3SI5A

Kinetochore-bubr1 kinase complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
152
structure length
152
Chain Sequence
TGSQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Blinkin-BUBR1 Complex Reveals an Interaction Crucial for Kinetochore-Mitotic Checkpoint Regulation via an Unanticipated Binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
total genus 64
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08311 Mad3_BUB1_I Mad3/BUB1 homology region 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.430 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3si5A00
4AEZC 4A1GA 3SI5A 2LAHA 2WVIA
chains in the Genus database with same CATH superfamily
4M7CA 4PS8A 5LX8A 4K03A 1N0RA 3NOCD 4MBGA 4Q94A 3D9PA 2BTDA 4B8CB 3JQ1A 2PL2A 1E96B 4XEIG 2PM6A 5ENRD 2WXPA 4YVQC 5M72A 3UQ3A 5EYLA 5B3SE 4UQXA 5HRYA 4JXTA 4DK5A 2KCLA 2R02A 4CCAA 4KVMA 5FQ4A 1K1BA 3FHEA 2DIWA 3CVQA 3VLFA 5JJ6A 4JA7A 4H7XA 3PE4A 1K3ZD 2F37A 1W3BA 4GZ6A 4BTBA 3TWWA 2V5QC 4JA9A 4MLPA 5CECB 3D9JA 5FZRA 3SBTB 1OCOE 1JCRA 1Y8MA 2BEDA 2PQRA 3U4TA 3AJIA 5KJLA 4J8FA 1N94A 5CMWA 4N5CA 4ACKA 5KNGA 4LEUA 4M3OA 4UQZA 2XS1A 4FJZA 3QC1A 4TXPA 1TR4A 2J4DA 1MJ0A 1KT1A 4K5CA 3HHMA 4LNUD 1RW2A 2VJ8A 4QFVA 3F6QA 1HXIA 2EQXA 3ASDA 4KBQA 4F7AA 3ULEG 5J08A 1K8KG 1INZA 2YHEA 3O48A 2Y4UA 1N11A 4Y6CA 2WXJA 4IYPA 2WXMA 4AOFA 2OVFA 4XE0A 3NOGD 4RVBA 2VTBA 1OWLA 3AAAC 4N3AA 3D9KA 3UINC 4AP2A 2C0LA 1MX6A 4AJWA 4RLYA 3EHQA 1LD7A 2WQHA 4E6HA 1QNFA 2IQCA 4A1SA 4B0ZA 4WWPA 2L0IA 1UW4B 1V54E 2R5SA 4FULA 3HG0D 5KWDA 3APFA 3NQPA 2H6FA 2Y4TA 2DZOA 1X5BA 5BXOA 3PE3A 3ENEA 5CERB 3TL5A 2Q7FA 3C98A 3L6AA 4WNFA 3DEOA 3CVPA 3D9LA 3DXKG 3R7QA 4DLQA 2VYIA 3QOUA 1BI7B 4IRUA 3TWXA 3U66A 2ZGDA 3SF4A 1QZ2A 5LP0A 3NAWA 2QYJA 3HRAA 4ANWA 3DSSA 3RSEG 1DNPA 5E76A 3UX4A 4CDNA 4EHMA 3ZGQA 3HYMB 5E75A 3IKOB 4GYYA 3PH0C 3ZNGA 4L2YA 3ZW3A 2WXNA 1N4SA 2Y0BG 4HFGA 4NQ0A 4JD2G 4GZ3A 2V4HC 4GTVA 3KSQA 2AXZA 4ME2A 3HXFA 4I6GA 4ANUA 4U63A 3B7BA 2IO3C 2X38A 3L22A 4AEZC 4OVVA 1JCQA 3HXEA 4JEUA 4XKCA 3CIAA 4CDRA 4GA0A 2XHEA 1DVPA 2ZU6B 5FQ6A 3UT8A 5AQ7A 1VDYA 5EIDA 4FJYA 2GGFA 1E8ZA 3T9KA 4HLEA 2VQ2A 3PREA 1K1AA 5ANRA 5FINA 3FTYA 3NZUA 4KXKB 2B0OE 4F1PA 5ENSD 2HM8A 3BG1B 1TNBA 2XRYA 3SQVA 3U64A 4I9EA 3PZ4A 4XI0A 3FUMA 4KZ0A 4HNAD 2HR2A 1E90A 3KD7A 1E7UA 5EX0A 3PRZA 2ILRA 4G11A 2IFUA 4J6IA 2GRMA 4HOTA 3ESLA 4PS3A 3BUAA 5J90A 4DI3A 4EZJA 4GCNA 2VGYA 2FO1E 2A5EA 2LAIA 4DX1A 2IOSA 3DSXA 1WM5A 1NP7A 5FT9A 4J0UA 4XZ4A 3FU3A 4C9BB 3E34A 4GPKA 1L5JA 1QYMA 2Y69E 3CVLA 1KLXA 4DLOA 4GMLA 4DX5D 3TWTA 1ZB1A 1PY1A 4G24A 2KBXA 1HG2A 4UUCA 3DEPA 3QWVA 3DSWA 2KCVA 1TYQG 3D3MA 3ULQA 3UIOC 2HYZA 4GTTA 3KAEA 1Z5SC 2AVPA 3EHRA 4NRHB 1TNOA 1EDUA 4WUYA 2NYJA 5FQ7A 2RFAA 2WM9A 5LOZA 2GW1A 5HQ8A 4GTOA 2GRLA 2FULA 2XEHA 5BV1A 4CEMA 3LJNA 2XZDG 4IULA 3C5RA 4LERA 3RKVA 4ILGA 4R7LA 2X6HA 3SHFA 3ZFWA 3RRMB 2MYOA 4CYMD 3ONLA 4JW1A 3MA5A 4N3CA 2MHKA 1N52A 3LDZA 4XX5A 4ABNA 1Z3YA 2J09A 1JUQA 2WXRA 3FTWA 3RAUA 4C0MA 2GRPB 4A3TA 5KJKA 3EU5A 3S2AA 1NI1A 1JPLA 3G2VA 3ZYLA 3LEWA 5JJ7A 4G8KA 3NZSA 4JEHA 3AU4A 3FUEA 2QY7A 3PUJA 3RJVA 3PNLB 4BT8A 4I6JA 2NSZA 1X81A 2X6JA 5G04C 1N54A 3MEKA 2WVIA 4J7WA 2A5UA 2YHCA 3UKUG 2WXHA 2EINE 4DJAA 5G04J 3V31A 3FUDA 5D66A 1NZNA 5JHAA 5D0OD 2X6KA 3FTSA 3FUHA 3PZDA 3DRAA 5T3RA 2LNIA 1MX2A 3P2BA 2WXLA 4CGWA 5AN8A 4K5BA 1FVHA 3RRUA 3SFZA 4BSXA 4DUIA 2KCKA 2YINA 3R7RA 4URKA 2OCCE 1H6OA 1LTXA 4F3VA 5D2MC 5EYPF 1TN7A 4N2SA 2CG2A 1ELKA 1BLXB 4CT4A 4FLHA 3I4RB 3KEAA 2IONA 4CDMA 2P2CP 3AS4A 2QZAA 3RO2A 5AJLA 1Z6TA 3E30A 2FBNA 4L7TA 4MKTA 4G25A 2BUGA 3SY2A 1OCCE 2GROB 4F6RD 4BEPA 4U04A 1WDYA 2JEKA 2Y1LE 5C1DA 3NF1A 1A5EA 5LCWJ 2WXOA 3TAXA 2PQNA 1U3DA 2GRQB 4J8YA 3ZPJA 1N9AA 3QKYA 5LCWC 3TG5A 2CFUA 3VTXA 1V55E 3ASNE 4HS2A 2ETCA 1P5QA 2BKKB 3UXGA 4L23A 2DWZA 1IHBA 3FH5A 1ELRA 3HXDA 1LF8A 4FA6A 3DXMG 3TWSA 4JHRA 1O5MA 4JHKA 3VLEA 3PZ1A 4JC8A 2R03A 2R17C 3B7TA 4HOSA 3RK6A 1HO8A 2X6IA 3C3QA 3TXNA 3UM3A 4N39A 1N4QA 2KXPC 2NC9A 2VSOE 4HI8A 4LUNU 5BNWA 1H6PA 3ZYQA 3Q5MA 3E32A 2WMOA 4I9CA 2VSXE 1PC2A 2E2EA 5C2YA 3L9TA 4Q69A 5AYWD 5BV0A 2IOLA 3Q75A 2DVWA 2CHXA 2F8XK 3SI5A 3B7SA 3PEVB 4HXIA 1N95A 2KC7A 1SZAA 3T5XA 4GCOA 2WXGA 2ONDA 4UWFA 3TWQA 4U0UA 5DIZA 3CHMA 3T8MA 3JXJA 1E8XA 3QWWA 4HRNA 2XGSA 3MV2B 4L1BA 4WNGA 4JVSA 3K9IA 3L13A 3S7BA 3MV3B 3FTUA 4UQYA 5EIBE 4HBDA 3NB2A 3QWPA 3NBNB 5HKPA 2P9NG 3JUIA 4AVXA 4XI9A 3ZUVB 4B94A 3CVYA 2XENA 4EZKA 1H6KA 3HXBA 5DBKA 4BX9A 4C0EA 3CKBA 3PDNA 4BSZB 3FEXA 1BPOA 3GW4A 1NL4A 4EECA 3CHRA 4DX7D 1TJFA 5ITZF 2EIKE 3IBEA 4PH4B 4FU3A 4BETA 3LY9A 4NIKA 3FUIA 5BUZA 4J8SA 4HOQA 4N2QA 2EILE 4HORA 4RG9A 4ANVA 4C48B 3G2TA 3R9MA 4HRMB 3B7UX 3LJ3A 1TN8A 4AXHA 5B1AE 4BFRA 1FVFA 1ZU2A 1IKND 4EQFA 2Y3AA 4LRZA 3G2UA 3ZN3A 3U3WA 2L9BA 5HS0A 4GZ5A 3UMVA 3W9GA 1D9SA 3C3RA 4K0RA 1MX4A 3FU6A 2A4ZA 4TUUA 1A17A 3FY4A 3E4BA 4O60A 3JYSA 3AU5A 1IYGA 4O1OA 5CEDB 2PM7A 2IF4A 3L16A 5CCMA 1WAO1 2J49A 4U95D 3TJPA 3TGOA 1YCSB 2I2OA 4ZHBA 3MX3A 5KNHD 5KJNA 2V4LA 3PNTB 5FZQA 2X6FA 2BF0X 3TXMA 4BX8A 3SD5A 3CKCA 3AS8A 3MKRA 3Q73A 1YA0A 2V5FA 4RSYA 3FDHA 5FTPA 2L6JA 3B7RL 2HO1A 2DYRE 3LPZA 2ZGGA 3EHNA 1N4PA 4FP7A 4JHJA 3E37A 3KS2A 4UWGA 5FJYA 5JJTA 3V2OA 2RD0A 4AV7A 1H2UA 4GB9A 4EBAG 2V8SE 3SBSA 1U3CA 3J5PA 3UKRG 2HE0A 4ACLA 3G2SA 4L9PA 4GTQA 1TNZA 3I4GA 1TNYA 5CCLA 1YYHA 2LXMA 4K5AB 3HVEB 1E7VA 3OXLA 4Z68A 4OYSA 4OAVB 3OTNA 1LD8A 3PZ3A 2B6CA 2YQ8A 3AS5A 1HS6A 3SFXA 4U0SA 3QARA 1D8DA 3D9NA 2KZTA 3MZLB 4PUCA 1OXJA 1XGWA 1FT1A 4WWOA 4FHKA 1OWPA 3CQCB 3LCAA 2LXLA 1WY6A 1Q2ZA 4HLLA 5EN5D 1NA0A 3DSTA 3Q49B 2XPYA 3CGHA 3FP3A 1O1TA 4TRQA 4XIFA 3FULA 4I1OB 4NURA 4TUMA 1Z3XA 5AQBA 2F8YA 1UJJA 1SW6A 2OEWA 5KCMA 1HF8A 3RO3A 2LSUA 2X3MA 4RG6A 2VSYA 4A63B 4KT6B 1S70B 3ASFA 4AIFA 2WXQA 4ANXA 3HIZA 2P9KG 4RQIA 4ZFHA 5AARA 2DBAA 2XPIA 3EDTB 2AJAA 2P9LG 4DPRA 3FH8A 5FZSA 4GU5A 3LYAA 3ZEFA 5BXUA 4E85A 3N71A 4W9RA 3B95A 4AY5A 4G8LA 2RFMA 4B93B 5A6CA 1H19A 2XEEA 1MHQA 4EZLA 2WXKA 1UG3A 4OVUA 4G2VA 4ATGA 3V2XA 3EU9A 5IY5E 4I2WA 5EX3A 4KZCA 3WXXA 3Q9NC 1XNFA 3EHMA 3EIJA 2LAHA 1N4RA 1Y6IA 4DI4A 4A3VA 5AQAA 4U8VD 2C0MA 1H2VC 3MKQA 2UY1A 3V30A 4V3IA 1KPSB 4CZ2D 3S7FA 3UT7A 2XS8A 3ZYMA 3ZIMA 2ZISA 5FIOA 3MKQB 3BG0B 4DX6D 1SVXA 3MYVA 5LFAA 3CK7A 3LXUX 3CVUA 1TJCA 1G3NB 2JLBA 4O1PA 3AG2E 2VSNA 3J5QB 4OAUC 3ZXSA 3CVVA 2EIME 4G26A 2OV8A 3U9WA 3UT4A 1SA4A 4U8YD 4H7YA 3BU8A 4JL0A 4TV3A 1SQMA 4TXRA 5BW8C 4HOUA 1OT8A 3FWVA 3UM1A 2WQ7A 2UY1B 4F53A 1GW6A 3T5VA 4AM9A 2PZIA 4IN3B 4DRXE 1D8EA 4UWKA 5CBOA 4UI9C 3W9FA 3FTZA 3CQGB 1O1SA 4GAAA 1HZ4A 3IV0A 3Q78A 4FADA 3LY8A 5ENTD 4GTRA 3QK0A 2FI7A 3CSTA 3C3OA 4YDYA 3LKUA 1RZ4A 2WPVA 3FTVA 4Q96A 3TG4A 3FUJA 5ANLA 1U2VG 5H7PA 2WQ6A 3Q9UC 3ZKJA 2EIJE 4PDXA 4CRWA 5T8IA 3ISMC 5G2NA 5T4YA 1E8WA 3CVWA 3UM0A 2H6GA 3LVQE 1SA5A 1HFAA 1YMPA 4YVOA 2R59A 3ZHEA 4CT0A 3IHVA 2QFCA 3PVLA 3O4ZA 2AW6A 1JWFA 3FUFA 5A7DB 3VTYA 1JWGA 1B89A 3FEYA 4WNDA 2WXIA 3QB2A 3X2QE 1KZPA 3UM2A 3Q47B 5ENPD 3FU5A 4B89A 3DWLG 5EILA 4U0ZA 2F0YA 3ASOE 4BT9A 4L2LA 3D9OA 2H6HA 4GTPA 2VGEA 2J07A 5BT1A 2CG3A 1N0QA 3MJWA 4BTAA 5AQ9A 2QC9A 5AAOA 5CRUA 2P9UG 3DBSA 5G05J 4FHJA 4HI9A 3AG4E 2CFZA 4GMRA 2FO7A 4LSZE 3ULYA 4I43A 1IQUA 3GZ1A 1BD8A 3JQ0A 1H2TC 3DPYA 2RKKA 1MZCA 5CMYA 5KJMA 4BESA 1NA3A 4LNBA 2J8SD 3APCA 5G55A 1OUVA 2P9IG 2XCBA 1ELWA 2FF4A 4HVBA 4N5QA 2AWIA 5AENA 2FEZA 4DX2A 3ABLE 4FC8A 5G05C 1S63A 2CHWA 5HI7A 4CGVA 3ASHA 3V79K 3KSLA 3Q15A 2OOEA 3L17A 5JA4D 2LO6A 4GYWA 1AWCB 4MRUA 1OCZE 4BWRA 3DPDA 5CBNA 2XEVA 3GZ2A 3CEQA 4I1AA 2KZTB 4NACA 3ZVVA 2ETAA 3CV0A 3BQOA 3ZU7B 2GRRB 3CHSA 3OAWA 1S64A 4LG6A 3R9AB 5B1BE 5ARFA 4GTSA 4JB8P 4U8HA 4KYOB 4GA1A 1E8YA 3LVRE 4Y6WA 3LY7A 1DCEA 2E0IA 2VTBB 3ML9A 3RRNB 2M63A 3ABME 5A23A 4LCTA 2XGMA 1HG5A 2AXUA 3FU0A 3KEZA 2AXVA 3FTXA 2IO2C 3LS8A 4N3BA 3CVNA 4KVOA 2XRZA 2I9CA 1WG0A 3G2WA 4G23A 1MQSA 2C2LA 2VGXB 2P58C 3ZYKA 3PUKA 4B8AA 4KMOA 3E33A 3URZA 1FPPA 3IXEA 2H6IA 1MYOA 2XGOA 4G1TA 2PNNA 5AJDA 2IY0C 3L08A 1IXVA 4GZCA 3TWUA 3QAQA 3JCKC 2I1JA 4I6EA 3CK9A 1EF1C 4WNEA 5EDSA 3S7JA 3P1UA 4MS6A 5CEAA 2J9QA 3CSFA 4LNGA 2I1KA 2ZIRA 5D0QD 4U07A 1TNUA 1SZ9A 3FH7A 3UPVA 2XPZA 3SNXA 4HB5A 4BY6A 4GZDA 3D9HA 3S7DA 1EPUA 1UN8A 2LSVA 5JMND 3I5PA 3PS6A 1DCQA 2YNQA 4HQDA 4A55A 3CVXA 1BI8B 5FWQA 3UI2A 2RG8A 1TEZA 2GRNB 3FUKA 2DZNA 3ZHEB 1OWNA 3ML8A 3ESKA 3TWVA 4GTMA 4A1GA 4YDEA 1KT0A 1DC2A 1FT2A 2XCCA 3QJZA 1FCHA 4GPMA 3Q4AB 1HX8A 2DCPA 2ZXWE 4APFA 3ASGA 3ONKA 2IU1A 1OWOA 4J8DA 1OWMA 3TWRA 5JHBA 2IEJA 2NXPA 1HU3A 4TXQA 3APDA 3D9MA 2J4BA 3IHYA 3CHOA 5EKQD 5AIJA 2WB2A 1QBQA 4I1MA 3BEEA 3UIPC 3HVEA 3OXGA 4ILHB 2CHZA 4GYOA 2MOWA 5BPPA 4AY6A 4UWLA 2MRIA 3Q7FA 3QDNA 5CHEE 3ZXPA 3CR3A 4F1SA 2XQ0A 1HE8A 1PAQA 3IEGA 3AG3E 3MCXA 3D9IA 4WAFA 4XKBA 1OY3D 1UOHA 3GYZA 3OXFA 4UI9J 3CHPA 1QQEA 3ABKE 3SZ7A 4X8QA 4WWNA 3SFYA 3EUVA 4PS7A 3L82A 1EYHA 2WMNA 3JXIA 3EIQC 5KBAA 1UN9A 2BKGA 3C72A 2R05A 4EBAA 1O1RA 4QQIA 2ETBA 2V0PA 3CHQA 2P9SG 2OVBA 5CRVA 2WXFA 4JPSA 3Q79A 3MGBA 3GZSA 4U7EB 3Q7AA 1OCRE 3WG7E 2L6BA 3SGHA 4EPZA 2OEVA 1BU9A 4GMJA 2XZTG 2IJGX 4P29A 5ARGA 3SO8A 3VLDA 3T8KA 1IHGA 5FQ8A 3DSUA 3PEUB 2L0TB 1JCSA 1HH8A 1UJKA 4GA2A 3L54A 5ENOD 4APOA 3B13A 4UI9K 2QYUA 2VGXA 4YNDA 1H0AA 3DSVA 3I3NA 4O6FA 4YDOA 3RU0A 5ENQD 3ZRHA 3FFLA 4I17A 3UUXA 3FUNA 3UTMA 2R2LA 1IQRA 4I2ZA 4ATZD 2DYSE 2UWJG 3CLJA 4BERA 4J8EA 4U96D 2KM4A 2LUHA 1TN6A 3HXCA 3JUEA 4FLBA 1ZBPA 3CK8A 2P9PG 2J08A 4D10C 3PZ2A 5ENNA 1KZOA 2JABA 1S0PA 4HRLA 4JZYA 1AP7A 3EJNA 3QNKA 4YDWA 3HDXA 2I6HA 3AG1E 2KATA 4ILIA 4UWHA 3RIBA 1NFIE
chains in the Genus database with same CATH topology
5FQ7A 4HVBA 2I2OA 4PS8A 5LX8A 2WM9A 5LOZA 4K03A 2AWIA 3MX3A 5AENA 2GW1A 5HQ8A 2FEZA 2GRLA 5KJNA 2V4LA 4FC8A 4Q94A 2FULA 3D9PA 3PNTB 2BTDA 5BV1A 4B8CB 4CEMA 3JQ1A 5FZQA 5G05C 2PL2A 2X6FA 4IULA 1E96B 2CHWA 2PM6A 2BF0X 3TXMA 2WXPA 4LERA 4YVQC 3RKVA 4ILGA 5HI7A 4BX8A 3ASHA 4CGVA 4R7LA 2X6HA 3Q15A 5M72A 3SHFA 3ZFWA 3RRMB 3SD5A 3UQ3A 3ONLA 2OOEA 4JW1A 4UQXA 3L17A 3CKCA 3MA5A 3AS8A 4N3CA 4JXTA 4DK5A 3MKRA 2KCLA 2LO6A 4GYWA 2MHKA 1N52A 4MRUA 4BWRA 4CCAA 3DPDA 1YA0A 2V5FA 2XEVA 3GZ2A 3CEQA 3LDZA 4I1AA 2KZTB 4KVMA 3FDHA 5FQ4A 3FHEA 5FTPA 2L6JA 4NACA 3B7RL 2HO1A 4XX5A 4ABNA 2DIWA 4RSYA 3ZVVA 1Z3YA 3CVQA 3CV0A 5JJ6A 2J09A 3VLFA 3LPZA 3EHNA 4FP7A 4JA7A 4JHJA 4H7XA 3PE4A 3KS2A 3CHSA 4UWGA 3OAWA 5FJYA 1W3BA 5JJTA 1JUQA 2WXRA 3FTWA 4GZ6A 4BTBA 2RD0A 3R9AB 4AV7A 4C0MA 5ARFA 4A3TA 5KJKA 3S2AA 4JA9A 1H2UA 4MLPA 4GB9A 4U8HA 1JPLA 3G2VA 3ZYLA 3LEWA 4KYOB 4EBAG 5JJ7A 3D9JA 4GA1A 3NZSA 2V8SE 5FZRA 3SBTB 3SBSA 1U3CA 1Y8MA 4JEHA 3AU4A 3FUEA 2PQRA 3U4TA 2QY7A 1E8YA 5KJLA 4J8FA 3PUJA 3LVRE 3RJVA 4Y6WA 3PNLB 5CMWA 4N5CA 4ACKA 4BT8A 4ACLA 3G2SA 4I6JA 3LY7A 2E0IA 2NSZA 2VTBB 2X6JA 3I4GA 3ML9A 5G04C 1N54A 3MEKA 3RRNB 2M63A 5A23A 5CCLA 2WVIA 4LEUA 4LCTA 2A5UA 2XGMA 2YHCA 2WXHA 4M3OA 3HVEB 4UQZA 1HG5A 3QC1A 4FJZA 1E7VA 4DJAA 5G04J 2J4DA 2AXUA 1KT1A 3OXLA 4OYSA 3HHMA 3OTNA 3FU0A 3FUDA 2YQ8A 3KEZA 2AXVA 3AS5A 1HS6A 1NZNA 5JHAA 4U0SA 5D0OD 3QARA 2X6KA 3FTXA 3FTSA 3FUHA 3PZDA 3D9NA 3LS8A 2VJ8A 2KZTA 3MZLB 4N3BA 4PUCA 3CVNA 4KVOA 4QFVA 5T3RA 2XRZA 2LNIA 1XGWA 3P2BA 4WWOA 2WXLA 4CGWA 4FHKA 1HXIA 1OWPA 2I9CA 3CQCB 3LCAA 2EQXA 3G2WA 1WY6A 1FVHA 3RRUA 3SFZA 3ASDA 4KBQA 4G23A 4F7AA 4BSXA 5J08A 2KCKA 2YINA 1MQSA 3R7RA 4URKA 2YHEA 1INZA 3O48A 2C2LA 2VGXB 1NA0A 2Y4UA 2P58C 3Q49B 4F3VA 2XPYA 3CGHA 3FP3A 3ZYKA 4TRQA 4Y6CA 2WXJA 3PUKA 4IYPA 3FULA 2WXMA 4I1OB 4KMOA 4XIFA 4AOFA 2OVFA 3URZA 4B8AA 4XE0A 4RVBA 4N2SA 2VTBA 2CG2A 2XGOA 4NURA 1Z3XA 4G1TA 1UJJA 5AJDA 1ELKA 5KCMA 1OWLA 4FLHA 1HF8A 3L08A 3RO3A 4CT4A 4N3AA 4GZCA 2LSUA 3I4RB 3D9KA 2X3MA 2IONA 4CDMA 4RG6A 4AP2A 2C0LA 3QAQA 4AJWA 2VSYA 3JCKC 3AS4A 4KT6B 2I1JA 3RO2A 3ASFA 5AJLA 1Z6TA 4I6EA 2WQHA 3CK9A 2WXQA 4AIFA 4E6HA 4ANXA 1EF1C 1QNFA 2IQCA 3HIZA 4A1SA 2FBNA 4B0ZA 4WNEA 4WWPA 2L0IA 5EDSA 2DBAA 3S7JA 1UW4B 2XPIA 4L7TA 3EDTB 3P1UA 4MS6A 4MKTA 2R5SA 4G25A 2BUGA 2J9QA 4FULA 3CSFA 2I1KA 5D0QD 4U07A 4U04A 4DPRA 3FH8A 1SZ9A 3APFA 3FH7A 2JEKA 3NQPA 4GU5A 5FZSA 2XPZA 3LYAA 3UPVA 3ZEFA 3SNXA 5C1DA 3NF1A 4E85A 3N71A 2WXOA 4W9RA 4AY5A 2Y4TA 3TAXA 5LCWJ 1X5BA 4GZDA 2PQNA 1U3DA 4BY6A 3S7DA 1EPUA 1UN8A 2LSVA 3ZPJA 3PE3A 3ENEA 3TL5A 3I5PA 3PS6A 2Q7FA 3C98A 3QKYA 5A6CA 2YNQA 1H19A 3L6AA 4WNFA 4A55A 3CVXA 5FWQA 5LCWC 1MHQA 3CVPA 4EZLA 3D9LA 3TG5A 2CFUA 2RG8A 3VTXA 1TEZA 2WXKA 1UG3A 3R7QA 4DLQA 2VYIA 4OVUA 4G2VA 4HS2A 3QOUA 3FUKA 4ATGA 1P5QA 3ZHEB 4IRUA 1OWNA 3ML8A 4L23A 3ESKA 3U66A 3FH5A 4I2WA 5EX3A 4KZCA 3WXXA 1ELRA 4A1GA 1LF8A 4FA6A 1XNFA 1KT0A 3EHMA 3SF4A 3EIJA 4JHRA 2LAHA 4JHKA 1Y6IA 1QZ2A 3VLEA 2XCCA 3QJZA 1FCHA 4A3VA 4DI4A 3Q4AB 1HX8A 4JC8A 5LP0A 2R17C 3B7TA 2C0MA 1H2VC 2DCPA 2UY1A 3MKQA 4HOSA 4V3IA 4ANWA 3RK6A 3ASGA 4APFA 1HO8A 3S7FA 3ONKA 2IU1A 1DNPA 1OWOA 2X6IA 3TXNA 4N39A 3UT7A 5E76A 4J8DA 3UX4A 4CDNA 2NC9A 1OWMA 2VSOE 3HYMB 3ZGQA 5E75A 3ZYMA 3ZIMA 4LUNU 3IKOB 5JHBA 3MKQB 3BG0B 4GYYA 3PH0C 2NXPA 1HU3A 5BNWA 3APDA 3ZYQA 3Q5MA 3D9MA 4L2YA 3MYVA 2WMOA 2WXNA 4I9CA 3ZW3A 5LFAA 2J4BA 3IHYA 2VSXE 1PC2A 3CK7A 3CHOA 3LXUX 5EKQD 1TJCA 3CVUA 2JLBA 5AIJA 4HFGA 2VSNA 2E2EA 4NQ0A 5C2YA 2WB2A 3ZXSA 3CVVA 4I1MA 3BEEA 4GZ3A 4G26A 4Q69A 2OV8A 5AYWD 3HVEA 3OXGA 4ILHB 3U9WA 3UT4A 5BV0A 2IOLA 4H7YA 2CHZA 2AXZA 4GYOA 4JL0A 4TV3A 2MOWA 1SQMA 4ME2A 4I6GA 4ANUA 2CHXA 5BPPA 4U63A 5BW8C 4HOUA 4AY6A 4UWLA 2MRIA 3SI5A 3QDNA 5CHEE 3FWVA 2WQ7A 2X38A 3B7SA 3L22A 3CR3A 3PEVB 4AEZC 2UY1B 4F53A 1GW6A 4OVVA 3T5VA 4AM9A 4F1SA 2XQ0A 1HE8A 1PAQA 2PZIA 3IEGA 4HXIA 4IN3B 3MCXA 3D9IA 4WAFA 4UWKA 2KC7A 1SZAA 4JEUA 4XKCA 4UI9C 3T5XA 3CIAA 4GCOA 2WXGA 4XKBA 4CDRA 2ONDA 3FTZA 4UWFA 4GA0A 2XHEA 1DVPA 3CQGB 2ZU6B 5FQ6A 4U0UA 3UT8A 3GYZA 4GAAA 5DIZA 1HZ4A 3CHMA 3IV0A 3OXFA 4UI9J 3T8MA 4FADA 3CHPA 1VDYA 3LY8A 1E8XA 3QWWA 1QQEA 3SZ7A 3QK0A 4FJYA 2XGSA 2FI7A 3CSTA 4WWNA 2GGFA 1E8ZA 3MV2B 3LKUA 4L1BA 4HLEA 2VQ2A 2WPVA 3FTVA 3K9IA 3L13A 4JVSA 4Q96A 4PS7A 3FUJA 4WNGA 3S7BA 3TG4A 3PREA 1EYHA 2WMNA 5ANRA 3EIQC 5ANLA 3MV3B 3FTUA 3FTYA 4UQYA 2WQ6A 1UN9A 3NZUA 4EBAA 4KXKB 4PDXA 3QWPA 4CRWA 2HM8A 3BG1B 5T8IA 2V0PA 3CHQA 2XRYA 5G2NA 5T4YA 2OVBA 2WXFA 1E8WA 3U64A 3JUIA 4JPSA 3CVWA 4I9EA 4AVXA 3MGBA 4XI9A 3GZSA 4XI0A 3FUMA 4B94A 3LVQE 4KZ0A 3CVYA 1HFAA 4EZKA 2HR2A 1E90A 1H6KA 4YVOA 2R59A 3KD7A 3SGHA 1E7UA 5DBKA 3ZHEA 4EPZA 4CT0A 4BX9A 5EX0A 3IHVA 3PRZA 4C0EA 2QFCA 3CKBA 2ILRA 3PVLA 2IFUA 4G11A 4GMJA 4J6IA 2IJGX 2GRMA 3O4ZA 2AW6A 4P29A 5ARGA 3VLDA 1JWFA 3ESLA 3PDNA 4HOTA 4PS3A 5J90A 1IHGA 5FQ8A 3FUFA 3PEUB 2L0TB 3FEXA 5A7DB 3VTYA 4DI3A 1JWGA 1BPOA 3GW4A 1B89A 1HH8A 4EECA 3CHRA 3FEYA 1TJFA 1UJKA 4GA2A 3L54A 4WNDA 4EZJA 4APOA 2WXIA 3QB2A 3B13A 4UI9K 4GCNA 4YNDA 2VGXA 2VGYA 1H0AA 2LAIA 3I3NA 3IBEA 4O6FA 4PH4B 3Q47B 4FU3A 3RU0A 3FU5A 3LY9A 2IOSA 5BUZA 3FUIA 4B89A 4J8SA 4HOQA 4N2QA 1WM5A 4U0ZA 3ZRHA 4HORA 1NP7A 4RG9A 4ANVA 3FFLA 4I17A 4BT9A 5FT9A 3G2TA 3FUNA 4J0UA 4L2LA 3UUXA 4XZ4A 3D9OA 3B7UX 1IQRA 3LJ3A 4I2ZA 4AXHA 2J07A 3FU3A 2UWJG 4C9BB 4BFRA 5BT1A 4GPKA 2CG3A 3CLJA 1L5JA 3MJWA 1FVFA 1ZU2A 4BTAA 4EQFA 4J8EA 2Y3AA 4LRZA 3CVLA 3G2UA 2KM4A 3ZN3A 3U3WA 1KLXA 3DBSA 4DLOA 5G05J 4GMLA 2L9BA 4FHJA 1PY1A 4G24A 1HG2A 4FLBA 2CFZA 1ZBPA 3CK8A 2FO7A 2J08A 3QWVA 4D10C 5ENNA 1S0PA 2KCVA 4GZ5A 4JZYA 3UMVA 3D3MA 3ULQA 4I43A 3EJNA 3QNKA 3HDXA 1IQUA 2HYZA 4K0RA 3FU6A 2A4ZA 1A17A 3FY4A 3GZ1A 3E4BA 1H2TC 3JQ0A 2I6HA 4TUUA 2KATA 3JYSA 3AU5A 5KJMA 5CMYA 1IYGA 3KAEA 1NA3A 2PM7A 2IF4A 3L16A 4ILIA 2AVPA 4UWHA 5CCMA 3APCA 1OUVA 1WAO1 2J49A 4NRHB 5G55A 1EDUA 2XCBA 3RIBA 1ELWA 3TJPA 3TGOA 2FF4A 4WUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AEZ C;  4A1G A;  3SI5 A;  2LAH A;  2WVI A; 
#chains in the Genus database with same CATH topology
 4M7C A;  4PS8 A;  5LX8 A;  4K03 A;  1N0R A;  3NOC D;  4MBG A;  4Q94 A;  3D9P A;  2BTD A;  4B8C B;  3JQ1 A;  2PL2 A;  1E96 B;  4XEI G;  2PM6 A;  5ENR D;  2WXP A;  4YVQ C;  5M72 A;  3UQ3 A;  5EYL A;  5B3S E;  4UQX A;  5HRY A;  4JXT A;  4DK5 A;  2KCL A;  2R02 A;  4CCA A;  4KVM A;  5FQ4 A;  1K1B A;  3FHE A;  2DIW A;  3CVQ A;  3VLF A;  5JJ6 A;  4JA7 A;  4H7X A;  3PE4 A;  1K3Z D;  2F37 A;  1W3B A;  4GZ6 A;  4BTB A;  3TWW A;  2V5Q C;  4JA9 A;  4MLP A;  5CEC B;  3D9J A;  5FZR A;  3SBT B;  1OCO E;  1JCR A;  1Y8M A;  2BED A;  2PQR A;  3U4T A;  3AJI A;  5KJL A;  4J8F A;  1N94 A;  5CMW A;  4N5C A;  4ACK A;  5KNG A;  4LEU A;  4M3O A;  4UQZ A;  2XS1 A;  4FJZ A;  3QC1 A;  4TXP A;  1TR4 A;  2J4D A;  1MJ0 A;  1KT1 A;  4K5C A;  3HHM A;  4LNU D;  1RW2 A;  2VJ8 A;  4QFV A;  3F6Q A;  1HXI A;  2EQX A;  3ASD A;  4KBQ A;  4F7A A;  3ULE G;  5J08 A;  1K8K G;  1INZ A;  2YHE A;  3O48 A;  2Y4U A;  1N11 A;  4Y6C A;  2WXJ A;  4IYP A;  2WXM A;  4AOF A;  2OVF A;  4XE0 A;  3NOG D;  4RVB A;  2VTB A;  1OWL A;  3AAA C;  4N3A A;  3D9K A;  3UIN C;  4AP2 A;  2C0L A;  1MX6 A;  4AJW A;  4RLY A;  3EHQ A;  1LD7 A;  2WQH A;  4E6H A;  1QNF A;  2IQC A;  4A1S A;  4B0Z A;  4WWP A;  2L0I A;  1UW4 B;  1V54 E;  2R5S A;  4FUL A;  3HG0 D;  5KWD A;  3APF A;  3NQP A;  2H6F A;  2Y4T A;  2DZO A;  1X5B A;  5BXO A;  3PE3 A;  3ENE A;  5CER B;  3TL5 A;  2Q7F A;  3C98 A;  3L6A A;  4WNF A;  3DEO A;  3CVP A;  3D9L A;  3DXK G;  3R7Q A;  4DLQ A;  2VYI A;  3QOU A;  1BI7 B;  4IRU A;  3TWX A;  3U66 A;  2ZGD A;  3SF4 A;  1QZ2 A;  5LP0 A;  3NAW A;  2QYJ A;  3HRA A;  4ANW A;  3DSS A;  3RSE G;  1DNP A;  5E76 A;  3UX4 A;  4CDN A;  4EHM A;  3ZGQ A;  3HYM B;  5E75 A;  3IKO B;  4GYY A;  3PH0 C;  3ZNG A;  4L2Y A;  3ZW3 A;  2WXN A;  1N4S A;  2Y0B G;  4HFG A;  4NQ0 A;  4JD2 G;  4GZ3 A;  2V4H C;  4GTV A;  3KSQ A;  2AXZ A;  4ME2 A;  3HXF A;  4I6G A;  4ANU A;  4U63 A;  3B7B A;  2IO3 C;  2X38 A;  3L22 A;  4AEZ C;  4OVV A;  1JCQ A;  3HXE A;  4JEU A;  4XKC A;  3CIA A;  4CDR A;  4GA0 A;  2XHE A;  1DVP A;  2ZU6 B;  5FQ6 A;  3UT8 A;  5AQ7 A;  1VDY A;  5EID A;  4FJY A;  2GGF A;  1E8Z A;  3T9K A;  4HLE A;  2VQ2 A;  3PRE A;  1K1A A;  5ANR A;  5FIN A;  3FTY A;  3NZU A;  4KXK B;  2B0O E;  4F1P A;  5ENS D;  2HM8 A;  3BG1 B;  1TNB A;  2XRY A;  3SQV A;  3U64 A;  4I9E A;  3PZ4 A;  4XI0 A;  3FUM A;  4KZ0 A;  4HNA D;  2HR2 A;  1E90 A;  3KD7 A;  1E7U A;  5EX0 A;  3PRZ A;  2ILR A;  4G11 A;  2IFU A;  4J6I A;  2GRM A;  4HOT A;  3ESL A;  4PS3 A;  3BUA A;  5J90 A;  4DI3 A;  4EZJ A;  4GCN A;  2VGY A;  2FO1 E;  2A5E A;  2LAI A;  4DX1 A;  2IOS A;  3DSX A;  1WM5 A;  1NP7 A;  5FT9 A;  4J0U A;  4XZ4 A;  3FU3 A;  4C9B B;  3E34 A;  4GPK A;  1L5J A;  1QYM A;  2Y69 E;  3CVL A;  1KLX A;  4DLO A;  4GML A;  4DX5 D;  3TWT A;  1ZB1 A;  1PY1 A;  4G24 A;  2KBX A;  1HG2 A;  4UUC A;  3DEP A;  3QWV A;  3DSW A;  2KCV A;  1TYQ G;  3D3M A;  3ULQ A;  3UIO C;  2HYZ A;  4GTT A;  3KAE A;  1Z5S C;  2AVP A;  3EHR A;  4NRH B;  1TNO A;  1EDU A;  4WUY A;  2NYJ A;  5FQ7 A;  2RFA A;  2WM9 A;  5LOZ A;  2GW1 A;  5HQ8 A;  4GTO A;  2GRL A;  2FUL A;  2XEH A;  5BV1 A;  4CEM A;  3LJN A;  2XZD G;  4IUL A;  3C5R A;  4LER A;  3RKV A;  4ILG A;  4R7L A;  2X6H A;  3SHF A;  3ZFW A;  3RRM B;  2MYO A;  4CYM D;  3ONL A;  4JW1 A;  3MA5 A;  4N3C A;  2MHK A;  1N52 A;  3LDZ A;  4XX5 A;  4ABN A;  1Z3Y A;  2J09 A;  1JUQ A;  2WXR A;  3FTW A;  3RAU A;  4C0M A;  2GRP B;  4A3T A;  5KJK A;  3EU5 A;  3S2A A;  1NI1 A;  1JPL A;  3G2V A;  3ZYL A;  3LEW A;  5JJ7 A;  4G8K A;  3NZS A;  4JEH A;  3AU4 A;  3FUE A;  2QY7 A;  3PUJ A;  3RJV A;  3PNL B;  4BT8 A;  4I6J A;  2NSZ A;  1X81 A;  2X6J A;  5G04 C;  1N54 A;  3MEK A;  2WVI A;  4J7W A;  2A5U A;  2YHC A;  3UKU G;  2WXH A;  2EIN E;  4DJA A;  5G04 J;  3V31 A;  3FUD A;  5D66 A;  1NZN A;  5JHA A;  5D0O D;  2X6K A;  3FTS A;  3FUH A;  3PZD A;  3DRA A;  5T3R A;  2LNI A;  1MX2 A;  3P2B A;  2WXL A;  4CGW A;  5AN8 A;  4K5B A;  1FVH A;  3RRU A;  3SFZ A;  4BSX A;  4DUI A;  2KCK A;  2YIN A;  3R7R A;  4URK A;  2OCC E;  1H6O A;  1LTX A;  4F3V A;  5D2M C;  5EYP F;  1TN7 A;  4N2S A;  2CG2 A;  1ELK A;  1BLX B;  4CT4 A;  4FLH A;  3I4R B;  3KEA A;  2ION A;  4CDM A;  2P2C P;  3AS4 A;  2QZA A;  3RO2 A;  5AJL A;  1Z6T A;  3E30 A;  2FBN A;  4L7T A;  4MKT A;  4G25 A;  2BUG A;  3SY2 A;  1OCC E;  2GRO B;  4F6R D;  4BEP A;  4U04 A;  1WDY A;  2JEK A;  2Y1L E;  5C1D A;  3NF1 A;  1A5E A;  5LCW J;  2WXO A;  3TAX A;  2PQN A;  1U3D A;  2GRQ B;  4J8Y A;  3ZPJ A;  1N9A A;  3QKY A;  5LCW C;  3TG5 A;  2CFU A;  3VTX A;  1V55 E;  3ASN E;  4HS2 A;  2ETC A;  1P5Q A;  2BKK B;  3UXG A;  4L23 A;  2DWZ A;  1IHB A;  3FH5 A;  1ELR A;  3HXD A;  1LF8 A;  4FA6 A;  3DXM G;  3TWS A;  4JHR A;  1O5M A;  4JHK A;  3VLE A;  3PZ1 A;  4JC8 A;  2R03 A;  2R17 C;  3B7T A;  4HOS A;  3RK6 A;  1HO8 A;  2X6I A;  3C3Q A;  3TXN A;  3UM3 A;  4N39 A;  1N4Q A;  2KXP C;  2NC9 A;  2VSO E;  4HI8 A;  4LUN U;  5BNW A;  1H6P A;  3ZYQ A;  3Q5M A;  3E32 A;  2WMO A;  4I9C A;  2VSX E;  1PC2 A;  2E2E A;  5C2Y A;  3L9T A;  4Q69 A;  5AYW D;  5BV0 A;  2IOL A;  3Q75 A;  2DVW A;  2CHX A;  2F8X K;  3SI5 A;  3B7S A;  3PEV B;  4HXI A;  1N95 A;  2KC7 A;  1SZA A;  3T5X A;  4GCO A;  2WXG A;  2OND A;  4UWF A;  3TWQ A;  4U0U A;  5DIZ A;  3CHM A;  3T8M A;  3JXJ A;  1E8X A;  3QWW A;  4HRN A;  2XGS A;  3MV2 B;  4L1B A;  4WNG A;  4JVS A;  3K9I A;  3L13 A;  3S7B A;  3MV3 B;  3FTU A;  4UQY A;  5EIB E;  4HBD A;  3NB2 A;  3QWP A;  3NBN B;  5HKP A;  2P9N G;  3JUI A;  4AVX A;  4XI9 A;  3ZUV B;  4B94 A;  3CVY A;  2XEN A;  4EZK A;  1H6K A;  3HXB A;  5DBK A;  4BX9 A;  4C0E A;  3CKB A;  3PDN A;  4BSZ B;  3FEX A;  1BPO A;  3GW4 A;  1NL4 A;  4EEC A;  3CHR A;  4DX7 D;  1TJF A;  5ITZ F;  2EIK E;  3IBE A;  4PH4 B;  4FU3 A;  4BET A;  3LY9 A;  4NIK A;  3FUI A;  5BUZ A;  4J8S A;  4HOQ A;  4N2Q A;  2EIL E;  4HOR A;  4RG9 A;  4ANV A;  4C48 B;  3G2T A;  3R9M A;  4HRM B;  3B7U X;  3LJ3 A;  1TN8 A;  4AXH A;  5B1A E;  4BFR A;  1FVF A;  1ZU2 A;  1IKN D;  4EQF A;  2Y3A A;  4LRZ A;  3G2U A;  3ZN3 A;  3U3W A;  2L9B A;  5HS0 A;  4GZ5 A;  3UMV A;  3W9G A;  1D9S A;  3C3R A;  4K0R A;  1MX4 A;  3FU6 A;  2A4Z A;  4TUU A;  1A17 A;  3FY4 A;  3E4B A;  4O60 A;  3JYS A;  3AU5 A;  1IYG A;  4O1O A;  5CED B;  2PM7 A;  2IF4 A;  3L16 A;  5CCM A;  1WAO 1;  2J49 A;  4U95 D;  3TJP A;  3TGO A;  1YCS B;  2I2O A;  4ZHB A;  3MX3 A;  5KNH D;  5KJN A;  2V4L A;  3PNT B;  5FZQ A;  2X6F A;  2BF0 X;  3TXM A;  4BX8 A;  3SD5 A;  3CKC A;  3AS8 A;  3MKR A;  3Q73 A;  1YA0 A;  2V5F A;  4RSY A;  3FDH A;  5FTP A;  2L6J A;  3B7R L;  2HO1 A;  2DYR E;  3LPZ A;  2ZGG A;  3EHN A;  1N4P A;  4FP7 A;  4JHJ A;  3E37 A;  3KS2 A;  4UWG A;  5FJY A;  5JJT A;  3V2O A;  2RD0 A;  4AV7 A;  1H2U A;  4GB9 A;  4EBA G;  2V8S E;  3SBS A;  1U3C A;  3J5P A;  3UKR G;  2HE0 A;  4ACL A;  3G2S A;  4L9P A;  4GTQ A;  1TNZ A;  3I4G A;  1TNY A;  5CCL A;  1YYH A;  2LXM A;  4K5A B;  3HVE B;  1E7V A;  3OXL A;  4Z68 A;  4OYS A;  4OAV B;  3OTN A;  1LD8 A;  3PZ3 A;  2B6C A;  2YQ8 A;  3AS5 A;  1HS6 A;  3SFX A;  4U0S A;  3QAR A;  1D8D A;  3D9N A;  2KZT A;  3MZL B;  4PUC A;  1OXJ A;  1XGW A;  1FT1 A;  4WWO A;  4FHK A;  1OWP A;  3CQC B;  3LCA A;  2LXL A;  1WY6 A;  1Q2Z A;  4HLL A;  5EN5 D;  1NA0 A;  3DST A;  3Q49 B;  2XPY A;  3CGH A;  3FP3 A;  1O1T A;  4TRQ A;  4XIF A;  3FUL A;  4I1O B;  4NUR A;  4TUM A;  1Z3X A;  5AQB A;  2F8Y A;  1UJJ A;  1SW6 A;  2OEW A;  5KCM A;  1HF8 A;  3RO3 A;  2LSU A;  2X3M A;  4RG6 A;  2VSY A;  4A63 B;  4KT6 B;  1S70 B;  3ASF A;  4AIF A;  2WXQ A;  4ANX A;  3HIZ A;  2P9K G;  4RQI A;  4ZFH A;  5AAR A;  2DBA A;  2XPI A;  3EDT B;  2AJA A;  2P9L G;  4DPR A;  3FH8 A;  5FZS A;  4GU5 A;  3LYA A;  3ZEF A;  5BXU A;  4E85 A;  3N71 A;  4W9R A;  3B95 A;  4AY5 A;  4G8L A;  2RFM A;  4B93 B;  5A6C A;  1H19 A;  2XEE A;  1MHQ A;  4EZL A;  2WXK A;  1UG3 A;  4OVU A;  4G2V A;  4ATG A;  3V2X A;  3EU9 A;  5IY5 E;  4I2W A;  5EX3 A;  4KZC A;  3WXX A;  3Q9N C;  1XNF A;  3EHM A;  3EIJ A;  2LAH A;  1N4R A;  1Y6I A;  4DI4 A;  4A3V A;  5AQA A;  4U8V D;  2C0M A;  1H2V C;  3MKQ A;  2UY1 A;  3V30 A;  4V3I A;  1KPS B;  4CZ2 D;  3S7F A;  3UT7 A;  2XS8 A;  3ZYM A;  3ZIM A;  2ZIS A;  5FIO A;  3MKQ B;  3BG0 B;  4DX6 D;  1SVX A;  3MYV A;  5LFA A;  3CK7 A;  3LXU X;  3CVU A;  1TJC A;  1G3N B;  2JLB A;  4O1P A;  3AG2 E;  2VSN A;  3J5Q B;  4OAU C;  3ZXS A;  3CVV A;  2EIM E;  4G26 A;  2OV8 A;  3U9W A;  3UT4 A;  1SA4 A;  4U8Y D;  4H7Y A;  3BU8 A;  4JL0 A;  4TV3 A;  1SQM A;  4TXR A;  5BW8 C;  4HOU A;  1OT8 A;  3FWV A;  3UM1 A;  2WQ7 A;  2UY1 B;  4F53 A;  1GW6 A;  3T5V A;  4AM9 A;  2PZI A;  4IN3 B;  4DRX E;  1D8E A;  4UWK A;  5CBO A;  4UI9 C;  3W9F A;  3FTZ A;  3CQG B;  1O1S A;  4GAA A;  1HZ4 A;  3IV0 A;  3Q78 A;  4FAD A;  3LY8 A;  5ENT D;  4GTR A;  3QK0 A;  2FI7 A;  3CST A;  3C3O A;  4YDY A;  3LKU A;  1RZ4 A;  2WPV A;  3FTV A;  4Q96 A;  3TG4 A;  3FUJ A;  5ANL A;  1U2V G;  5H7P A;  2WQ6 A;  3Q9U C;  3ZKJ A;  2EIJ E;  4PDX A;  4CRW A;  5T8I A;  3ISM C;  5G2N A;  5T4Y A;  1E8W A;  3CVW A;  3UM0 A;  2H6G A;  3LVQ E;  1SA5 A;  1HFA A;  1YMP A;  4YVO A;  2R59 A;  3ZHE A;  4CT0 A;  3IHV A;  2QFC A;  3PVL A;  3O4Z A;  2AW6 A;  1JWF A;  3FUF A;  5A7D B;  3VTY A;  1JWG A;  1B89 A;  3FEY A;  4WND A;  2WXI A;  3QB2 A;  3X2Q E;  1KZP A;  3UM2 A;  3Q47 B;  5ENP D;  3FU5 A;  4B89 A;  3DWL G;  5EIL A;  4U0Z A;  2F0Y A;  3ASO E;  4BT9 A;  4L2L A;  3D9O A;  2H6H A;  4GTP A;  2VGE A;  2J07 A;  5BT1 A;  2CG3 A;  1N0Q A;  3MJW A;  4BTA A;  5AQ9 A;  2QC9 A;  5AAO A;  5CRU A;  2P9U G;  3DBS A;  5G05 J;  4FHJ A;  4HI9 A;  3AG4 E;  2CFZ A;  4GMR A;  2FO7 A;  4LSZ E;  3ULY A;  4I43 A;  1IQU A;  3GZ1 A;  1BD8 A;  3JQ0 A;  1H2T C;  3DPY A;  2RKK A;  1MZC A;  5CMY A;  5KJM A;  4BES A;  1NA3 A;  4LNB A;  2J8S D;  3APC A;  5G55 A;  1OUV A;  2P9I G;  2XCB A;  1ELW A;  2FF4 A;  4HVB A;  4N5Q A;  2AWI A;  5AEN A;  2FEZ A;  4DX2 A;  3ABL E;  4FC8 A;  5G05 C;  1S63 A;  2CHW A;  5HI7 A;  4CGV A;  3ASH A;  3V79 K;  3KSL A;  3Q15 A;  2OOE A;  3L17 A;  5JA4 D;  2LO6 A;  4GYW A;  1AWC B;  4MRU A;  1OCZ E;  4BWR A;  3DPD A;  5CBN A;  2XEV A;  3GZ2 A;  3CEQ A;  4I1A A;  2KZT B;  4NAC A;  3ZVV A;  2ETA A;  3CV0 A;  3BQO A;  3ZU7 B;  2GRR B;  3CHS A;  3OAW A;  1S64 A;  4LG6 A;  3R9A B;  5B1B E;  5ARF A;  4GTS A;  4JB8 P;  4U8H A;  4KYO B;  4GA1 A;  1E8Y A;  3LVR E;  4Y6W A;  3LY7 A;  1DCE A;  2E0I A;  2VTB B;  3ML9 A;  3RRN B;  2M63 A;  3ABM E;  5A23 A;  4LCT A;  2XGM A;  1HG5 A;  2AXU A;  3FU0 A;  3KEZ A;  2AXV A;  3FTX A;  2IO2 C;  3LS8 A;  4N3B A;  3CVN A;  4KVO A;  2XRZ A;  2I9C A;  1WG0 A;  3G2W A;  4G23 A;  1MQS A;  2C2L A;  2VGX B;  2P58 C;  3ZYK A;  3PUK A;  4B8A A;  4KMO A;  3E33 A;  3URZ A;  1FPP A;  3IXE A;  2H6I A;  1MYO A;  2XGO A;  4G1T A;  2PNN A;  5AJD A;  2IY0 C;  3L08 A;  1IXV A;  4GZC A;  3TWU A;  3QAQ A;  3JCK C;  2I1J A;  4I6E A;  3CK9 A;  1EF1 C;  4WNE A;  5EDS A;  3S7J A;  3P1U A;  4MS6 A;  5CEA A;  2J9Q A;  3CSF A;  4LNG A;  2I1K A;  2ZIR A;  5D0Q D;  4U07 A;  1TNU A;  1SZ9 A;  3FH7 A;  3UPV A;  2XPZ A;  3SNX A;  4HB5 A;  4BY6 A;  4GZD A;  3D9H A;  3S7D A;  1EPU A;  1UN8 A;  2LSV A;  5JMN D;  3I5P A;  3PS6 A;  1DCQ A;  2YNQ A;  4HQD A;  4A55 A;  3CVX A;  1BI8 B;  5FWQ A;  3UI2 A;  2RG8 A;  1TEZ A;  2GRN B;  3FUK A;  2DZN A;  3ZHE B;  1OWN A;  3ML8 A;  3ESK A;  3TWV A;  4GTM A;  4A1G A;  4YDE A;  1KT0 A;  1DC2 A;  1FT2 A;  2XCC A;  3QJZ A;  1FCH A;  4GPM A;  3Q4A B;  1HX8 A;  2DCP A;  2ZXW E;  4APF A;  3ASG A;  3ONK A;  2IU1 A;  1OWO A;  4J8D A;  1OWM A;  3TWR A;  5JHB A;  2IEJ A;  2NXP A;  1HU3 A;  4TXQ A;  3APD A;  3D9M A;  2J4B A;  3IHY A;  3CHO A;  5EKQ D;  5AIJ A;  2WB2 A;  1QBQ A;  4I1M A;  3BEE A;  3UIP C;  3HVE A;  3OXG A;  4ILH B;  2CHZ A;  4GYO A;  2MOW A;  5BPP A;  4AY6 A;  4UWL A;  2MRI A;  3Q7F A;  3QDN A;  5CHE E;  3ZXP A;  3CR3 A;  4F1S A;  2XQ0 A;  1HE8 A;  1PAQ A;  3IEG A;  3AG3 E;  3MCX A;  3D9I A;  4WAF A;  4XKB A;  1OY3 D;  1UOH A;  3GYZ A;  3OXF A;  4UI9 J;  3CHP A;  1QQE A;  3ABK E;  3SZ7 A;  4X8Q A;  4WWN A;  3SFY A;  3EUV A;  4PS7 A;  3L82 A;  1EYH A;  2WMN A;  3JXI A;  3EIQ C;  5KBA A;  1UN9 A;  2BKG A;  3C72 A;  2R05 A;  4EBA A;  1O1R A;  4QQI A;  2ETB A;  2V0P A;  3CHQ A;  2P9S G;  2OVB A;  5CRV A;  2WXF A;  4JPS A;  3Q79 A;  3MGB A;  3GZS A;  4U7E B;  3Q7A A;  1OCR E;  3WG7 E;  2L6B A;  3SGH A;  4EPZ A;  2OEV A;  1BU9 A;  4GMJ A;  2XZT G;  2IJG X;  4P29 A;  5ARG A;  3SO8 A;  3VLD A;  3T8K A;  1IHG A;  5FQ8 A;  3DSU A;  3PEU B;  2L0T B;  1JCS A;  1HH8 A;  1UJK A;  4GA2 A;  3L54 A;  5ENO D;  4APO A;  3B13 A;  4UI9 K;  2QYU A;  2VGX A;  4YND A;  1H0A A;  3DSV A;  3I3N A;  4O6F A;  4YDO A;  3RU0 A;  5ENQ D;  3ZRH A;  3FFL A;  4I17 A;  3UUX A;  3FUN A;  3UTM A;  2R2L A;  1IQR A;  4I2Z A;  4ATZ D;  2DYS E;  2UWJ G;  3CLJ A;  4BER A;  4J8E A;  4U96 D;  2KM4 A;  2LUH A;  1TN6 A;  3HXC A;  3JUE A;  4FLB A;  1ZBP A;  3CK8 A;  2P9P G;  2J08 A;  4D10 C;  3PZ2 A;  5ENN A;  1KZO A;  2JAB A;  1S0P A;  4HRL A;  4JZY A;  1AP7 A;  3EJN A;  3QNK A;  4YDW A;  3HDX A;  2I6H A;  3AG1 E;  2KAT A;  4ILI A;  4UWH A;  3RIB A;  1NFI E; 
#chains in the Genus database with same CATH homology
 5FQ7 A;  4HVB A;  2I2O A;  4PS8 A;  5LX8 A;  2WM9 A;  5LOZ A;  4K03 A;  2AWI A;  3MX3 A;  5AEN A;  2GW1 A;  5HQ8 A;  2FEZ A;  2GRL A;  5KJN A;  2V4L A;  4FC8 A;  4Q94 A;  2FUL A;  3D9P A;  3PNT B;  2BTD A;  5BV1 A;  4B8C B;  4CEM A;  3JQ1 A;  5FZQ A;  5G05 C;  2PL2 A;  2X6F A;  4IUL A;  1E96 B;  2CHW A;  2PM6 A;  2BF0 X;  3TXM A;  2WXP A;  4LER A;  4YVQ C;  3RKV A;  4ILG A;  5HI7 A;  4BX8 A;  3ASH A;  4CGV A;  4R7L A;  2X6H A;  3Q15 A;  5M72 A;  3SHF A;  3ZFW A;  3RRM B;  3SD5 A;  3UQ3 A;  3ONL A;  2OOE A;  4JW1 A;  4UQX A;  3L17 A;  3CKC A;  3MA5 A;  3AS8 A;  4N3C A;  4JXT A;  4DK5 A;  3MKR A;  2KCL A;  2LO6 A;  4GYW A;  2MHK A;  1N52 A;  4MRU A;  4BWR A;  4CCA A;  3DPD A;  1YA0 A;  2V5F A;  2XEV A;  3GZ2 A;  3CEQ A;  3LDZ A;  4I1A A;  2KZT B;  4KVM A;  3FDH A;  5FQ4 A;  3FHE A;  5FTP A;  2L6J A;  4NAC A;  3B7R L;  2HO1 A;  4XX5 A;  4ABN A;  2DIW A;  4RSY A;  3ZVV A;  1Z3Y A;  3CVQ A;  3CV0 A;  5JJ6 A;  2J09 A;  3VLF A;  3LPZ A;  3EHN A;  4FP7 A;  4JA7 A;  4JHJ A;  4H7X A;  3PE4 A;  3KS2 A;  3CHS A;  4UWG A;  3OAW A;  5FJY A;  1W3B A;  5JJT A;  1JUQ A;  2WXR A;  3FTW A;  4GZ6 A;  4BTB A;  2RD0 A;  3R9A B;  4AV7 A;  4C0M A;  5ARF A;  4A3T A;  5KJK A;  3S2A A;  4JA9 A;  1H2U A;  4MLP A;  4GB9 A;  4U8H A;  1JPL A;  3G2V A;  3ZYL A;  3LEW A;  4KYO B;  4EBA G;  5JJ7 A;  3D9J A;  4GA1 A;  3NZS A;  2V8S E;  5FZR A;  3SBT B;  3SBS A;  1U3C A;  1Y8M A;  4JEH A;  3AU4 A;  3FUE A;  2PQR A;  3U4T A;  2QY7 A;  1E8Y A;  5KJL A;  4J8F A;  3PUJ A;  3LVR E;  3RJV A;  4Y6W A;  3PNL B;  5CMW A;  4N5C A;  4ACK A;  4BT8 A;  4ACL A;  3G2S A;  4I6J A;  3LY7 A;  2E0I A;  2NSZ A;  2VTB B;  2X6J A;  3I4G A;  3ML9 A;  5G04 C;  1N54 A;  3MEK A;  3RRN B;  2M63 A;  5A23 A;  5CCL A;  2WVI A;  4LEU A;  4LCT A;  2A5U A;  2XGM A;  2YHC A;  2WXH A;  4M3O A;  3HVE B;  4UQZ A;  1HG5 A;  3QC1 A;  4FJZ A;  1E7V A;  4DJA A;  5G04 J;  2J4D A;  2AXU A;  1KT1 A;  3OXL A;  4OYS A;  3HHM A;  3OTN A;  3FU0 A;  3FUD A;  2YQ8 A;  3KEZ A;  2AXV A;  3AS5 A;  1HS6 A;  1NZN A;  5JHA A;  4U0S A;  5D0O D;  3QAR A;  2X6K A;  3FTX A;  3FTS A;  3FUH A;  3PZD A;  3D9N A;  3LS8 A;  2VJ8 A;  2KZT A;  3MZL B;  4N3B A;  4PUC A;  3CVN A;  4KVO A;  4QFV A;  5T3R A;  2XRZ A;  2LNI A;  1XGW A;  3P2B A;  4WWO A;  2WXL A;  4CGW A;  4FHK A;  1HXI A;  1OWP A;  2I9C A;  3CQC B;  3LCA A;  2EQX A;  3G2W A;  1WY6 A;  1FVH A;  3RRU A;  3SFZ A;  3ASD A;  4KBQ A;  4G23 A;  4F7A A;  4BSX A;  5J08 A;  2KCK A;  2YIN A;  1MQS A;  3R7R A;  4URK A;  2YHE A;  1INZ A;  3O48 A;  2C2L A;  2VGX B;  1NA0 A;  2Y4U A;  2P58 C;  3Q49 B;  4F3V A;  2XPY A;  3CGH A;  3FP3 A;  3ZYK A;  4TRQ A;  4Y6C A;  2WXJ A;  3PUK A;  4IYP A;  3FUL A;  2WXM A;  4I1O B;  4KMO A;  4XIF A;  4AOF A;  2OVF A;  3URZ A;  4B8A A;  4XE0 A;  4RVB A;  4N2S A;  2VTB A;  2CG2 A;  2XGO A;  4NUR A;  1Z3X A;  4G1T A;  1UJJ A;  5AJD A;  1ELK A;  5KCM A;  1OWL A;  4FLH A;  1HF8 A;  3L08 A;  3RO3 A;  4CT4 A;  4N3A A;  4GZC A;  2LSU A;  3I4R B;  3D9K A;  2X3M A;  2ION A;  4CDM A;  4RG6 A;  4AP2 A;  2C0L A;  3QAQ A;  4AJW A;  2VSY A;  3JCK C;  3AS4 A;  4KT6 B;  2I1J A;  3RO2 A;  3ASF A;  5AJL A;  1Z6T A;  4I6E A;  2WQH A;  3CK9 A;  2WXQ A;  4AIF A;  4E6H A;  4ANX A;  1EF1 C;  1QNF A;  2IQC A;  3HIZ A;  4A1S A;  2FBN A;  4B0Z A;  4WNE A;  4WWP A;  2L0I A;  5EDS A;  2DBA A;  3S7J A;  1UW4 B;  2XPI A;  4L7T A;  3EDT B;  3P1U A;  4MS6 A;  4MKT A;  2R5S A;  4G25 A;  2BUG A;  2J9Q A;  4FUL A;  3CSF A;  2I1K A;  5D0Q D;  4U07 A;  4U04 A;  4DPR A;  3FH8 A;  1SZ9 A;  3APF A;  3FH7 A;  2JEK A;  3NQP A;  4GU5 A;  5FZS A;  2XPZ A;  3LYA A;  3UPV A;  3ZEF A;  3SNX A;  5C1D A;  3NF1 A;  4E85 A;  3N71 A;  2WXO A;  4W9R A;  4AY5 A;  2Y4T A;  3TAX A;  5LCW J;  1X5B A;  4GZD A;  2PQN A;  1U3D A;  4BY6 A;  3S7D A;  1EPU A;  1UN8 A;  2LSV A;  3ZPJ A;  3PE3 A;  3ENE A;  3TL5 A;  3I5P A;  3PS6 A;  2Q7F A;  3C98 A;  3QKY A;  5A6C A;  2YNQ A;  1H19 A;  3L6A A;  4WNF A;  4A55 A;  3CVX A;  5FWQ A;  5LCW C;  1MHQ A;  3CVP A;  4EZL A;  3D9L A;  3TG5 A;  2CFU A;  2RG8 A;  3VTX A;  1TEZ A;  2WXK A;  1UG3 A;  3R7Q A;  4DLQ A;  2VYI A;  4OVU A;  4G2V A;  4HS2 A;  3QOU A;  3FUK A;  4ATG A;  1P5Q A;  3ZHE B;  4IRU A;  1OWN A;  3ML8 A;  4L23 A;  3ESK A;  3U66 A;  3FH5 A;  4I2W A;  5EX3 A;  4KZC A;  3WXX A;  1ELR A;  4A1G A;  1LF8 A;  4FA6 A;  1XNF A;  1KT0 A;  3EHM A;  3SF4 A;  3EIJ A;  4JHR A;  2LAH A;  4JHK A;  1Y6I A;  1QZ2 A;  3VLE A;  2XCC A;  3QJZ A;  1FCH A;  4A3V A;  4DI4 A;  3Q4A B;  1HX8 A;  4JC8 A;  5LP0 A;  2R17 C;  3B7T A;  2C0M A;  1H2V C;  2DCP A;  2UY1 A;  3MKQ A;  4HOS A;  4V3I A;  4ANW A;  3RK6 A;  3ASG A;  4APF A;  1HO8 A;  3S7F A;  3ONK A;  2IU1 A;  1DNP A;  1OWO A;  2X6I A;  3TXN A;  4N39 A;  3UT7 A;  5E76 A;  4J8D A;  3UX4 A;  4CDN A;  2NC9 A;  1OWM A;  2VSO E;  3HYM B;  3ZGQ A;  5E75 A;  3ZYM A;  3ZIM A;  4LUN U;  3IKO B;  5JHB A;  3MKQ B;  3BG0 B;  4GYY A;  3PH0 C;  2NXP A;  1HU3 A;  5BNW A;  3APD A;  3ZYQ A;  3Q5M A;  3D9M A;  4L2Y A;  3MYV A;  2WMO A;  2WXN A;  4I9C A;  3ZW3 A;  5LFA A;  2J4B A;  3IHY A;  2VSX E;  1PC2 A;  3CK7 A;  3CHO A;  3LXU X;  5EKQ D;  1TJC A;  3CVU A;  2JLB A;  5AIJ A;  4HFG A;  2VSN A;  2E2E A;  4NQ0 A;  5C2Y A;  2WB2 A;  3ZXS A;  3CVV A;  4I1M A;  3BEE A;  4GZ3 A;  4G26 A;  4Q69 A;  2OV8 A;  5AYW D;  3HVE A;  3OXG A;  4ILH B;  3U9W A;  3UT4 A;  5BV0 A;  2IOL A;  4H7Y A;  2CHZ A;  2AXZ A;  4GYO A;  4JL0 A;  4TV3 A;  2MOW A;  1SQM A;  4ME2 A;  4I6G A;  4ANU A;  2CHX A;  5BPP A;  4U63 A;  5BW8 C;  4HOU A;  4AY6 A;  4UWL A;  2MRI A;  3SI5 A;  3QDN A;  5CHE E;  3FWV A;  2WQ7 A;  2X38 A;  3B7S A;  3L22 A;  3CR3 A;  3PEV B;  4AEZ C;  2UY1 B;  4F53 A;  1GW6 A;  4OVV A;  3T5V A;  4AM9 A;  4F1S A;  2XQ0 A;  1HE8 A;  1PAQ A;  2PZI A;  3IEG A;  4HXI A;  4IN3 B;  3MCX A;  3D9I A;  4WAF A;  4UWK A;  2KC7 A;  1SZA A;  4JEU A;  4XKC A;  4UI9 C;  3T5X A;  3CIA A;  4GCO A;  2WXG A;  4XKB A;  4CDR A;  2OND A;  3FTZ A;  4UWF A;  4GA0 A;  2XHE A;  1DVP A;  3CQG B;  2ZU6 B;  5FQ6 A;  4U0U A;  3UT8 A;  3GYZ A;  4GAA A;  5DIZ A;  1HZ4 A;  3CHM A;  3IV0 A;  3OXF A;  4UI9 J;  3T8M A;  4FAD A;  3CHP A;  1VDY A;  3LY8 A;  1E8X A;  3QWW A;  1QQE A;  3SZ7 A;  3QK0 A;  4FJY A;  2XGS A;  2FI7 A;  3CST A;  4WWN A;  2GGF A;  1E8Z A;  3MV2 B;  3LKU A;  4L1B A;  4HLE A;  2VQ2 A;  2WPV A;  3FTV A;  3K9I A;  3L13 A;  4JVS A;  4Q96 A;  4PS7 A;  3FUJ A;  4WNG A;  3S7B A;  3TG4 A;  3PRE A;  1EYH A;  2WMN A;  5ANR A;  3EIQ C;  5ANL A;  3MV3 B;  3FTU A;  3FTY A;  4UQY A;  2WQ6 A;  1UN9 A;  3NZU A;  4EBA A;  4KXK B;  4PDX A;  3QWP A;  4CRW A;  2HM8 A;  3BG1 B;  5T8I A;  2V0P A;  3CHQ A;  2XRY A;  5G2N A;  5T4Y A;  2OVB A;  2WXF A;  1E8W A;  3U64 A;  3JUI A;  4JPS A;  3CVW A;  4I9E A;  4AVX A;  3MGB A;  4XI9 A;  3GZS A;  4XI0 A;  3FUM A;  4B94 A;  3LVQ E;  4KZ0 A;  3CVY A;  1HFA A;  4EZK A;  2HR2 A;  1E90 A;  1H6K A;  4YVO A;  2R59 A;  3KD7 A;  3SGH A;  1E7U A;  5DBK A;  3ZHE A;  4EPZ A;  4CT0 A;  4BX9 A;  5EX0 A;  3IHV A;  3PRZ A;  4C0E A;  2QFC A;  3CKB A;  2ILR A;  3PVL A;  2IFU A;  4G11 A;  4GMJ A;  4J6I A;  2IJG X;  2GRM A;  3O4Z A;  2AW6 A;  4P29 A;  5ARG A;  3VLD A;  1JWF A;  3ESL A;  3PDN A;  4HOT A;  4PS3 A;  5J90 A;  1IHG A;  5FQ8 A;  3FUF A;  3PEU B;  2L0T B;  3FEX A;  5A7D B;  3VTY A;  4DI3 A;  1JWG A;  1BPO A;  3GW4 A;  1B89 A;  1HH8 A;  4EEC A;  3CHR A;  3FEY A;  1TJF A;  1UJK A;  4GA2 A;  3L54 A;  4WND A;  4EZJ A;  4APO A;  2WXI A;  3QB2 A;  3B13 A;  4UI9 K;  4GCN A;  4YND A;  2VGX A;  2VGY A;  1H0A A;  2LAI A;  3I3N A;  3IBE A;  4O6F A;  4PH4 B;  3Q47 B;  4FU3 A;  3RU0 A;  3FU5 A;  3LY9 A;  2IOS A;  5BUZ A;  3FUI A;  4B89 A;  4J8S A;  4HOQ A;  4N2Q A;  1WM5 A;  4U0Z A;  3ZRH A;  4HOR A;  1NP7 A;  4RG9 A;  4ANV A;  3FFL A;  4I17 A;  4BT9 A;  5FT9 A;  3G2T A;  3FUN A;  4J0U A;  4L2L A;  3UUX A;  4XZ4 A;  3D9O A;  3B7U X;  1IQR A;  3LJ3 A;  4I2Z A;  4AXH A;  2J07 A;  3FU3 A;  2UWJ G;  4C9B B;  4BFR A;  5BT1 A;  4GPK A;  2CG3 A;  3CLJ A;  1L5J A;  3MJW A;  1FVF A;  1ZU2 A;  4BTA A;  4EQF A;  4J8E A;  2Y3A A;  4LRZ A;  3CVL A;  3G2U A;  2KM4 A;  3ZN3 A;  3U3W A;  1KLX A;  3DBS A;  4DLO A;  5G05 J;  4GML A;  2L9B A;  4FHJ A;  1PY1 A;  4G24 A;  1HG2 A;  4FLB A;  2CFZ A;  1ZBP A;  3CK8 A;  2FO7 A;  2J08 A;  3QWV A;  4D10 C;  5ENN A;  1S0P A;  2KCV A;  4GZ5 A;  4JZY A;  3UMV A;  3D3M A;  3ULQ A;  4I43 A;  3EJN A;  3QNK A;  3HDX A;  1IQU A;  2HYZ A;  4K0R A;  3FU6 A;  2A4Z A;  1A17 A;  3FY4 A;  3GZ1 A;  3E4B A;  1H2T C;  3JQ0 A;  2I6H A;  4TUU A;  2KAT A;  3JYS A;  3AU5 A;  5KJM A;  5CMY A;  1IYG A;  3KAE A;  1NA3 A;  2PM7 A;  2IF4 A;  3L16 A;  4ILI A;  2AVP A;  4UWH A;  5CCM A;  3APC A;  1OUV A;  1WAO 1;  2J49 A;  4NRH B;  5G55 A;  1EDU A;  2XCB A;  3RIB A;  1ELW A;  3TJP A;  3TGO A;  2FF4 A;  4WUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...