4ITQ A;  3T38 A;  1YUB A;  3I51 A;  2Y0T A;  5EXP A;  2Y20 A;  1N34 M;  4NRV A;  5JI3 E;  1QAM A;  3PVS A;  4G6Z A;  5FTL A;  4DR4 M;  3FYC A;  2E5L M;  2DVW B;  4RNA A;  4DV0 M;  3HGI A;  4DUY M;  1HT1 E;  3KP1 E;  3GPX A;  3L2A A;  2F5N A;  1L1T A;  5F3W A;  1IM2 A;  1TH2 A;  3FTD A;  4I5S A;  5ITR A;  5IWA M;  3W0F A;  2F5S A;  3CF0 A;  2YQZ A;  4JI2 M;  2LNH C;  4FWD A;  1I4W A;  3GLI A;  2M60 A;  3PXG A;  4Z8X A;  1T3T A;  1NSF A;  3ZC7 B;  4DV2 M;  2R65 A;  2KZS A;  1L2B A;  1XMO M;  2XF3 A;  3HHW A;  4GIP A;  4ZPX A;  4FCV A;  2X4A A;  2I7N A;  4KHP M;  3KSX A;  5EP1 A;  2QEN A;  5GKN A;  3GQ4 A;  1Q39 A;  1G3I A;  4QOS A;  4QHS A;  3VDP A;  5EJC A;  4OU7 A;  4GC5 A;  4FVM A;  4JI1 M;  4WW0 A;  3U5Z B;  3K1J A;  2DWN A;  4DR6 M;  3RGS A;  1GVN A;  2YNM D;  2KEB A;  3FTF A;  5DNY A;  4IIW A;  3R9X B;  3NBI A;  4MM3 B;  4JI6 M;  3FUX A;  2UXC M;  1HNZ M;  2H1R A;  1IN8 A;  2C5R A;  2F5Q A;  1QQW A;  3VKH A;  4BB9 A;  5ITX E;  2CHG A;  1C1K A;  1IQP A;  4IBD A;  3U6D A;  2P5T A;  1EE8 A;  2JA2 A;  3SAR A;  4LF5 M;  4L15 A;  4L16 A;  3U6S A;  3HKP A;  2OPF A;  4QOZ C;  2C98 A;  3SMS A;  3SHF A;  5KPT A;  4AKH A;  5LMU M;  3JR5 A;  3KOX E;  1XNR M;  2HHH M;  3GPY A;  1DGF A;  3UJN A;  4NRW A;  4D81 A;  1XNQ M;  2LH0 A;  2CHQ A;  4IBG A;  5BPV A;  3WHL A;  1IXS B;  4LFC M;  1PM5 A;  2KA6 B;  1IBL M;  4IJF A;  2F5P A;  4OX9 M;  1TGU A;  3MK6 A;  3D8B A;  4B3M M;  2ZAO A;  4OVZ A;  4EIW A;  2R46 A;  3B9P A;  8CAT A;  4X65 M;  3A46 A;  4X64 M;  3UZU A;  1L2D A;  2KZU A;  4JYA M;  3FYD A;  3L27 A;  2R45 A;  3SBJ A;  3A45 A;  1E94 E;  1DO2 A;  3K2L A;  2CV1 A;  3SAT A;  3PNV A;  1DGH B;  4A3V B;  2R62 A;  4B7H A;  2DHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...