3SHGB

Vbht fic protein from bartonella schoenbuchensis in complex with vbha antitoxin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
61
structure length
61
Chain Sequence
VLSEEEIEYRRRDARNALASQRLEGLEPDPQVVAQMERVVVGELETSDVIKDLMERIKREE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VbhT
publication title Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins.
pubmed doi rcsb
source organism Bartonella schoenbuchensis r1
molecule tags Transferase/protein binding
total genus 25
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18495 VbhA Antitoxin VbhA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1050 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3shgB00
3ZC7B 3ZCBB 3SHGB
chains in the Genus database with same CATH superfamily
5KO3A 1DGFA 3MHVC 4JI0M 1N75A 1TH2A 1L1ZA 3VFDA 2ZANA 3TL4X 3Q8XA 2V1UA 3JR5A 1XHBA 1E94E 4NOOB 2HHHM 2L7HA 4DV5M 2LXEA 4NRWA 2QZ4A 4I8OA 1N78A 2DWNA 3I01M 5ITTA 2HWJA 4OX9M 4IBKA 3GLIB 3HX3A 4Y28F 4OU7A 4LF7M 2CWBA 4G3OA 1DGHA 2CEAA 3C58A 4ITQA 3VDUA 4JI7M 1IY1A 4XGIA 1G4AE 1L2CA 1F4IA 4GIPA 2XF3A 1OQYA 3PFIA 1NJFA 1GJSA 3FTCA 4ZPXA 1ZMVA 3A45A 2CP8A 3E4RA 3HWSA 1R2YA 2ZAMA 2QENA 3D8BA 3CF2A 1I4WA 2QPAA 1JR3D 2FS1A 3B7QA 3CGWA 1VG5A 3HJ8A 3W68A 3PVSA 4NL4H 3GPXA 2N35A 4OVZB 3GLGA 5EP2A 4LFCM 2UXCM 2E5LM 4L16A 3WHLA 1TDHA 1G3IA 4LJAA 5EP3A 3WHKA 1IY2A 3HGIA 4IJEA 2LNHC 1OTRA 3CF0A 2EJSA 4ANRA 2R44A 3SYKA 4X62M 5BPVA 1TH4A 3U61A 2BWEA 3F92A 5KPRA 3HJQA 2R45A 3VKHA 2XSZA 3HU3A 2MGWA 3A42A 4CGYB 4JI4M 3IG8A 4FWGA 3FKEA 5EXSA 3RGSA 4IBGA 2JY8A 1Z5BA 2KW0A 3GLGE 4X64M 2F4VM 4AZFA 4LG2A 4R7GA 2X4AA 1J5EM 3HU2A 4LJ6A 3SHFA 2UXBM 3FYDA 4IBCA 4LRTA 1PGYA 4JI6M 1NNUC 4LJ5A 4LJ4A 5JI2E 4D81A 3KOWE 4LRSA 4G4QA 3VK7A 3C3DA 2KEBA 3KOYE 4QHSA 2LHCA 3R9XB 3FUXA 3M7GA 4IBDA 2JZ1A 3U6SA 1GL6A 3ZH9B 1D0KA 3A98B 3L26A 2D7HA 3FYCA 2YQZA 4I81A 4P17A 2OOBA 2Z7JA 4W5WA 5DYIA 4CJ6A 1XMOM 4LF5M 3KOXE 4MH0E 2KRUA 3ILKA 1IN5A 1Q39A 4NXNM 3T1HM 1C7YA 4IIWA 3FTDA 2CV1A 3KP1E 1YUBA 2D7EA 2OOAA 1PJIA 3SAVA 1ORYB 2Z4SA 4B3SM 1Q02A 4K0KM 3HHWA 4GKJM 5GKNA 3J7BA 2L4FA 2KNZA 1N36M 2C9CA 5ITXE 1VEJA 2L7IA 2H1RA 2B3TA 2LVOC 4GH9A 1NHGC 3GRVA 1OAOC 1IXSB 1SG9A 4CIZA 3A46A 3U6EA 1NNJA 2LVNC 4G6ZA 1GVNA 2CHGA 4QOZC 2Y20A 2JY7A 1DV0A 3H4MA 3PNYA 5FTLA 4OVZA 2QP9X 4DR2M 4JN6A 2BWBA 3U6OA 4L15A 1R6BX 5LMNM 3I4YA 2K9DA 5IREB 2V6ZM 1K3XA 1OJLA 3W0LB 1OFHA 1IN4A 1R7RA 2EUCA 3B7ZA 4DV2M 4LCBA 3U6DA 2KZSA 4FCWA 1L2BA 1DO2A 3QAUA 1JB0F 2C99A 1A5TA 3SC3A 4NSRA 3U6LA 2CFOA 1KYIA 2O5RA 2R62A 4P16A 4PD2A 5FSWA 2JY6B 4WW0A 2M60A 3LW5F 3GPUA 1QAQA 2CRUA 3W67A 4B7FA 1MN3A 4LFAM 4MGHA 3VK8A 2RGOA 3SFZA 4DV6M 4FCVA 2D7GA 1JR3A 1QUTA 3E9SA 1LV7A 2JNHA 2R4JA 2EO2A 2QSFX 4NC6A 1WJ7A 4CHTB 3B7NA 3FRIA 2Z3XA 2X8AA 1UFZA 3SARA 4JV5M 3VKGA 1JR3E 3AOGA 4D80A 4DBGB 4B3RM 1GABA 3U60B 1QAMA 4JI2M 2H5XA 2KHHA 4FD2A 3FUUA 2F5NA 4LF8M 8CATA 1TTEA 3GPYA 1Y8GA 3GO8A 3M6AA 1HNXM 4LF6M 3H4JA 2VF8A 1D2NA 2KRKA 4REZA 4F1IA 3U5ZA 1IM2A 2DWZB 2HAKA 3EIHA 3KSJA 3AJIB 3FRHA 4MGKE 5ITYA 2C5RA 1P3QQ 1DO0A 3LCUA 2VQFM 4AKGA 5FTJA 2R46A 5LMUM 2DAEA 1IBMM 2AHMA 4PT5A 1NSFA 2JP7A 2CV2A 4IBJA 4DV1M 5EQTA 4B08A 4JYAM 2C96A 2DAGA 1IXRC 2GNOA 4IBBA 4MM3B 4PDIA 3AKZA 1VDLA 1ZMUA 2KXEA 2RKOA 2BNKA 3HU1A 2G3QA 3ZCBB 5IT9S 1KFVA 2W82A 3GRYA 4M0WA 1HT2E 3C3EA 1XXHB 4JI1M 2L09A 3U6CA 1OIZA 5H37D 4DR6M 1TF0B 2CUZA 1JQJC 4LJ9A 1N34M 1WHCA 3J80S 2L2DA 1V92A 1IQPA 3EIEA 3TWKA 4RNAA 4GKKM 1AIPC 4B7GA 3JR4A 2ZTDA 1OFIA 1G71A 4HEOA 3CTWB 2NQ8C 2QBYA 3VLFB 5IZ7D 2FE8A 3QYBA 4LFBM 2APLA 2R6FA 1NY5A 3KSXA 4L8RC 3GQ5A 4I5SA 4QHTA 1PM5A 1EE8A 2LTUA 1NO1A 2JUJA 2LVAA 5KQDA 2ERCA 3GQ4A 2DZLA 5ITXA 4WURA 1VEKA 5KPTA 4L6V6 3K2LA 1FNNA 3GLIA 2JA2A 4QNMA 2Y0TA 3HHZA 4AKIA 1E32A 2XZFA 1NV8A 2J7OA 4IBIA 3GLHB 4BBAA 1R4GA 2FH0A 3FUVA 4AW4A 4G4OA 4NSOB 2J7NA 3E46A 3SATA 2G8LA 1I94M 4KHPM 1QANA 4LJ8A 1XMQM 2LWXA 1IBKM 2LBCA 2YR0A 1TGUA 2R18A 2XH9A 2DZOB 3I04M 1VEGA 2C98A 3GLIE 4DR1M 3L2AA 1L2DA 2OO9A 3FUTA 3C9PA 1PJJA 3AFHA 2KDLA 4AQYM 3R8FA 1NV9A 2O01F 3PNVA 1EFUB 1HNWM 1IFYA 1W5TA 1VDDA 1QDTA 2G5GX 2R4EA 4JI5M 3DOAA 1OKSA 3B9PA 1Z59A 4LF9M 2QHOB 2GQFA 3TWLA 4FCTA 4L4UA 5BR8M 3RFWA 2YFQA 4PDGA 2EA0A 2I7NA 2CHVA 5FTKA 4LGYA 2Z8YM 1XB2B 2F5QA 1EIJA 2WSEF 2XGNA 1HNZM 2UUBM 2VF7A 1H6UA 3W0FA 1WIVA 1T3TA 4S12A 3JAMS 3J81S 1HR0M 1OAIA 1QUSA 1WXQA 2CE7A 3L27A 2MR9A 1SXJD 2DNAA 5E26A 2UUAM 3K9PA 1C1KA 2FOIC 4QOSA 1PJTA 3K8ZA 1G8PA 3QYEA 2JY5A 4MGYE 3K1JA 4YY3M 2DWMA 4AI6A 2LVQD 1FJGM 4G4RA 1GL7A 4QNRA 2UUCM 2UXDM 2O25A 2ZBKB 5C18A 1Q3CA 3KFUG 2RRUA 3NWLA 1DGGA 4GHAA 3HKPA 4RKUF 4XBOA 5JI3E 3UJNA 1XWIA 1ZMWA 3AV0A 3LQQA 4GRIA 4WP2A 2VQEM 2DAMA 5DFLA 5F3WA 2YNMD 2JWSA 3SBJA 1GLNA 4LZZA 4IJFA 1NHWC 3IECA 4LJ7A 2K6BA 3U61B 2JZ0A 4A3VB 5EXTA 4FWDA 4NXMM 1MX0A 1PJSA 3FE3A 2EKKA 4HLQA 2DVWB 3GLHA 3ZQJA 3IHPA 1IBLM 2LH0A 3U6PA 1G59A 4NRVA 1E9SA 4FVMA 3UMMA 3HZJA 5ITQA 2ZM6M 1Z5AA 2QNJA 4B3MM 4IBEA 2X49A 4DUYM 1NJGA 2KA6B 1IXSA 5EXXA 3GLFB 1SXJB 2HCBA 1J7KA 5EP4A 2MH8A 5FTNA 3RE8A 2MJ5B 4DV3M 2Y0QA 2CHQA 2XFTA 1QZMA 2A5YB 3LQRA 1GJTA 1QVRA 2R65A 3GLHE 1QQWA 3MJ5A 4PCZA 4XK8F 4EIWA 1V34A 1ZV1A 5EXPA 2P5TA 3I51A 2V1CA 3THGA 5EJCA 5ITRA 2ZAOA 2OQ4A 4DR5M 3SMPA 3KDSE 2WZJA 3GRUA 2DHRA 4R3DA 4MGIE 2KNVA 3QWLA 3KXEC 4HL4A 5E6JA 3VDPA 2K47A 4GMQA 4JI8M 2DENA 3SMSA 1DGBA 2RGHA 4FW9A 1KSFX 3E21A 4JI3M 3J7AS 2ZTCA 3LVVA 1D0LA 1N32M 1PRBA 3LVWA 4YHHM 1BVSA 1QZEA 5FTMA 3AOEA 3B74A 3V76A 4BLCA 2C9OA 2BJWA 3NBIA 2HL7A 1L8QA 2FFJA 1HQYE 2DI0A 1YE9A 4B7HA 3BBZA 2VDBB 2R0IA 3J27B 3L28A 4G4NA 1TR8A 1IN7A 1GKIA 4JXJA 3TQSA 4DV7M 2UU9M 1LTMA 4GC5A 1TDZA 2WSCF 2EKFA 4M9XA 1YSYA 2F5OA 2XZUA 2KNAA 4DV4M 1HJPA 2JXNA 4Q7JA 3Q8GA 2CV0A 3CF6E 1MJGM 3MMPA 3DZDA 4LY6A 3HHXA 3KOZE 2FNAA 2DZNB 1Q3BA 5C1BA 2WSFF 1WGLA 1RU3A 5DNYA 1XC8A 1V33A 1Z5CA 2DAIA 2Q2EB 3U60A 1XNQM 3J2PB 1R5LA 3UZUA 1CUKA 3GLFA 1SXJA 3BXWA 4RF0A 2DWLA 2L4EA 4R71A 5A2QS 1YLAA 2Z4RA 4UN2B 5ITUA 4F2LA 1UM8A 3GPPA 5DYGA 3T38A 5KPZA 3HJSA 3KP0E 1IXZA 4DR3M 4X65M 2LHGA 2KZUA 3SAUA 1XNRM 3RGPA 4KT0F 4I4LA 1J09A 1WR1B 3MK6A 1G41A 1E9RA 3ZC7B 4X66M 1K82A 3GLFE 1SXJE 2K0BX 4LZJA 4AG6A 4OW0A 4TUWA 1AUAA 3D8LA 3NBXX 4M9SA 1MU5A 2BJVA 2LVPC 5KQ8A 3SASA 3KW6A 2XLJA 2F5SA 3UGJA 3L25A 1TH3A 1D0MA 4D82A 2MROB 3TE6A 3FTEA 4GHLA 3KS4A 3LCVB 4DR7M 1XXHA 3AOEC 2XSZD 7CATA 1N77A 4AG5A 4DUZM 1HT1E 3IG5A 3PXGA 3B89A 2HKJA 4M0DA 1QDRA 3GRRA 2QCUA 1IY0A 1S3SA 3HY5A 4Z6YA 3GQ3A 3FUWA 1DGHB 3FD9A 1NVMA 1Z6TA 3U6MA 3I4VA 3TPZA 5FLXS 4GC9A 3U5ZB 1X37A 3UK6A 3TWMA 4BB9A 2I7PA 3GP1A 2F5PA 1XXHE 2OPFA 4IBFA 1IN8A 2DXIA 3OTOM 4II7A 4Z8XA 1K3WA 5EP1A 1W5SA 1QYRA 3U6QA 4MGZE 1NY6A 1ZQ9A 3BOSA 1VQ1A 1HQCA 1GO5A 2Y21A 4LF4M 3K9OA 3DFZA 4KO8A 5L8RF 1L1TA 4FWHA 3T15A 3GLGB 4B3TM 3AL0C 1ZAEA 3HHYA 1N33M 3T1YM 4KODA 4CISA 1T43A 3L29A 1OIPA 2J5YA 2QQ8A 1SXJC 2XEPA 2XFSA 3SYLA 3T6PA 2DAKA 4KLNA 4DR4M 3KVWA 3M0EA 1R2ZA 1T6OA 3K92A 4RF1A 4L78A 3FTFA 4GITA 1QAOA 2DHYA 2DKLA 4LGMA 5IWAM 4AKHA 1WGNA 3SAWA 3KS8A 2L6OA 2VIIA 3LMMA 4GEWA 1IN6A 3SHGB 4MB7A 4M9ZA 1PJQA 3DA1A 2M5ZA 2QBYB 4DV0M
chains in the Genus database with same CATH topology
5KO3A 1DGFA 3MHVC 4JI0M 1N75A 1TH2A 1L1ZA 3VFDA 2ZANA 3TL4X 3Q8XA 2V1UA 3JR5A 1XHBA 1E94E 4NOOB 2HHHM 2L7HA 4DV5M 2LXEA 4NRWA 2QZ4A 4I8OA 1N78A 2DWNA 5ITTA 4OX9M 4IBKA 3GLIB 4OU7A 4LF7M 4ITQA 3C58A 1DGHA 2CEAA 3VDUA 4JI7M 1IY1A 4XGIA 1G4AE 1L2CA 4GIPA 2XF3A 3PFIA 1NJFA 3FTCA 4ZPXA 3A45A 3E4RA 3HWSA 1R2YA 2ZAMA 2QENA 3D8BA 3CF2A 1I4WA 2QPAA 1JR3D 3HJ8A 3PVSA 4NL4H 3GPXA 4OVZB 3GLGA 4LFCM 5EP2A 2UXCM 2E5LM 4L16A 3WHLA 1TDHA 1G3IA 4LJAA 5EP3A 3WHKA 1IY2A 3HGIA 4IJEA 2LNHC 3CF0A 4X62M 3U61A 3SYKA 5BPVA 1TH4A 5KPRA 3HJQA 2R45A 3VKHA 2XSZA 3HU3A 3A42A 4CGYB 4JI4M 3IG8A 4FWGA 3FKEA 5EXSA 3RGSA 4IBGA 1Z5BA 2KW0A 4X64M 2F4VM 4AZFA 4LG2A 4R7GA 2X4AA 1J5EM 3HU2A 4LJ6A 3SHFA 2UXBM 3FYDA 4IBCA 4LRTA 4JI6M 1NNUC 4LJ5A 4LJ4A 5JI2E 4D81A 3KOWE 4LRSA 4G4QA 3VK7A 2KEBA 3KOYE 4QHSA 3R9XB 3FUXA 3M7GA 4IBDA 3U6SA 1GL6A 3ZH9B 2UU9M 3A98B 3L26A 2D7HA 3FYCA 2YQZA 4I81A 5DYIA 2Z7JA 1XMOM 4W5WA 4LF5M 3KOXE 4MH0E 2KRUA 3ILKA 1IN5A 1Q39A 4NXNM 3T1HM 4IIWA 3FTDA 2CV1A 3KP1E 1YUBA 2D7EA 1PJIA 4K0KM 3SAVA 1ORYB 2Z4SA 4B3SM 3HHWA 4GKJM 5GKNA 3J7BA 1N36M 2C9CA 5ITXE 2L7IA 2H1RA 4GH9A 1NHGC 3GRVA 3U6EA 1IXSB 3A46A 1NNJA 4G6ZA 1GVNA 2CHGA 4QOZC 2Y20A 3H4MA 3PNYA 5FTLA 4OVZA 2QP9X 4DR2M 4JN6A 3U6OA 4L15A 1R6BX 5LMNM 3I4YA 5IREB 2V6ZM 1K3XA 1OJLA 3W0LB 1OFHA 1IN4A 1R7RA 2EUCA 4DV2M 4LCBA 3U6DA 2KZSA 4FCWA 1L2BA 1DO2A 3QAUA 2C99A 3SC3A 4NSRA 3U6LA 2CFOA 1KYIA 2O5RA 2R62A 4P16A 4PD2A 5FSWA 4WW0A 2M60A 3GPUA 1QAQA 4B7FA 4LFAM 4MGHA 3VK8A 2RGOA 3SFZA 4DV6M 4FCVA 2D7GA 1JR3A 3E9SA 1LV7A 2R4JA 2EO2A 4CHTB 2Z3XA 2X8AA 3SARA 4JV5M 3VKGA 3AOGA 4D80A 4B3RM 3U60B 1QAMA 4JI2M 4FD2A 3FUUA 2F5NA 4LF8M 8CATA 3GPYA 3GO8A 3M6AA 1HNXM 4LF6M 4REZA 1D2NA 2KRKA 3U5ZA 1IM2A 2DWZB 3EIHA 3KSJA 5ITYA 3AJIB 4MGKE 2C5RA 4AKGA 2VQFM 1DO0A 5FTJA 2R46A 5LMUM 1IBMM 2AHMA 4PT5A 1NSFA 2CV2A 4IBJA 4DV1M 5EQTA 4B08A 4JYAM 2C96A 1IXRC 4IBBA 4MM3B 3AKZA 4PDIA 2KXEA 2RKOA 3HU1A 2BNKA 3ZCBB 5IT9S 1KFVA 2W82A 3GRYA 4M0WA 1HT2E 1XXHB 4JI1M 2L09A 3U6CA 5H37D 4DR6M 2CUZA 1JQJC 4LJ9A 1N34M 3J80S 1IQPA 3EIEA 3TWKA 4RNAA 4GKKM 4B7GA 3JR4A 1OFIA 3CTWB 2NQ8C 2QBYA 3VLFB 5IZ7D 2FE8A 4LFBM 1NY5A 3KSXA 4L8RC 3GQ5A 4I5SA 4QHTA 1PM5A 1EE8A 5KQDA 2ERCA 3GQ4A 5ITXA 4WURA 5KPTA 3K2LA 1FNNA 3GLIA 2JA2A 4QNMA 2Y0TA 3HHZA 4AKIA 1E32A 2XZFA 2J7OA 4IBIA 3GLHB 4BBAA 3FUVA 4AW4A 3SATA 4G4OA 4NSOB 2J7NA 2G8LA 1I94M 4KHPM 1QANA 4LJ8A 1XMQM 2LWXA 1IBKM 2YR0A 1TGUA 2R18A 2XH9A 2DZOB 2C98A 4DR1M 3L2AA 1L2DA 3FUTA 1PJJA 3AFHA 4AQYM 3R8FA 3PNVA 1HNWM 1W5TA 1VDDA 2G5GX 2R4EA 4JI5M 3DOAA 3B9PA 1Z59A 4LF9M 3TWLA 4FCTA 4L4UA 5BR8M 3RFWA 2YFQA 4PDGA 2EA0A 2I7NA 2CHVA 5FTKA 4LGYA 2F5QA 2XGNA 1HNZM 2UUBM 1H6UA 3W0FA 1T3TA 4S12A 3JAMS 3J81S 1HR0M 1WXQA 2CE7A 3L27A 1SXJD 5E26A 2UUAM 1C1KA 2FOIC 4QOSA 3K8ZA 1G8PA 4MGYE 2DWMA 3K1JA 4YY3M 4AI6A 1FJGM 4G4RA 1GL7A 4QNRA 2UUCM 2UXDM 5C18A 2ZBKB 1Q3CA 3KFUG 3NWLA 1DGGA 4GHAA 3HKPA 4XBOA 5JI3E 3UJNA 1XWIA 3AV0A 3LQQA 4GRIA 2VQEM 5F3WA 2YNMD 3SBJA 1GLNA 4LZZA 4IJFA 1NHWC 4LJ7A 3U61B 4A3VB 5EXTA 4FWDA 4NXMM 1MX0A 4HLQA 2DVWB 3GLHA 1IBLM 2LH0A 3U6PA 1G59A 4NRVA 1E9SA 4FVMA 3UMMA 5ITQA 2ZM6M 1Z5AA 4B3MM 4IBEA 2X49A 4DUYM 1NJGA 2KA6B 5EXXA 3GLFB 1SXJB 2HCBA 1J7KA 5EP4A 5FTNA 3RE8A 4DV3M 2Y0QA 2CHQA 2XFTA 1QZMA 2A5YB 3LQRA 1QVRA 2R65A 3MJ5A 4PCZA 1QQWA 4EIWA 5EXPA 2P5TA 3I51A 2V1CA 3THGA 5EJCA 5ITRA 2ZAOA 2OQ4A 4DR5M 3SMPA 3KDSE 3GRUA 2DHRA 4R3DA 4MGIE 3QWLA 3KXEC 4HL4A 5E6JA 3VDPA 2K47A 4GMQA 4JI8M 3SMSA 1DGBA 2RGHA 4FW9A 1KSFX 4JI3M 3J7AS 3LVVA 1N32M 4YHHM 3LVWA 5FTMA 3AOEA 4BLCA 2C9OA 2BJWA 3NBIA 2HL7A 1L8QA 2FFJA 1HQYE 4B7HA 1YE9A 3J27B 3L28A 4G4NA 1IN7A 1GKIA 4JXJA 3TQSA 4DV7M 4GC5A 1TDZA 4M9XA 1YSYA 2F5OA 2XZUA 4DV4M 2CV0A 3CF6E 4LY6A 3DZDA 3HHXA 3KOZE 2FNAA 2DZNB 1Q3BA 5C1BA 5DNYA 1XC8A 1Z5CA 3U60A 2Q2EB 1XNQM 3J2PB 3UZUA 3GLFA 1SXJA 4RF0A 2DWLA 5A2QS 2Z4RA 5ITUA 3GPPA 1UM8A 5DYGA 3T38A 5KPZA 3HJSA 3KP0E 1IXZA 4DR3M 4X65M 3SAUA 2KZUA 1XNRM 3RGPA 4I4LA 1J09A 3MK6A 1G41A 1E9RA 3ZC7B 4X66M 1K82A 4TUWA 1SXJE 4LZJA 4AG6A 4OW0A 3D8LA 4M9SA 1MU5A 2BJVA 5KQ8A 3SASA 3L25A 3KW6A 2XLJA 2F5SA 3UGJA 1TH3A 4D82A 3TE6A 3FTEA 4GHLA 3KS4A 4DR7M 1XXHA 3AOEC 2XSZD 7CATA 1N77A 4AG5A 4DUZM 1HT1E 3IG5A 3PXGA 2HKJA 4M0DA 3GQ3A 3GRRA 2QCUA 1IY0A 1S3SA 4Z6YA 3FUWA 1DGHB 3FD9A 1NVMA 1Z6TA 3U6MA 3I4VA 3TPZA 5FLXS 4GC9A 3U5ZB 1X37A 3UK6A 3TWMA 4BB9A 2I7PA 3GP1A 2F5PA 2OPFA 4IBFA 1IN8A 2DXIA 3OTOM 4II7A 4Z8XA 1K3WA 5EP1A 1W5SA 1QYRA 3U6QA 4MGZE 1NY6A 1ZQ9A 3BOSA 1HQCA 2Y21A 4LF4M 3DFZA 4KO8A 1L1TA 4FWHA 3T15A 3GLGB 4B3TM 3AL0C 1ZAEA 3HHYA 1N33M 3T1YM 4KODA 4CISA 3L29A 1SXJC 2XEPA 2XFSA 3SYLA 4KLNA 4DR4M 3KVWA 3M0EA 1R2ZA 4RF1A 3K92A 4L78A 3FTFA 4GITA 1QAOA 5IWAM 4LGMA 4AKHA 3SAWA 3KS8A 2L6OA 2VIIA 3LMMA 1IN6A 3SHGB 4MB7A 4M9ZA 3DA1A 2M5ZA 2QBYB 4DV0M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZC7 B;  3ZCB B;  3SHG B; 
#chains in the Genus database with same CATH topology
 5KO3 A;  1DGF A;  3MHV C;  4JI0 M;  1N75 A;  1TH2 A;  1L1Z A;  3VFD A;  2ZAN A;  3TL4 X;  3Q8X A;  2V1U A;  3JR5 A;  1XHB A;  1E94 E;  4NOO B;  2HHH M;  2L7H A;  4DV5 M;  2LXE A;  4NRW A;  2QZ4 A;  4I8O A;  1N78 A;  2DWN A;  3I01 M;  5ITT A;  2HWJ A;  4OX9 M;  4IBK A;  3GLI B;  3HX3 A;  4Y28 F;  4OU7 A;  4LF7 M;  2CWB A;  4G3O A;  1DGH A;  2CEA A;  3C58 A;  4ITQ A;  3VDU A;  4JI7 M;  1IY1 A;  4XGI A;  1G4A E;  1L2C A;  1F4I A;  4GIP A;  2XF3 A;  1OQY A;  3PFI A;  1NJF A;  1GJS A;  3FTC A;  4ZPX A;  1ZMV A;  3A45 A;  2CP8 A;  3E4R A;  3HWS A;  1R2Y A;  2ZAM A;  2QEN A;  3D8B A;  3CF2 A;  1I4W A;  2QPA A;  1JR3 D;  2FS1 A;  3B7Q A;  3CGW A;  1VG5 A;  3HJ8 A;  3W68 A;  3PVS A;  4NL4 H;  3GPX A;  2N35 A;  4OVZ B;  3GLG A;  5EP2 A;  4LFC M;  2UXC M;  2E5L M;  4L16 A;  3WHL A;  1TDH A;  1G3I A;  4LJA A;  5EP3 A;  3WHK A;  1IY2 A;  3HGI A;  4IJE A;  2LNH C;  1OTR A;  3CF0 A;  2EJS A;  4ANR A;  2R44 A;  3SYK A;  4X62 M;  5BPV A;  1TH4 A;  3U61 A;  2BWE A;  3F92 A;  5KPR A;  3HJQ A;  2R45 A;  3VKH A;  2XSZ A;  3HU3 A;  2MGW A;  3A42 A;  4CGY B;  4JI4 M;  3IG8 A;  4FWG A;  3FKE A;  5EXS A;  3RGS A;  4IBG A;  2JY8 A;  1Z5B A;  2KW0 A;  3GLG E;  4X64 M;  2F4V M;  4AZF A;  4LG2 A;  4R7G A;  2X4A A;  1J5E M;  3HU2 A;  4LJ6 A;  3SHF A;  2UXB M;  3FYD A;  4IBC A;  4LRT A;  1PGY A;  4JI6 M;  1NNU C;  4LJ5 A;  4LJ4 A;  5JI2 E;  4D81 A;  3KOW E;  4LRS A;  4G4Q A;  3VK7 A;  3C3D A;  2KEB A;  3KOY E;  4QHS A;  2LHC A;  3R9X B;  3FUX A;  3M7G A;  4IBD A;  2JZ1 A;  3U6S A;  1GL6 A;  3ZH9 B;  1D0K A;  3A98 B;  3L26 A;  2D7H A;  3FYC A;  2YQZ A;  4I81 A;  4P17 A;  2OOB A;  2Z7J A;  4W5W A;  5DYI A;  4CJ6 A;  1XMO M;  4LF5 M;  3KOX E;  4MH0 E;  2KRU A;  3ILK A;  1IN5 A;  1Q39 A;  4NXN M;  3T1H M;  1C7Y A;  4IIW A;  3FTD A;  2CV1 A;  3KP1 E;  1YUB A;  2D7E A;  2OOA A;  1PJI A;  3SAV A;  1ORY B;  2Z4S A;  4B3S M;  1Q02 A;  4K0K M;  3HHW A;  4GKJ M;  5GKN A;  3J7B A;  2L4F A;  2KNZ A;  1N36 M;  2C9C A;  5ITX E;  1VEJ A;  2L7I A;  2H1R A;  2B3T A;  2LVO C;  4GH9 A;  1NHG C;  3GRV A;  1OAO C;  1IXS B;  1SG9 A;  4CIZ A;  3A46 A;  3U6E A;  1NNJ A;  2LVN C;  4G6Z A;  1GVN A;  2CHG A;  4QOZ C;  2Y20 A;  2JY7 A;  1DV0 A;  3H4M A;  3PNY A;  5FTL A;  4OVZ A;  2QP9 X;  4DR2 M;  4JN6 A;  2BWB A;  3U6O A;  4L15 A;  1R6B X;  5LMN M;  3I4Y A;  2K9D A;  5IRE B;  2V6Z M;  1K3X A;  1OJL A;  3W0L B;  1OFH A;  1IN4 A;  1R7R A;  2EUC A;  3B7Z A;  4DV2 M;  4LCB A;  3U6D A;  2KZS A;  4FCW A;  1L2B A;  1DO2 A;  3QAU A;  1JB0 F;  2C99 A;  1A5T A;  3SC3 A;  4NSR A;  3U6L A;  2CFO A;  1KYI A;  2O5R A;  2R62 A;  4P16 A;  4PD2 A;  5FSW A;  2JY6 B;  4WW0 A;  2M60 A;  3LW5 F;  3GPU A;  1QAQ A;  2CRU A;  3W67 A;  4B7F A;  1MN3 A;  4LFA M;  4MGH A;  3VK8 A;  2RGO A;  3SFZ A;  4DV6 M;  4FCV A;  2D7G A;  1JR3 A;  1QUT A;  3E9S A;  1LV7 A;  2JNH A;  2R4J A;  2EO2 A;  2QSF X;  4NC6 A;  1WJ7 A;  4CHT B;  3B7N A;  3FRI A;  2Z3X A;  2X8A A;  1UFZ A;  3SAR A;  4JV5 M;  3VKG A;  1JR3 E;  3AOG A;  4D80 A;  4DBG B;  4B3R M;  1GAB A;  3U60 B;  1QAM A;  4JI2 M;  2H5X A;  2KHH A;  4FD2 A;  3FUU A;  2F5N A;  4LF8 M;  8CAT A;  1TTE A;  3GPY A;  1Y8G A;  3GO8 A;  3M6A A;  1HNX M;  4LF6 M;  3H4J A;  2VF8 A;  1D2N A;  2KRK A;  4REZ A;  4F1I A;  3U5Z A;  1IM2 A;  2DWZ B;  2HAK A;  3EIH A;  3KSJ A;  3AJI B;  3FRH A;  4MGK E;  5ITY A;  2C5R A;  1P3Q Q;  1DO0 A;  3LCU A;  2VQF M;  4AKG A;  5FTJ A;  2R46 A;  5LMU M;  2DAE A;  1IBM M;  2AHM A;  4PT5 A;  1NSF A;  2JP7 A;  2CV2 A;  4IBJ A;  4DV1 M;  5EQT A;  4B08 A;  4JYA M;  2C96 A;  2DAG A;  1IXR C;  2GNO A;  4IBB A;  4MM3 B;  4PDI A;  3AKZ A;  1VDL A;  1ZMU A;  2KXE A;  2RKO A;  2BNK A;  3HU1 A;  2G3Q A;  3ZCB B;  5IT9 S;  1KFV A;  2W82 A;  3GRY A;  4M0W A;  1HT2 E;  3C3E A;  1XXH B;  4JI1 M;  2L09 A;  3U6C A;  1OIZ A;  5H37 D;  4DR6 M;  1TF0 B;  2CUZ A;  1JQJ C;  4LJ9 A;  1N34 M;  1WHC A;  3J80 S;  2L2D A;  1V92 A;  1IQP A;  3EIE A;  3TWK A;  4RNA A;  4GKK M;  1AIP C;  4B7G A;  3JR4 A;  2ZTD A;  1OFI A;  1G71 A;  4HEO A;  3CTW B;  2NQ8 C;  2QBY A;  3VLF B;  5IZ7 D;  2FE8 A;  3QYB A;  4LFB M;  2APL A;  2R6F A;  1NY5 A;  3KSX A;  4L8R C;  3GQ5 A;  4I5S A;  4QHT A;  1PM5 A;  1EE8 A;  2LTU A;  1NO1 A;  2JUJ A;  2LVA A;  5KQD A;  2ERC A;  3GQ4 A;  2DZL A;  5ITX A;  4WUR A;  1VEK A;  5KPT A;  4L6V 6;  3K2L A;  1FNN A;  3GLI A;  2JA2 A;  4QNM A;  2Y0T A;  3HHZ A;  4AKI A;  1E32 A;  2XZF A;  1NV8 A;  2J7O A;  4IBI A;  3GLH B;  4BBA A;  1R4G A;  2FH0 A;  3FUV A;  4AW4 A;  4G4O A;  4NSO B;  2J7N A;  3E46 A;  3SAT A;  2G8L A;  1I94 M;  4KHP M;  1QAN A;  4LJ8 A;  1XMQ M;  2LWX A;  1IBK M;  2LBC A;  2YR0 A;  1TGU A;  2R18 A;  2XH9 A;  2DZO B;  3I04 M;  1VEG A;  2C98 A;  3GLI E;  4DR1 M;  3L2A A;  1L2D A;  2OO9 A;  3FUT A;  3C9P A;  1PJJ A;  3AFH A;  2KDL A;  4AQY M;  3R8F A;  1NV9 A;  2O01 F;  3PNV A;  1EFU B;  1HNW M;  1IFY A;  1W5T A;  1VDD A;  1QDT A;  2G5G X;  2R4E A;  4JI5 M;  3DOA A;  1OKS A;  3B9P A;  1Z59 A;  4LF9 M;  2QHO B;  2GQF A;  3TWL A;  4FCT A;  4L4U A;  5BR8 M;  3RFW A;  2YFQ A;  4PDG A;  2EA0 A;  2I7N A;  2CHV A;  5FTK A;  4LGY A;  2Z8Y M;  1XB2 B;  2F5Q A;  1EIJ A;  2WSE F;  2XGN A;  1HNZ M;  2UUB M;  2VF7 A;  1H6U A;  3W0F A;  1WIV A;  1T3T A;  4S12 A;  3JAM S;  3J81 S;  1HR0 M;  1OAI A;  1QUS A;  1WXQ A;  2CE7 A;  3L27 A;  2MR9 A;  1SXJ D;  2DNA A;  5E26 A;  2UUA M;  3K9P A;  1C1K A;  2FOI C;  4QOS A;  1PJT A;  3K8Z A;  1G8P A;  3QYE A;  2JY5 A;  4MGY E;  3K1J A;  4YY3 M;  2DWM A;  4AI6 A;  2LVQ D;  1FJG M;  4G4R A;  1GL7 A;  4QNR A;  2UUC M;  2UXD M;  2O25 A;  2ZBK B;  5C18 A;  1Q3C A;  3KFU G;  2RRU A;  3NWL A;  1DGG A;  4GHA A;  3HKP A;  4RKU F;  4XBO A;  5JI3 E;  3UJN A;  1XWI A;  1ZMW A;  3AV0 A;  3LQQ A;  4GRI A;  4WP2 A;  2VQE M;  2DAM A;  5DFL A;  5F3W A;  2YNM D;  2JWS A;  3SBJ A;  1GLN A;  4LZZ A;  4IJF A;  1NHW C;  3IEC A;  4LJ7 A;  2K6B A;  3U61 B;  2JZ0 A;  4A3V B;  5EXT A;  4FWD A;  4NXM M;  1MX0 A;  1PJS A;  3FE3 A;  2EKK A;  4HLQ A;  2DVW B;  3GLH A;  3ZQJ A;  3IHP A;  1IBL M;  2LH0 A;  3U6P A;  1G59 A;  4NRV A;  1E9S A;  4FVM A;  3UMM A;  3HZJ A;  5ITQ A;  2ZM6 M;  1Z5A A;  2QNJ A;  4B3M M;  4IBE A;  2X49 A;  4DUY M;  1NJG A;  2KA6 B;  1IXS A;  5EXX A;  3GLF B;  1SXJ B;  2HCB A;  1J7K A;  5EP4 A;  2MH8 A;  5FTN A;  3RE8 A;  2MJ5 B;  4DV3 M;  2Y0Q A;  2CHQ A;  2XFT A;  1QZM A;  2A5Y B;  3LQR A;  1GJT A;  1QVR A;  2R65 A;  3GLH E;  1QQW A;  3MJ5 A;  4PCZ A;  4XK8 F;  4EIW A;  1V34 A;  1ZV1 A;  5EXP A;  2P5T A;  3I51 A;  2V1C A;  3THG A;  5EJC A;  5ITR A;  2ZAO A;  2OQ4 A;  4DR5 M;  3SMP A;  3KDS E;  2WZJ A;  3GRU A;  2DHR A;  4R3D A;  4MGI E;  2KNV A;  3QWL A;  3KXE C;  4HL4 A;  5E6J A;  3VDP A;  2K47 A;  4GMQ A;  4JI8 M;  2DEN A;  3SMS A;  1DGB A;  2RGH A;  4FW9 A;  1KSF X;  3E21 A;  4JI3 M;  3J7A S;  2ZTC A;  3LVV A;  1D0L A;  1N32 M;  1PRB A;  3LVW A;  4YHH M;  1BVS A;  1QZE A;  5FTM A;  3AOE A;  3B74 A;  3V76 A;  4BLC A;  2C9O A;  2BJW A;  3NBI A;  2HL7 A;  1L8Q A;  2FFJ A;  1HQY E;  2DI0 A;  1YE9 A;  4B7H A;  3BBZ A;  2VDB B;  2R0I A;  3J27 B;  3L28 A;  4G4N A;  1TR8 A;  1IN7 A;  1GKI A;  4JXJ A;  3TQS A;  4DV7 M;  2UU9 M;  1LTM A;  4GC5 A;  1TDZ A;  2WSC F;  2EKF A;  4M9X A;  1YSY A;  2F5O A;  2XZU A;  2KNA A;  4DV4 M;  1HJP A;  2JXN A;  4Q7J A;  3Q8G A;  2CV0 A;  3CF6 E;  1MJG M;  3MMP A;  3DZD A;  4LY6 A;  3HHX A;  3KOZ E;  2FNA A;  2DZN B;  1Q3B A;  5C1B A;  2WSF F;  1WGL A;  1RU3 A;  5DNY A;  1XC8 A;  1V33 A;  1Z5C A;  2DAI A;  2Q2E B;  3U60 A;  1XNQ M;  3J2P B;  1R5L A;  3UZU A;  1CUK A;  3GLF A;  1SXJ A;  3BXW A;  4RF0 A;  2DWL A;  2L4E A;  4R71 A;  5A2Q S;  1YLA A;  2Z4R A;  4UN2 B;  5ITU A;  4F2L A;  1UM8 A;  3GPP A;  5DYG A;  3T38 A;  5KPZ A;  3HJS A;  3KP0 E;  1IXZ A;  4DR3 M;  4X65 M;  2LHG A;  2KZU A;  3SAU A;  1XNR M;  3RGP A;  4KT0 F;  4I4L A;  1J09 A;  1WR1 B;  3MK6 A;  1G41 A;  1E9R A;  3ZC7 B;  4X66 M;  1K82 A;  3GLF E;  1SXJ E;  2K0B X;  4LZJ A;  4AG6 A;  4OW0 A;  4TUW A;  1AUA A;  3D8L A;  3NBX X;  4M9S A;  1MU5 A;  2BJV A;  2LVP C;  5KQ8 A;  3SAS A;  3KW6 A;  2XLJ A;  2F5S A;  3UGJ A;  3L25 A;  1TH3 A;  1D0M A;  4D82 A;  2MRO B;  3TE6 A;  3FTE A;  4GHL A;  3KS4 A;  3LCV B;  4DR7 M;  1XXH A;  3AOE C;  2XSZ D;  7CAT A;  1N77 A;  4AG5 A;  4DUZ M;  1HT1 E;  3IG5 A;  3PXG A;  3B89 A;  2HKJ A;  4M0D A;  1QDR A;  3GRR A;  2QCU A;  1IY0 A;  1S3S A;  3HY5 A;  4Z6Y A;  3GQ3 A;  3FUW A;  1DGH B;  3FD9 A;  1NVM A;  1Z6T A;  3U6M A;  3I4V A;  3TPZ A;  5FLX S;  4GC9 A;  3U5Z B;  1X37 A;  3UK6 A;  3TWM A;  4BB9 A;  2I7P A;  3GP1 A;  2F5P A;  1XXH E;  2OPF A;  4IBF A;  1IN8 A;  2DXI A;  3OTO M;  4II7 A;  4Z8X A;  1K3W A;  5EP1 A;  1W5S A;  1QYR A;  3U6Q A;  4MGZ E;  1NY6 A;  1ZQ9 A;  3BOS A;  1VQ1 A;  1HQC A;  1GO5 A;  2Y21 A;  4LF4 M;  3K9O A;  3DFZ A;  4KO8 A;  5L8R F;  1L1T A;  4FWH A;  3T15 A;  3GLG B;  4B3T M;  3AL0 C;  1ZAE A;  3HHY A;  1N33 M;  3T1Y M;  4KOD A;  4CIS A;  1T43 A;  3L29 A;  1OIP A;  2J5Y A;  2QQ8 A;  1SXJ C;  2XEP A;  2XFS A;  3SYL A;  3T6P A;  2DAK A;  4KLN A;  4DR4 M;  3KVW A;  3M0E A;  1R2Z A;  1T6O A;  3K92 A;  4RF1 A;  4L78 A;  3FTF A;  4GIT A;  1QAO A;  2DHY A;  2DKL A;  4LGM A;  5IWA M;  4AKH A;  1WGN A;  3SAW A;  3KS8 A;  2L6O A;  2VII A;  3LMM A;  4GEW A;  1IN6 A;  3SHG B;  4MB7 A;  4M9Z A;  1PJQ A;  3DA1 A;  2M5Z A;  2QBY B;  4DV0 M; 
#chains in the Genus database with same CATH homology
 5KO3 A;  1DGF A;  3MHV C;  4JI0 M;  1N75 A;  1TH2 A;  1L1Z A;  3VFD A;  2ZAN A;  3TL4 X;  3Q8X A;  2V1U A;  3JR5 A;  1XHB A;  1E94 E;  4NOO B;  2HHH M;  2L7H A;  4DV5 M;  2LXE A;  4NRW A;  2QZ4 A;  4I8O A;  1N78 A;  2DWN A;  5ITT A;  4OX9 M;  4IBK A;  3GLI B;  4OU7 A;  4LF7 M;  4ITQ A;  3C58 A;  1DGH A;  2CEA A;  3VDU A;  4JI7 M;  1IY1 A;  4XGI A;  1G4A E;  1L2C A;  4GIP A;  2XF3 A;  3PFI A;  1NJF A;  3FTC A;  4ZPX A;  3A45 A;  3E4R A;  3HWS A;  1R2Y A;  2ZAM A;  2QEN A;  3D8B A;  3CF2 A;  1I4W A;  2QPA A;  1JR3 D;  3HJ8 A;  3PVS A;  4NL4 H;  3GPX A;  4OVZ B;  3GLG A;  4LFC M;  5EP2 A;  2UXC M;  2E5L M;  4L16 A;  3WHL A;  1TDH A;  1G3I A;  4LJA A;  5EP3 A;  3WHK A;  1IY2 A;  3HGI A;  4IJE A;  2LNH C;  3CF0 A;  4X62 M;  3U61 A;  3SYK A;  5BPV A;  1TH4 A;  5KPR A;  3HJQ A;  2R45 A;  3VKH A;  2XSZ A;  3HU3 A;  3A42 A;  4CGY B;  4JI4 M;  3IG8 A;  4FWG A;  3FKE A;  5EXS A;  3RGS A;  4IBG A;  1Z5B A;  2KW0 A;  4X64 M;  2F4V M;  4AZF A;  4LG2 A;  4R7G A;  2X4A A;  1J5E M;  3HU2 A;  4LJ6 A;  3SHF A;  2UXB M;  3FYD A;  4IBC A;  4LRT A;  4JI6 M;  1NNU C;  4LJ5 A;  4LJ4 A;  5JI2 E;  4D81 A;  3KOW E;  4LRS A;  4G4Q A;  3VK7 A;  2KEB A;  3KOY E;  4QHS A;  3R9X B;  3FUX A;  3M7G A;  4IBD A;  3U6S A;  1GL6 A;  3ZH9 B;  2UU9 M;  3A98 B;  3L26 A;  2D7H A;  3FYC A;  2YQZ A;  4I81 A;  5DYI A;  2Z7J A;  1XMO M;  4W5W A;  4LF5 M;  3KOX E;  4MH0 E;  2KRU A;  3ILK A;  1IN5 A;  1Q39 A;  4NXN M;  3T1H M;  4IIW A;  3FTD A;  2CV1 A;  3KP1 E;  1YUB A;  2D7E A;  1PJI A;  4K0K M;  3SAV A;  1ORY B;  2Z4S A;  4B3S M;  3HHW A;  4GKJ M;  5GKN A;  3J7B A;  1N36 M;  2C9C A;  5ITX E;  2L7I A;  2H1R A;  4GH9 A;  1NHG C;  3GRV A;  3U6E A;  1IXS B;  3A46 A;  1NNJ A;  4G6Z A;  1GVN A;  2CHG A;  4QOZ C;  2Y20 A;  3H4M A;  3PNY A;  5FTL A;  4OVZ A;  2QP9 X;  4DR2 M;  4JN6 A;  3U6O A;  4L15 A;  1R6B X;  5LMN M;  3I4Y A;  5IRE B;  2V6Z M;  1K3X A;  1OJL A;  3W0L B;  1OFH A;  1IN4 A;  1R7R A;  2EUC A;  4DV2 M;  4LCB A;  3U6D A;  2KZS A;  4FCW A;  1L2B A;  1DO2 A;  3QAU A;  2C99 A;  3SC3 A;  4NSR A;  3U6L A;  2CFO A;  1KYI A;  2O5R A;  2R62 A;  4P16 A;  4PD2 A;  5FSW A;  4WW0 A;  2M60 A;  3GPU A;  1QAQ A;  4B7F A;  4LFA M;  4MGH A;  3VK8 A;  2RGO A;  3SFZ A;  4DV6 M;  4FCV A;  2D7G A;  1JR3 A;  3E9S A;  1LV7 A;  2R4J A;  2EO2 A;  4CHT B;  2Z3X A;  2X8A A;  3SAR A;  4JV5 M;  3VKG A;  3AOG A;  4D80 A;  4B3R M;  3U60 B;  1QAM A;  4JI2 M;  4FD2 A;  3FUU A;  2F5N A;  4LF8 M;  8CAT A;  3GPY A;  3GO8 A;  3M6A A;  1HNX M;  4LF6 M;  4REZ A;  1D2N A;  2KRK A;  3U5Z A;  1IM2 A;  2DWZ B;  3EIH A;  3KSJ A;  5ITY A;  3AJI B;  4MGK E;  2C5R A;  4AKG A;  2VQF M;  1DO0 A;  5FTJ A;  2R46 A;  5LMU M;  1IBM M;  2AHM A;  4PT5 A;  1NSF A;  2CV2 A;  4IBJ A;  4DV1 M;  5EQT A;  4B08 A;  4JYA M;  2C96 A;  1IXR C;  4IBB A;  4MM3 B;  3AKZ A;  4PDI A;  2KXE A;  2RKO A;  3HU1 A;  2BNK A;  3ZCB B;  5IT9 S;  1KFV A;  2W82 A;  3GRY A;  4M0W A;  1HT2 E;  1XXH B;  4JI1 M;  2L09 A;  3U6C A;  5H37 D;  4DR6 M;  2CUZ A;  1JQJ C;  4LJ9 A;  1N34 M;  3J80 S;  1IQP A;  3EIE A;  3TWK A;  4RNA A;  4GKK M;  4B7G A;  3JR4 A;  1OFI A;  3CTW B;  2NQ8 C;  2QBY A;  3VLF B;  5IZ7 D;  2FE8 A;  4LFB M;  1NY5 A;  3KSX A;  4L8R C;  3GQ5 A;  4I5S A;  4QHT A;  1PM5 A;  1EE8 A;  5KQD A;  2ERC A;  3GQ4 A;  5ITX A;  4WUR A;  5KPT A;  3K2L A;  1FNN A;  3GLI A;  2JA2 A;  4QNM A;  2Y0T A;  3HHZ A;  4AKI A;  1E32 A;  2XZF A;  2J7O A;  4IBI A;  3GLH B;  4BBA A;  3FUV A;  4AW4 A;  3SAT A;  4G4O A;  4NSO B;  2J7N A;  2G8L A;  1I94 M;  4KHP M;  1QAN A;  4LJ8 A;  1XMQ M;  2LWX A;  1IBK M;  2YR0 A;  1TGU A;  2R18 A;  2XH9 A;  2DZO B;  2C98 A;  4DR1 M;  3L2A A;  1L2D A;  3FUT A;  1PJJ A;  3AFH A;  4AQY M;  3R8F A;  3PNV A;  1HNW M;  1W5T A;  1VDD A;  2G5G X;  2R4E A;  4JI5 M;  3DOA A;  3B9P A;  1Z59 A;  4LF9 M;  3TWL A;  4FCT A;  4L4U A;  5BR8 M;  3RFW A;  2YFQ A;  4PDG A;  2EA0 A;  2I7N A;  2CHV A;  5FTK A;  4LGY A;  2F5Q A;  2XGN A;  1HNZ M;  2UUB M;  1H6U A;  3W0F A;  1T3T A;  4S12 A;  3JAM S;  3J81 S;  1HR0 M;  1WXQ A;  2CE7 A;  3L27 A;  1SXJ D;  5E26 A;  2UUA M;  1C1K A;  2FOI C;  4QOS A;  3K8Z A;  1G8P A;  4MGY E;  2DWM A;  3K1J A;  4YY3 M;  4AI6 A;  1FJG M;  4G4R A;  1GL7 A;  4QNR A;  2UUC M;  2UXD M;  5C18 A;  2ZBK B;  1Q3C A;  3KFU G;  3NWL A;  1DGG A;  4GHA A;  3HKP A;  4XBO A;  5JI3 E;  3UJN A;  1XWI A;  3AV0 A;  3LQQ A;  4GRI A;  2VQE M;  5F3W A;  2YNM D;  3SBJ A;  1GLN A;  4LZZ A;  4IJF A;  1NHW C;  4LJ7 A;  3U61 B;  4A3V B;  5EXT A;  4FWD A;  4NXM M;  1MX0 A;  4HLQ A;  2DVW B;  3GLH A;  1IBL M;  2LH0 A;  3U6P A;  1G59 A;  4NRV A;  1E9S A;  4FVM A;  3UMM A;  5ITQ A;  2ZM6 M;  1Z5A A;  4B3M M;  4IBE A;  2X49 A;  4DUY M;  1NJG A;  2KA6 B;  5EXX A;  3GLF B;  1SXJ B;  2HCB A;  1J7K A;  5EP4 A;  5FTN A;  3RE8 A;  4DV3 M;  2Y0Q A;  2CHQ A;  2XFT A;  1QZM A;  2A5Y B;  3LQR A;  1QVR A;  2R65 A;  3MJ5 A;  4PCZ A;  1QQW A;  4EIW A;  5EXP A;  2P5T A;  3I51 A;  2V1C A;  3THG A;  5EJC A;  5ITR A;  2ZAO A;  2OQ4 A;  4DR5 M;  3SMP A;  3KDS E;  3GRU A;  2DHR A;  4R3D A;  4MGI E;  3QWL A;  3KXE C;  4HL4 A;  5E6J A;  3VDP A;  2K47 A;  4GMQ A;  4JI8 M;  3SMS A;  1DGB A;  2RGH A;  4FW9 A;  1KSF X;  4JI3 M;  3J7A S;  3LVV A;  1N32 M;  4YHH M;  3LVW A;  5FTM A;  3AOE A;  4BLC A;  2C9O A;  2BJW A;  3NBI A;  2HL7 A;  1L8Q A;  2FFJ A;  1HQY E;  4B7H A;  1YE9 A;  3J27 B;  3L28 A;  4G4N A;  1IN7 A;  1GKI A;  4JXJ A;  3TQS A;  4DV7 M;  4GC5 A;  1TDZ A;  4M9X A;  1YSY A;  2F5O A;  2XZU A;  4DV4 M;  2CV0 A;  3CF6 E;  4LY6 A;  3DZD A;  3HHX A;  3KOZ E;  2FNA A;  2DZN B;  1Q3B A;  5C1B A;  5DNY A;  1XC8 A;  1Z5C A;  3U60 A;  2Q2E B;  1XNQ M;  3J2P B;  3UZU A;  3GLF A;  1SXJ A;  4RF0 A;  2DWL A;  5A2Q S;  2Z4R A;  5ITU A;  3GPP A;  1UM8 A;  5DYG A;  3T38 A;  5KPZ A;  3HJS A;  3KP0 E;  1IXZ A;  4DR3 M;  4X65 M;  3SAU A;  2KZU A;  1XNR M;  3RGP A;  4I4L A;  1J09 A;  3MK6 A;  1G41 A;  1E9R A;  3ZC7 B;  4X66 M;  1K82 A;  4TUW A;  1SXJ E;  4LZJ A;  4AG6 A;  4OW0 A;  3D8L A;  4M9S A;  1MU5 A;  2BJV A;  5KQ8 A;  3SAS A;  3L25 A;  3KW6 A;  2XLJ A;  2F5S A;  3UGJ A;  1TH3 A;  4D82 A;  3TE6 A;  3FTE A;  4GHL A;  3KS4 A;  4DR7 M;  1XXH A;  3AOE C;  2XSZ D;  7CAT A;  1N77 A;  4AG5 A;  4DUZ M;  1HT1 E;  3IG5 A;  3PXG A;  2HKJ A;  4M0D A;  3GQ3 A;  3GRR A;  2QCU A;  1IY0 A;  1S3S A;  4Z6Y A;  3FUW A;  1DGH B;  3FD9 A;  1NVM A;  1Z6T A;  3U6M A;  3I4V A;  3TPZ A;  5FLX S;  4GC9 A;  3U5Z B;  1X37 A;  3UK6 A;  3TWM A;  4BB9 A;  2I7P A;  3GP1 A;  2F5P A;  2OPF A;  4IBF A;  1IN8 A;  2DXI A;  3OTO M;  4II7 A;  4Z8X A;  1K3W A;  5EP1 A;  1W5S A;  1QYR A;  3U6Q A;  4MGZ E;  1NY6 A;  1ZQ9 A;  3BOS A;  1HQC A;  2Y21 A;  4LF4 M;  3DFZ A;  4KO8 A;  1L1T A;  4FWH A;  3T15 A;  3GLG B;  4B3T M;  3AL0 C;  1ZAE A;  3HHY A;  1N33 M;  3T1Y M;  4KOD A;  4CIS A;  3L29 A;  1SXJ C;  2XEP A;  2XFS A;  3SYL A;  4KLN A;  4DR4 M;  3KVW A;  3M0E A;  1R2Z A;  4RF1 A;  3K92 A;  4L78 A;  3FTF A;  4GIT A;  1QAO A;  5IWA M;  4LGM A;  4AKH A;  3SAW A;  3KS8 A;  2L6O A;  2VII A;  3LMM A;  1IN6 A;  3SHG B;  4MB7 A;  4M9Z A;  3DA1 A;  2M5Z A;  2QBY B;  4DV0 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...