3SI5A

Kinetochore-bubr1 kinase complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
152
structure length
152
Chain Sequence
TGSQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Blinkin-BUBR1 Complex Reveals an Interaction Crucial for Kinetochore-Mitotic Checkpoint Regulation via an Unanticipated Binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
total genus 64
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08311 Mad3_BUB1_I Mad3/BUB1 homology region 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.430 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3si5A00
2LAHA 4AEZC 3SI5A 2WVIA 4A1GA
chains in the Genus database with same CATH superfamily
4HOUA 3CVQA 4HI9A 2Q7FA 1OCZE 3ZYLA 3PEUB 3U64A 5E75A 1NZNA 3CQGB 4KZ0A 4Y6CA 4I2ZA 2X3MA 1XGWA 3VLFA 3CQCB 4GZ5A 3KSLA 5JHBA 4LRZA 1TNZA 1WY6A 2HM8A 4BTAA 3T5XA 3Q75A 3K9IA 4CEMA 3KEAA 3RK6A 2VSOE 1QNFA 3U4TA 4G1TA 4BSZB 3ASNE 2ETAA 5FQ7A 4UWKA 4PH4B 2BKGA 2WQHA 1N95A 3B7RL 2X6FA 3ZFWA 3DXMG 3AG1E 5D66A 4ZHBA 4GZCA 2Y3AA 4WNEA 2VTBB 4HRNA 4DX7D 4NQ0A 2GGFA 3CHPA 5KJMA 1KPSB 3JCKC 4APOA 3D9LA 3UT4A 3D9IA 3B7BA 4N5CA 5BT1A 3UKRG 2VSYA 4YDOA 4IRUA 4XI9A 1H6OA 1SW6A 2DZNA 1FVFA 5JHAA 5HKPA 3SQVA 3NOCD 1O5MA 3QWWA 4V3IA 4K03A 2ZU6B 4JA7A 4I6GA 3UT7A 1MQSA 1S64A 4FC8A 3IHVA 3CHQA 2GRMA 3KEZA 3VTYA 4B8AA 2IEJA 4B93B 3MEKA 4UWLA 5KWDA 4FJYA 1INZA 5LP0A 4RQIA 4M7CA 4DX1A 4FP7A 3FTVA 3ZYMA 4ANWA 2J07A 1H19A 4GCNA 1EF1C 1KT1A 5ANRA 4PDXA 1EPUA 2R59A 3PUKA 3OTNA 3GZ2A 2EIJE 1SA5A 2CHWA 1NA0A 4JA9A 4U07A 3L08A 3V31A 4HXIA 4GTQA 3DSUA 2IY0C 1IXVA 2DIWA 3AU5A 5T4YA 3DSSA 1FPPA 3Q9NC 3RIBA 3GZSA 4HOTA 1PAQA 3CK7A 4K5BA 3B95A 2NC9A 3LVQE 1ZB1A 1XNFA 5B1AE 3QWVA 3O4ZA 4N3CA 1TYQG 2A5EA 2RD0A 1BU9A 5J08A 4BX9A 4H7YA 3EDTB 5KJKA 2XCCA 4J6IA 3EHNA 1FCHA 5EIBE 3BG1B 4JZYA 2XEHA 2KM4A 1Z6TA 3L82A 2OCCE 3UTMA 5ITZF 3QC1A 2JLBA 4GU5A 3LDZA 1ZU2A 2R2LA 3D9PA 3UM1A 2IF4A 1Z3YA 2LUHA 2XEVA 5C1DA 1U3CA 5ARGA 4O60A 1YYHA 4L9PA 3U9WA 5A6CA 5B3SE 2BTDA 4PS3A 4JC8A 3QWPA 1ELRA 1Y6IA 2WXPA 2KZTB 3FUDA 5DIZA 1H2VC 2H6IA 2Y4UA 4DRXE 1IHBA 4FULA 3ZHEB 4EBAA 1NA3A 2XQ0A 3UT8A 1Y8MA 2X6JA 1MX4A 2IOLA 4HLLA 1OWLA 3I5PA 3D9JA 2C0LA 4KVMA 4UQZA 5G05C 5ENRD 4GA2A 1EYHA 4J8SA 4CDMA 1N0RA 4TUUA 1QQEA 1V54E 2Y4TA 1LD8A 3SF4A 1EDUA 5FINA 1UOHA 1DC2A 2AXVA 2MOWA 3G2VA 2YQ8A 3ZNGA 1LTXA 1N54A 2BEDA 3ZEFA 4EZKA 3V30A 3V79K 3RKVA 4W9RA 2X38A 2ILRA 5KCMA 3CHMA 3Q4AB 3R9MA 5AJLA 3JQ1A 2LSVA 2XRYA 3FUFA 3S7DA 5BXOA 1SZAA 4XX5A 3O48A 1H6KA 2PM7A 5J90A 1E8ZA 1JWGA 4OVVA 2EINE 5FZQA 3G2WA 4CGVA 1JCSA 2ZISA 5KNGA 2KCLA 4GMJA 2PZIA 3LKUA 3OXLA 4WNDA 2DBAA 3ZXSA 3V2XA 2DWZA 3FULA 3CK9A 4HOQA 2XS1A 4UI9J 3PZ3A 2A4ZA 3SGHA 4B89A 2PM6A 3E30A 3PREA 3TL5A 3KD7A 1E7UA 2YHCA 1K1BA 3URZA 4GTPA 4DLOA 3C98A 1WDYA 3ASOE 4A1GA 1HF8A 3TXMA 1E8YA 1E8WA 4B94A 4UI9K 5EX3A 2QY7A 4AJWA 2RG8A 3C72A 1GW6A 3JXJA 3T8KA 3CHSA 5A7DB 5EYLA 1NL4A 3PS6A 3S7BA 2GRRB 5C2YA 4G23A 3F6QA 1WM5A 4BT9A 2FULA 5CCLA 2PL2A 4CDNA 5CERB 3AAAC 4GA1A 4I43A 4CT4A 3Q9UC 3SZ7A 2PQRA 3ZU7B 2R17C 2QC9A 2IJGX 4JEUA 1HG2A 4MKTA 3UUXA 4ANXA 5LX8A 1X81A 2WXQA 4RSYA 4GPKA 4LNGA 3ZYQA 3DEPA 4WUYA 4G8LA 3HVEA 4Q69A 3CSFA 3GZ1A 3BEEA 3P1UA 1S63A 4HVBA 1YA0A 2OV8A 3MKRA 4FHJA 3MX3A 5BNWA 2IFUA 3CVVA 3EHRA 2VGXB 3CKCA 3BUAA 4I1MA 4FADA 3QK0A 2WQ7A 2IOSA 4BY6A 3L9TA 2LO6A 5M72A 2XZTG 3G2UA 2HE0A 5FTPA 3FDHA 3SFXA 4PUCA 1QZ2A 4A55A 2WPVA 3R7RA 2I9CA 4K0RA 3FTUA 4HRMB 3ASFA 4O6FA 4E6HA 5G05J 4K5CA 3NZUA 4C48B 3LXUX 4U95D 1U3DA 3WXXA 1OWPA 2E2EA 2FEZA 1JCRA 1TN8A 4LERA 1RW2A 4OVUA 5KNHD 3DSTA 3EIQC 2OVFA 2XS8A 5HQ8A 3FWVA 4UWGA 1L5JA 1TN6A 2GW1A 1WG0A 2OOEA 3NAWA 1TEZA 2LXLA 1OWMA 3CVUA 3TG4A 4NURA 2M63A 4O1PA 4AY5A 4GZ3A 3APDA 3UM2A 5AQAA 2F8YA 1OUVA 1N52A 3IKOB 3FEXA 3PE4A 3E32A 2KCVA 2GRNB 4LEUA 1DCEA 5AJDA 3E4BA 2WXOA 4PS8A 2XPIA 3HXFA 4D10C 2YINA 3UIPC 2X6IA 3L22A 4JXTA 1IQRA 2V4HC 3SBTB 4L2YA 1KZPA 1HG5A 3DBSA 5B1BE 4AOFA 4BFRA 3LCAA 4GZDA 3CR3A 4E85A 2F8XK 4G11A 3HXDA 3KS2A 2P9NG 2DZOA 3AJIA 1RZ4A 1D8EA 4YNDA 5BPPA 4Z68A 4XZ4A 3PZ2A 4GTSA 4BWRA 3CK8A 1AP7A 1SZ9A 3Q5MA 2C2LA 2V4LA 3EU9A 3FU0A 1NP7A 4F1SA 4JW1A 4GTRA 4LNBA 1V55E 3C5RA 1MJ0A 1TJCA 3FUIA 4ANVA 5BW8C 4IULA 4J8DA 4ACKA 1PY1A 3E33A 3S2AA 2J09A 2P9UG 3TGOA 4JHKA 2IO2C 2IU1A 3TJPA 2JABA 1UJJA 5EIDA 3JQ0A 5CEDB 3C3OA 3CV0A 4N5QA 4J8FA 3PE3A 4U0ZA 2R5SA 1TNOA 2V5QC 5G04C 1MZCA 3I4GA 4YVOA 3UPVA 5JJ7A 2GRPB 4G2VA 4L7TA 4WAFA 3ZUVB 4U7EB 1D9SA 4A1SA 1JPLA 2NYJA 3LY8A 2EIKE 2C0MA 4C0EA 2AW6A 3QARA 1Z5SC 5FZSA 5CBNA 4G8KA 2XZDG 4K5AB 4N2SA 1N9AA 3ESKA 5AENA 5CMYA 4DI4A 3IHYA 4J7WA 5KJNA 2P9LG 5G55A 2LNIA 3UM3A 3EUVA 2P9PG 1ZBPA 4XI0A 4TXPA 4XIFA 1O1SA 3T9KA 4CRWA 3UQ3A 3D3MA 3FFLA 2J49A 3SBSA 3ONKA 3HIZA 5EN5D 3NBNB 2F37A 3FUNA 3TWSA 3FTXA 4P29A 1N94A 3ZIMA 1FT1A 3OAWA 4JL0A 4UI9C 3ASGA 2PNNA 3MA5A 3AS8A 1IQUA 4GZ6A 4DX6D 3RAUA 3PVLA 2RFAA 4CDRA 2VSNA 1OT8A 3CGHA 3FUMA 4NIKA 1HO8A 1LF8A 4YDWA 1O1RA 3Q15A 2R02A 1HH8A 5FJYA 2VGYA 4G26A 4DX5D 3FTZA 3LJNA 3TWVA 4GA0A 2GROB 2WB2A 4ANUA 2X6HA 3LS8A 4XE0A 3KSQA 3RU0A 3NOGD 3ZHEA 2WXHA 1E7VA 3FU5A 3L54A 3PDNA 3RRMB 3ULYA 4YDEA 3ZPJA 4EBAG 2NXPA 5FZRA 4EECA 5LOZA 2XRZA 1VDYA 3E34A 4HORA 2FO7A 3TAXA 5LCWJ 4ILIA 2I2OA 3SFZA 2WMNA 4AY6A 1KLXA 3NQPA 5G2NA 4APFA 2PQNA 3ZGQA 4I17A 4U8YD 3FUJA 2XGSA 3Q73A 4BT8A 2HYZA 4ATZD 3TWTA 4GMLA 2WXIA 4U63A 1SA4A 3C3RA 5EYPF 4KYOB 3ZVVA 4EZLA 3R9AB 1K8KG 4L2LA 4B8CB 5FIOA 2RFMA 4WWPA 3UX4A 3MGBA 3ABLE 1K1AA 5AARA 1X5BA 2AJAA 3KAEA 4RG6A 1S70B 3JUIA 1O1TA 4HNAD 4HOSA 3L17A 5DBKA 2YHEA 5EILA 4KVOA 5ENNA 4GYYA 3CHOA 1ELKA 3ULQA 4BSXA 2ONDA 3FEYA 4G25A 3Q49B 4F6RD 3FH7A 5CRVA 4WWNA 4AIFA 3CVWA 3MZLB 4U96D 2NSZA 3VTXA 1YMPA 1JUQA 2WXKA 3AG2E 2HO1A 5A23A 3CVYA 2OEWA 1TNYA 4J0UA 4I6EA 5AIJA 4HB5A 4EZJA 3B7TA 2RKKA 1HX8A 2L0IA 5ENSD 5ENQD 5FQ4A 1HS6A 5JJTA 1DNPA 1G3NB 1NI1A 2EQXA 2CG2A 3HXCA 4MS6A 1N4RA 1OY3D 4OAUC 3RJVA 3RO3A 4ATGA 4CYMD 2XENA 3FTSA 3R7QA 5BV1A 3D9OA 3EJNA 1N11A 4JPSA 3T8MA 2FI7A 5CHEE 3QNKA 2VGXA 2WM9A 4Q94A 2WXJA 3HHMA 2XCBA 5BXUA 1P5QA 2H6HA 1TN7A 3DSWA 1YCSB 4N39A 4UWFA 2LXMA 2V8SE 2P58C 5AN8A 3HDXA 5AYWD 3HVEB 4FLBA 3CVNA 2J4BA 3ASHA 3QB2A 1IYGA 1N4SA 2EILE 4JHJA 4JHRA 1BI7B 5FWQA 3FUEA 2P9KG 1IHGA 2VQ2A 4DUIA 3SI5A 4NACA 1E90A 1HU3A 2A5UA 4I1AA 5JA4D 5EX0A 3TWRA 1FT2A 1SQMA 3HRAA 5AAOA 2CHZA 4QQIA 3AG3E 3ZN3A 4M3OA 3GW4A 3ULEG 4AEZC 1PC2A 4Y6WA 2GRQB 3AS4A 2AVPA 3EU5A 4KT6B 3Q79A 3TXNA 2LAHA 3PNTB 4BEPA 3CHRA 3W9FA 2CG3A 4RVBA 4F7AA 2CFUA 4RLYA 5LCWC 4HBDA 1U2VG 1DCQA 3ABME 4YDYA 1H2UA 5E76A 4EPZA 2XEEA 2EIME 4FJZA 5CCMA 4EHMA 4ACLA 5CECB 4HFGA 4GTOA 2DVWA 3QOUA 4TUMA 1OCOE 1K3ZD 1OCRE 4GCOA 4AVXA 1KZOA 1JWFA 3RRUA 5ANLA 3FU6A 5D0QD 3B7SA 3PNLB 2XPZA 4BTBA 1KT0A 3HXBA 2B0OE 3MKQB 3UKUG 3AS5A 1H0AA 3JUEA 3FP3A 3SO8A 3LPZA 2R05A 2Y0BG 3FH8A 3DEOA 4AM9A 4NRHB 1TNBA 2Y1LE 5JJ6A 3ONLA 3HXEA 3J5PA 3OXFA 4KZCA 3LJ3A 4U8VD 1MYOA 4JD2G 4XEIG 1QYMA 3PH0C 3D9KA 3MJWA 4L23A 3PZ4A 1B89A 4GTVA 4LCTA 4C0MA 3UI2A 3FY4A 3QJZA 3VLEA 2CFZA 3UINC 3ZYKA 4BERA 4TXQA 1UN9A 3DPYA 3APCA 2AWIA 3UXGA 3D9MA 3PRZA 3BG0B 3S7FA 5ENPD 1DVPA 3NF1A 1MX2A 3I4RB 3FTWA 3PZ1A 2I1JA 4ME2A 3TWWA 5D2MC 1BD8A 3V2OA 4UQXA 5JMND 4U0UA 3Q7FA 5FT9A 2ZIRA 4A3VA 4IYPA 2XHEA 1OXJA 4DX2A 4I6JA 2VSXE 2ETBA 2BUGA 2MHKA 3I3NA 4MBGA 3U66A 3SFYA 5EKQD 2WXFA 2ZGGA 5ARFA 2R03A 4DJAA 2E0IA 2L6BA 1UW4B 2B6CA 3DPDA 3AU4A 3NB2A 1WAO1 2L0TB 4G24A 4OYSA 4LUNU 3UM0A 4J8EA 3IXEA 1D8DA 1QBQA 2VYIA 3SNXA 4U8HA 2WVIA 1Z3XA 2I6HA 3T5VA 3E37A 4FU3A 2WXRA 1A5EA 3ZKJA 2VGEA 3QKYA 4KXKB 4H7XA 2DYRE 2ZGDA 4GAAA 3J5QB 2FBNA 3Q7AA 4HRLA 3JXIA 4TRQA 5LFAA 2ETCA 5FQ8A 5G04J 4I2WA 1OWOA 4QFVA 1LD7A 3G2TA 3SY2A 3TWXA 5BUZA 3L6AA 2MRIA 2QFCA 2CHXA 3FUKA 4WNGA 2F0YA 3APFA 4FHKA 1UJKA 2DCPA 2YNQA 1UN8A 4FLHA 3G2SA 4GMRA 2VTBA 1W3BA 4U0SA 4LG6A 4B0ZA 3ZRHA 4J8YA 3AG4E 4Q96A 2GRLA 2VJ8A 4CZ2D 3RSEG 3X2QE 5IY5E 4L1BA 5BV0A 3FU3A 3CVPA 4PS7A 2WQ6A 4GTTA 5AQ9A 3TWQA 3L13A 1MHQA 2BF0X 4GYWA 4EQFA 4HLEA 4KBQA 4N3BA 4UUCA 1AWCB 4F1PA 4CT0A 3UIOC 4N3AA 3LY7A 2V5FA 3UMVA 1TJFA 2H6FA 5HS0A 2J08A 3IEGA 3NZSA 2KZTA 3SD5A 5HRYA 4HS2A 4ILGA 3FH5A 5HI7A 2ZXWE 4UWHA 3QDNA 1HZ4A 4DK5A 4KMOA 4A63B 3RRNB 1SVXA 5ENOD 2OVBA 3HG0D 5AQBA 1OCCE 1E96B 5CEAA 3L16A 4O1OA 4CCAA 1A17A 1UG3A 4TV3A 3ML9A 2BKKB 2KC7A 2MYOA 2WXGA 4RG9A 4F3VA 2AXUA 4F53A 1HFAA 3ISMC 3CVLA 2QYJA 1ELWA 4HQDA 2DYSE 2WXMA 3LEWA 1N4QA 3CSTA 3RO2A 4JB8P 1S0PA 2P2CP 2IQCA 5KJLA 4DLQA 4UQYA 2L6JA 3IV0A 2Y69E 2HR2A 3P2BA 2J4DA 4FA6A 4U04A 1FVHA 1N0QA 5T3RA 3CIAA 3BQOA 2WXLA 3ASDA 4GYOA 3EHQA 3Q78A 2XPYA 3FTYA 2QZAA 4IN3B 5FQ6A 3DXKG 3MV3B 3TG5A 4N2QA 2J8SD 1H2TC 4A3TA 3VLDA 3Q47B 3MV2B 3LY9A 3GYZA 1N4PA 4DI3A 5T8IA 4BESA 3W9GA 5KBAA 5D0OD 5H7PA 1HE8A 1NFIE 3PZDA 3U3WA 4R7LA 3MCXA 3CEQA 3MYVA 2UY1A 2H6GA 3S7JA 4LSZE 4XKCA 5ENTD 2FO1E 4I1OB 2WXNA 2QYUA 3PEVB 4GPMA 4X8QA 2AXZA 3B13A 5CRUA 3MKQA 2P9IG 3JYSA 1TNUA 2V0PA 4GB9A 3DSVA 3PUJA 2IONA 4I9CA 2KXPC 2P9SG 1MX6A 1HXIA 2LSUA 3ZW3A 4AV7A 3CVXA 4MRUA 3DWLG 3WG7E 4YVQC 4AP2A 4ILHB 1H6PA 2IO3C 4ZFHA 3ML8A 3FUHA 3ZXPA 2KCKA 1OWNA 4ABNA 3OXGA 3ENEA 2I1KA 2XGOA 2KATA 1E8XA 3D9HA 5AQ7A 5CBOA 2WMOA 2OEVA 3CKBA 3IBEA 4LNUD 3D9NA 3CLJA 4DPRA 4OAVB 2L9BA 3N71A 1BLXB 3QAQA 4C9BB 2FF4A 1Q2ZA 2X6KA 3BU8A 3ESLA 4XKBA 1JCQA 4MLPA 2UY1B 5CMWA 1IKND 4WNFA 4TXRA 4AXHA 1BPOA 2XGMA 1BI8B 3FHEA 2KBXA 2J9QA 3DSXA 3B7UX 3EIJA 3SHFA 2LAIA 5EDSA 4BETA 3ABKE 3LVRE 4HI8A 4CGWA 1TR4A 2JEKA 4JVSA 3HYMB 4JEHA 3LYAA 3TWUA 3C3QA 2UWJG 4BX8A 3DRAA 4WWOA 3EHMA 4URKA 4GTMA 4I9EA
chains in the Genus database with same CATH topology
4G24A 4HORA 2FO7A 4LUNU 4HOUA 4OYSA 3TAXA 3CVQA 4ILIA 5LCWJ 2I2OA 2RG8A 3SFZA 2Q7FA 2WMNA 1GW6A 4AY6A 4J8EA 3ZYLA 3PEUB 1KLXA 3CHSA 5A7DB 3U64A 3NQPA 3PS6A 5G2NA 3S7BA 4APFA 5C2YA 2PQNA 5E75A 1NZNA 4G23A 3CQGB 4KZ0A 4Y6CA 3ZGQA 1WM5A 2VYIA 4I17A 4I2ZA 3SNXA 4BT9A 4U8HA 2FULA 2X3MA 2WVIA 5CCLA 1Z3XA 2PL2A 2I6HA 4CDNA 1XGWA 3VLFA 3T5VA 4FU3A 3CQCB 3FUJA 4GZ5A 2WXRA 2XGSA 4LRZA 5JHBA 1WY6A 4GA1A 4I43A 4CT4A 3SZ7A 5BV0A 2HM8A 4BTAA 3T5XA 2PQRA 3QKYA 4KXKB 4H7XA 2R17C 3K9IA 4BT8A 4CEMA 2HYZA 3RK6A 2IJGX 2VSOE 1QNFA 4GMLA 3U4TA 4JEUA 1HG2A 4MKTA 4GAAA 2WXIA 4G1TA 4U63A 2FBNA 3UUXA 4ANXA 5LX8A 2WXQA 5FQ7A 4RSYA 4GPKA 4TRQA 5LFAA 3ZYQA 4UWKA 4PH4B 5FQ8A 5G04J 2WQHA 3B7RL 4I2WA 4WUYA 1OWOA 4QFVA 3HVEA 4Q69A 3CSFA 2X6FA 3GZ1A 3G2TA 4KYOB 3ZFWA 3BEEA 3ZVVA 3P1UA 4EZLA 5BUZA 3L6AA 2MRIA 3R9AB 2QFCA 4GZCA 2CHXA 4HVBA 3FUKA 4L2LA 1YA0A 2OV8A 2Y3AA 4WNEA 4B8CB 2VTBB 3MKRA 4FHJA 4WNGA 3APFA 3MX3A 4FHKA 4WWPA 3UX4A 5BNWA 3MGBA 4NQ0A 2IFUA 1UJKA 2GGFA 3CHPA 2DCPA 5KJMA 3CVVA 2YNQA 3JCKC 4APOA 1UN8A 1X5BA 3D9LA 3UT4A 3D9IA 3KAEA 4N5CA 4FLHA 3G2SA 2VTBA 1W3BA 4U0SA 2VGXB 4RG6A 5BT1A 3CKCA 3JUIA 4B0ZA 2VSYA 4IRUA 4HOSA 3ZRHA 4I1MA 4XI9A 3QK0A 4FADA 2IOSA 2WQ7A 3L17A 5DBKA 2YHEA 4BY6A 2LO6A 5M72A 4KVOA 5ENNA 4Q96A 2GRLA 4GYYA 2VJ8A 3G2UA 1FVFA 5FTPA 3FDHA 5JHAA 4PUCA 3CHOA 1ELKA 3QWWA 4L1BA 1QZ2A 3ULQA 4A55A 2WPVA 4V3IA 4BSXA 3FU3A 2ONDA 3FEYA 4K03A 3R7RA 2I9CA 3CVPA 2ZU6B 4JA7A 4G25A 4K0RA 3Q49B 3FTUA 4PS7A 2WQ6A 4I6GA 3UT7A 3FH7A 4WWNA 1MQSA 3L13A 1MHQA 4AIFA 3CVWA 2BF0X 3ASFA 4GYWA 3MZLB 4O6FA 4E6HA 4EQFA 4HLEA 4FC8A 2NSZA 5G05J 3IHVA 3CHQA 3VTXA 3NZUA 4KBQA 3LXUX 2GRMA 3KEZA 4N3BA 3VTYA 1JUQA 1U3DA 2WXKA 4B8AA 3WXXA 2HO1A 1OWPA 2E2EA 4CT0A 5A23A 2FEZA 3CVYA 3MEKA 4LERA 4N3AA 4UWLA 4OVUA 3LY7A 4FJYA 4J0UA 2V5FA 4I6EA 5AIJA 5LP0A 1INZA 3UMVA 4EZJA 3EIQC 2OVFA 3B7TA 5HQ8A 4FP7A 1TJFA 3FWVA 1HX8A 2J08A 3IEGA 3FTVA 3NZSA 2L0IA 4UWGA 2KZTA 3ZYMA 4ANWA 1L5JA 3SD5A 4HS2A 2J07A 4ILGA 3FH5A 1HS6A 1H19A 2GW1A 2OOEA 5FQ4A 4UWHA 5HI7A 5JJTA 1TEZA 3QDNA 1DNPA 1OWMA 4GCNA 1HZ4A 3TG4A 4DK5A 1EF1C 1KT1A 3CVUA 4KMOA 2EQXA 4NURA 2M63A 5ANRA 2CG2A 3RRNB 2OVBA 4MS6A 4AY5A 3RJVA 4GZ3A 4PDXA 3RO3A 3APDA 1E96B 4ATGA 3FTSA 1EPUA 2R59A 3PUKA 1OUVA 1N52A 3R7QA 5BV1A 3D9OA 3EJNA 3IKOB 3L16A 3OTNA 4JPSA 3T8MA 2FI7A 3FEXA 3GZ2A 3PE4A 2VGXA 2WM9A 1A17A 3QNKA 4Q94A 5CHEE 2KCVA 4CCAA 1UG3A 2CHWA 1NA0A 2WXJA 4LEUA 3HHMA 4JA9A 5AJDA 4TV3A 2XCBA 3E4BA 1P5QA 3ML9A 4U07A 2WXOA 3L08A 4PS8A 2XPIA 2KC7A 4HXIA 4D10C 2YINA 2X6IA 3L22A 4JXTA 2WXGA 1IQRA 3SBTB 2DIWA 4N39A 4UWFA 4L2YA 3AU5A 1HG5A 2V8SE 4RG9A 2P58C 5T4YA 2AXUA 4F3VA 3DBSA 3HDXA 4F53A 5AYWD 3RIBA 1HFAA 4AOFA 3GZSA 3CVLA 4HOTA 1PAQA 3HVEB 4BFRA 3CK7A 1ELWA 4FLBA 3CVNA 3LCAA 2J4BA 2WXMA 3ASHA 3LEWA 2NC9A 3QB2A 3LVQE 4GZDA 1XNFA 1IYGA 3CR3A 4E85A 3QWVA 3O4ZA 4N3CA 4JHJA 2RD0A 3CSTA 4G11A 4JHRA 5J08A 3RO2A 4BX9A 3KS2A 4H7YA 3EDTB 5KJKA 1S0PA 5KJLA 2IQCA 2XCCA 4J6IA 3EHNA 1FCHA 4UQYA 4DLQA 2L6JA 5FWQA 3FUEA 3BG1B 4JZYA 4YNDA 3IV0A 5BPPA 1IHGA 4XZ4A 2KM4A 2VQ2A 1Z6TA 2HR2A 3P2BA 2J4DA 4FA6A 3SI5A 4BWRA 3CK8A 3QC1A 4U04A 1SZ9A 1FVHA 3Q5MA 4NACA 2C2LA 1E90A 5T3RA 2V4LA 2JLBA 4GU5A 3FU0A 1HU3A 1ZU2A 3CIAA 3LDZA 2WXLA 2A5UA 3ASDA 1NP7A 4GYOA 4F1SA 4I1AA 3D9PA 4JW1A 2IF4A 5EX0A 1Z3YA 1SQMA 2XEVA 5C1DA 2XPYA 1U3CA 5ARGA 3FTYA 4IN3B 3U9WA 1TJCA 3FUIA 2CHZA 5FQ6A 4ANVA 5BW8C 5A6CA 3MV3B 4IULA 4J8DA 2BTDA 1PY1A 4PS3A 3ZN3A 3TG5A 4JC8A 4ACKA 4M3OA 4N2QA 3S2AA 3GW4A 2J09A 3QWPA 1ELRA 4AEZC 1Y6IA 1H2TC 2WXPA 1PC2A 4A3TA 3TGOA 4Y6WA 4JHKA 2KZTB 3VLDA 3Q47B 3AS4A 3MV2B 3LY9A 3FUDA 2AVPA 2IU1A 4KT6B 3GYZA 3TXNA 2LAHA 3TJPA 3PNTB 3CHRA 2CG3A 4DI3A 4RVBA 5T8IA 4F7AA 1UJJA 5DIZA 2CFUA 1H2VC 3JQ0A 2Y4UA 5LCWC 5D0OD 3CV0A 4FULA 4J8FA 1H2UA 5E76A 1HE8A 3ZHEB 3PE3A 1NA3A 2XQ0A 4U0ZA 3PZDA 4FJZA 4EBAA 4EPZA 5CCMA 3UT8A 4ACLA 2R5SA 1Y8MA 3U3WA 4R7LA 3MCXA 2X6JA 3CEQA 5G04C 3MYVA 2UY1A 4HFGA 3I4GA 4YVOA 3S7JA 3UPVA 5JJ7A 3QOUA 4G2VA 4L7TA 4XKCA 2IOLA 4WAFA 1OWLA 3I5PA 4I1OB 2WXNA 4GCOA 3D9JA 3PEVB 2C0LA 4AVXA 1JWFA 2AXZA 4A1SA 3B13A 1JPLA 3MKQA 3RRUA 3LY8A 4KVMA 3JYSA 4UQZA 5ANLA 3FU6A 5D0QD 2C0MA 2V0PA 3B7SA 5G05C 4C0EA 3PNLB 2XPZA 4GB9A 3PUJA 4GA2A 2AW6A 2IONA 4I9CA 4BTBA 3QARA 1EYHA 5FZSA 1KT0A 4J8SA 4CDMA 3MKQB 1HXIA 3AS5A 4TUUA 2LSUA 3ZW3A 4AV7A 4N2SA 3CVXA 1QQEA 1H0AA 3FP3A 3ESKA 5AENA 4MRUA 5CMYA 3IHYA 3LPZA 4DI4A 2Y4TA 3FH8A 5KJNA 4AM9A 4NRHB 5G55A 2LNIA 3SF4A 5JJ6A 1EDUA 3ONLA 4YVQC 4AP2A 3OXFA 4KZCA 2AXVA 2MOWA 3G2VA 2YQ8A 4ILHB 3LJ3A 1ZBPA 1N54A 4XI0A 3ML8A 4XIFA 3ZEFA 3FUHA 4CRWA 2KCKA 1OWNA 3UQ3A 4EZKA 3PH0C 4ABNA 3RKVA 3D3MA 3D9KA 4W9RA 3FFLA 3OXGA 3ENEA 3MJWA 2X38A 2J49A 3SBSA 2I1KA 2ILRA 4L23A 3ONKA 5KCMA 3CHMA 3HIZA 3Q4AB 1B89A 4LCTA 3FUNA 4C0MA 2XGOA 5AJLA 3FTXA 3JQ1A 4P29A 2KATA 1E8XA 3FY4A 2LSVA 2XRYA 3QJZA 3VLEA 2CFZA 3FUFA 3S7DA 1SZAA 4XX5A 3ZIMA 2WMOA 3CKBA 3O48A 3OAWA 4JL0A 3ZYKA 1H6KA 3IBEA 2PM7A 4UI9C 3ASGA 5J90A 1E8ZA 3MA5A 3D9NA 1UN9A 3CLJA 1JWGA 3AS8A 4DPRA 4OVVA 5FZQA 2L9BA 3APCA 3N71A 3QAQA 1IQUA 2AWIA 3G2WA 4C9BB 4CGVA 3D9MA 2FF4A 4GZ6A 2X6KA 3PRZA 3BG0B 3ESLA 3S7FA 1DVPA 2KCLA 4XKBA 4MLPA 3NF1A 4GMJA 2PZIA 3I4RB 3PVLA 4CDRA 2UY1B 3LKUA 2VSNA 5CMWA 3FTWA 3OXLA 4WNDA 3CGHA 2I1JA 4ME2A 3FUMA 4WNFA 2DBAA 3ZXSA 1HO8A 4AXHA 1BPOA 1LF8A 2XGMA 4UQXA 3Q15A 3FHEA 4U0UA 1HH8A 3FULA 5FT9A 5FJYA 2J9QA 2VGYA 3CK9A 4G26A 4HOQA 4A3VA 4IYPA 3FTZA 4UI9J 2XHEA 2A4ZA 4GA0A 3SGHA 2PM6A 4B89A 3B7UX 4I6JA 2WB2A 3EIJA 2VSXE 3SHFA 2X6HA 2MHKA 2BUGA 2LAIA 4ANUA 3PREA 5EDSA 3TL5A 3KD7A 1E7UA 3I3NA 3LS8A 2YHCA 4XE0A 3RU0A 3URZA 3U66A 4DLOA 3LVRE 3ZHEA 4CGWA 5EKQD 2JEKA 4JVSA 2WXFA 2WXHA 1E7VA 3C98A 3FU5A 3HYMB 3LYAA 4JEHA 5ARFA 4A1GA 3L54A 3PDNA 1HF8A 2UWJG 3TXMA 4DJAA 1E8YA 3RRMB 2E0IA 4BX8A 1E8WA 1UW4B 4B94A 3ZPJA 4UI9K 4EBAG 4WWOA 3DPDA 2NXPA 3EHMA 5EX3A 5FZRA 3AU4A 4EECA 1WAO1 2QY7A 4URKA 5LOZA 4AJWA 4I9EA 2L0TB 2XRZA 1VDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAH A;  4AEZ C;  3SI5 A;  2WVI A;  4A1G A; 
#chains in the Genus database with same CATH topology
 4HOU A;  3CVQ A;  4HI9 A;  2Q7F A;  1OCZ E;  3ZYL A;  3PEU B;  3U64 A;  5E75 A;  1NZN A;  3CQG B;  4KZ0 A;  4Y6C A;  4I2Z A;  2X3M A;  1XGW A;  3VLF A;  3CQC B;  4GZ5 A;  3KSL A;  5JHB A;  4LRZ A;  1TNZ A;  1WY6 A;  2HM8 A;  4BTA A;  3T5X A;  3Q75 A;  3K9I A;  4CEM A;  3KEA A;  3RK6 A;  2VSO E;  1QNF A;  3U4T A;  4G1T A;  4BSZ B;  3ASN E;  2ETA A;  5FQ7 A;  4UWK A;  4PH4 B;  2BKG A;  2WQH A;  1N95 A;  3B7R L;  2X6F A;  3ZFW A;  3DXM G;  3AG1 E;  5D66 A;  4ZHB A;  4GZC A;  2Y3A A;  4WNE A;  2VTB B;  4HRN A;  4DX7 D;  4NQ0 A;  2GGF A;  3CHP A;  5KJM A;  1KPS B;  3JCK C;  4APO A;  3D9L A;  3UT4 A;  3D9I A;  3B7B A;  4N5C A;  5BT1 A;  3UKR G;  2VSY A;  4YDO A;  4IRU A;  4XI9 A;  1H6O A;  1SW6 A;  2DZN A;  1FVF A;  5JHA A;  5HKP A;  3SQV A;  3NOC D;  1O5M A;  3QWW A;  4V3I A;  4K03 A;  2ZU6 B;  4JA7 A;  4I6G A;  3UT7 A;  1MQS A;  1S64 A;  4FC8 A;  3IHV A;  3CHQ A;  2GRM A;  3KEZ A;  3VTY A;  4B8A A;  2IEJ A;  4B93 B;  3MEK A;  4UWL A;  5KWD A;  4FJY A;  1INZ A;  5LP0 A;  4RQI A;  4M7C A;  4DX1 A;  4FP7 A;  3FTV A;  3ZYM A;  4ANW A;  2J07 A;  1H19 A;  4GCN A;  1EF1 C;  1KT1 A;  5ANR A;  4PDX A;  1EPU A;  2R59 A;  3PUK A;  3OTN A;  3GZ2 A;  2EIJ E;  1SA5 A;  2CHW A;  1NA0 A;  4JA9 A;  4U07 A;  3L08 A;  3V31 A;  4HXI A;  4GTQ A;  3DSU A;  2IY0 C;  1IXV A;  2DIW A;  3AU5 A;  5T4Y A;  3DSS A;  1FPP A;  3Q9N C;  3RIB A;  3GZS A;  4HOT A;  1PAQ A;  3CK7 A;  4K5B A;  3B95 A;  2NC9 A;  3LVQ E;  1ZB1 A;  1XNF A;  5B1A E;  3QWV A;  3O4Z A;  4N3C A;  1TYQ G;  2A5E A;  2RD0 A;  1BU9 A;  5J08 A;  4BX9 A;  4H7Y A;  3EDT B;  5KJK A;  2XCC A;  4J6I A;  3EHN A;  1FCH A;  5EIB E;  3BG1 B;  4JZY A;  2XEH A;  2KM4 A;  1Z6T A;  3L82 A;  2OCC E;  3UTM A;  5ITZ F;  3QC1 A;  2JLB A;  4GU5 A;  3LDZ A;  1ZU2 A;  2R2L A;  3D9P A;  3UM1 A;  2IF4 A;  1Z3Y A;  2LUH A;  2XEV A;  5C1D A;  1U3C A;  5ARG A;  4O60 A;  1YYH A;  4L9P A;  3U9W A;  5A6C A;  5B3S E;  2BTD A;  4PS3 A;  4JC8 A;  3QWP A;  1ELR A;  1Y6I A;  2WXP A;  2KZT B;  3FUD A;  5DIZ A;  1H2V C;  2H6I A;  2Y4U A;  4DRX E;  1IHB A;  4FUL A;  3ZHE B;  4EBA A;  1NA3 A;  2XQ0 A;  3UT8 A;  1Y8M A;  2X6J A;  1MX4 A;  2IOL A;  4HLL A;  1OWL A;  3I5P A;  3D9J A;  2C0L A;  4KVM A;  4UQZ A;  5G05 C;  5ENR D;  4GA2 A;  1EYH A;  4J8S A;  4CDM A;  1N0R A;  4TUU A;  1QQE A;  1V54 E;  2Y4T A;  1LD8 A;  3SF4 A;  1EDU A;  5FIN A;  1UOH A;  1DC2 A;  2AXV A;  2MOW A;  3G2V A;  2YQ8 A;  3ZNG A;  1LTX A;  1N54 A;  2BED A;  3ZEF A;  4EZK A;  3V30 A;  3V79 K;  3RKV A;  4W9R A;  2X38 A;  2ILR A;  5KCM A;  3CHM A;  3Q4A B;  3R9M A;  5AJL A;  3JQ1 A;  2LSV A;  2XRY A;  3FUF A;  3S7D A;  5BXO A;  1SZA A;  4XX5 A;  3O48 A;  1H6K A;  2PM7 A;  5J90 A;  1E8Z A;  1JWG A;  4OVV A;  2EIN E;  5FZQ A;  3G2W A;  4CGV A;  1JCS A;  2ZIS A;  5KNG A;  2KCL A;  4GMJ A;  2PZI A;  3LKU A;  3OXL A;  4WND A;  2DBA A;  3ZXS A;  3V2X A;  2DWZ A;  3FUL A;  3CK9 A;  4HOQ A;  2XS1 A;  4UI9 J;  3PZ3 A;  2A4Z A;  3SGH A;  4B89 A;  2PM6 A;  3E30 A;  3PRE A;  3TL5 A;  3KD7 A;  1E7U A;  2YHC A;  1K1B A;  3URZ A;  4GTP A;  4DLO A;  3C98 A;  1WDY A;  3ASO E;  4A1G A;  1HF8 A;  3TXM A;  1E8Y A;  1E8W A;  4B94 A;  4UI9 K;  5EX3 A;  2QY7 A;  4AJW A;  2RG8 A;  3C72 A;  1GW6 A;  3JXJ A;  3T8K A;  3CHS A;  5A7D B;  5EYL A;  1NL4 A;  3PS6 A;  3S7B A;  2GRR B;  5C2Y A;  4G23 A;  3F6Q A;  1WM5 A;  4BT9 A;  2FUL A;  5CCL A;  2PL2 A;  4CDN A;  5CER B;  3AAA C;  4GA1 A;  4I43 A;  4CT4 A;  3Q9U C;  3SZ7 A;  2PQR A;  3ZU7 B;  2R17 C;  2QC9 A;  2IJG X;  4JEU A;  1HG2 A;  4MKT A;  3UUX A;  4ANX A;  5LX8 A;  1X81 A;  2WXQ A;  4RSY A;  4GPK A;  4LNG A;  3ZYQ A;  3DEP A;  4WUY A;  4G8L A;  3HVE A;  4Q69 A;  3CSF A;  3GZ1 A;  3BEE A;  3P1U A;  1S63 A;  4HVB A;  1YA0 A;  2OV8 A;  3MKR A;  4FHJ A;  3MX3 A;  5BNW A;  2IFU A;  3CVV A;  3EHR A;  2VGX B;  3CKC A;  3BUA A;  4I1M A;  4FAD A;  3QK0 A;  2WQ7 A;  2IOS A;  4BY6 A;  3L9T A;  2LO6 A;  5M72 A;  2XZT G;  3G2U A;  2HE0 A;  5FTP A;  3FDH A;  3SFX A;  4PUC A;  1QZ2 A;  4A55 A;  2WPV A;  3R7R A;  2I9C A;  4K0R A;  3FTU A;  4HRM B;  3ASF A;  4O6F A;  4E6H A;  5G05 J;  4K5C A;  3NZU A;  4C48 B;  3LXU X;  4U95 D;  1U3D A;  3WXX A;  1OWP A;  2E2E A;  2FEZ A;  1JCR A;  1TN8 A;  4LER A;  1RW2 A;  4OVU A;  5KNH D;  3DST A;  3EIQ C;  2OVF A;  2XS8 A;  5HQ8 A;  3FWV A;  4UWG A;  1L5J A;  1TN6 A;  2GW1 A;  1WG0 A;  2OOE A;  3NAW A;  1TEZ A;  2LXL A;  1OWM A;  3CVU A;  3TG4 A;  4NUR A;  2M63 A;  4O1P A;  4AY5 A;  4GZ3 A;  3APD A;  3UM2 A;  5AQA A;  2F8Y A;  1OUV A;  1N52 A;  3IKO B;  3FEX A;  3PE4 A;  3E32 A;  2KCV A;  2GRN B;  4LEU A;  1DCE A;  5AJD A;  3E4B A;  2WXO A;  4PS8 A;  2XPI A;  3HXF A;  4D10 C;  2YIN A;  3UIP C;  2X6I A;  3L22 A;  4JXT A;  1IQR A;  2V4H C;  3SBT B;  4L2Y A;  1KZP A;  1HG5 A;  3DBS A;  5B1B E;  4AOF A;  4BFR A;  3LCA A;  4GZD A;  3CR3 A;  4E85 A;  2F8X K;  4G11 A;  3HXD A;  3KS2 A;  2P9N G;  2DZO A;  3AJI A;  1RZ4 A;  1D8E A;  4YND A;  5BPP A;  4Z68 A;  4XZ4 A;  3PZ2 A;  4GTS A;  4BWR A;  3CK8 A;  1AP7 A;  1SZ9 A;  3Q5M A;  2C2L A;  2V4L A;  3EU9 A;  3FU0 A;  1NP7 A;  4F1S A;  4JW1 A;  4GTR A;  4LNB A;  1V55 E;  3C5R A;  1MJ0 A;  1TJC A;  3FUI A;  4ANV A;  5BW8 C;  4IUL A;  4J8D A;  4ACK A;  1PY1 A;  3E33 A;  3S2A A;  2J09 A;  2P9U G;  3TGO A;  4JHK A;  2IO2 C;  2IU1 A;  3TJP A;  2JAB A;  1UJJ A;  5EID A;  3JQ0 A;  5CED B;  3C3O A;  3CV0 A;  4N5Q A;  4J8F A;  3PE3 A;  4U0Z A;  2R5S A;  1TNO A;  2V5Q C;  5G04 C;  1MZC A;  3I4G A;  4YVO A;  3UPV A;  5JJ7 A;  2GRP B;  4G2V A;  4L7T A;  4WAF A;  3ZUV B;  4U7E B;  1D9S A;  4A1S A;  1JPL A;  2NYJ A;  3LY8 A;  2EIK E;  2C0M A;  4C0E A;  2AW6 A;  3QAR A;  1Z5S C;  5FZS A;  5CBN A;  4G8K A;  2XZD G;  4K5A B;  4N2S A;  1N9A A;  3ESK A;  5AEN A;  5CMY A;  4DI4 A;  3IHY A;  4J7W A;  5KJN A;  2P9L G;  5G55 A;  2LNI A;  3UM3 A;  3EUV A;  2P9P G;  1ZBP A;  4XI0 A;  4TXP A;  4XIF A;  1O1S A;  3T9K A;  4CRW A;  3UQ3 A;  3D3M A;  3FFL A;  2J49 A;  3SBS A;  3ONK A;  3HIZ A;  5EN5 D;  3NBN B;  2F37 A;  3FUN A;  3TWS A;  3FTX A;  4P29 A;  1N94 A;  3ZIM A;  1FT1 A;  3OAW A;  4JL0 A;  4UI9 C;  3ASG A;  2PNN A;  3MA5 A;  3AS8 A;  1IQU A;  4GZ6 A;  4DX6 D;  3RAU A;  3PVL A;  2RFA A;  4CDR A;  2VSN A;  1OT8 A;  3CGH A;  3FUM A;  4NIK A;  1HO8 A;  1LF8 A;  4YDW A;  1O1R A;  3Q15 A;  2R02 A;  1HH8 A;  5FJY A;  2VGY A;  4G26 A;  4DX5 D;  3FTZ A;  3LJN A;  3TWV A;  4GA0 A;  2GRO B;  2WB2 A;  4ANU A;  2X6H A;  3LS8 A;  4XE0 A;  3KSQ A;  3RU0 A;  3NOG D;  3ZHE A;  2WXH A;  1E7V A;  3FU5 A;  3L54 A;  3PDN A;  3RRM B;  3ULY A;  4YDE A;  3ZPJ A;  4EBA G;  2NXP A;  5FZR A;  4EEC A;  5LOZ A;  2XRZ A;  1VDY A;  3E34 A;  4HOR A;  2FO7 A;  3TAX A;  5LCW J;  4ILI A;  2I2O A;  3SFZ A;  2WMN A;  4AY6 A;  1KLX A;  3NQP A;  5G2N A;  4APF A;  2PQN A;  3ZGQ A;  4I17 A;  4U8Y D;  3FUJ A;  2XGS A;  3Q73 A;  4BT8 A;  2HYZ A;  4ATZ D;  3TWT A;  4GML A;  2WXI A;  4U63 A;  1SA4 A;  3C3R A;  5EYP F;  4KYO B;  3ZVV A;  4EZL A;  3R9A B;  1K8K G;  4L2L A;  4B8C B;  5FIO A;  2RFM A;  4WWP A;  3UX4 A;  3MGB A;  3ABL E;  1K1A A;  5AAR A;  1X5B A;  2AJA A;  3KAE A;  4RG6 A;  1S70 B;  3JUI A;  1O1T A;  4HNA D;  4HOS A;  3L17 A;  5DBK A;  2YHE A;  5EIL A;  4KVO A;  5ENN A;  4GYY A;  3CHO A;  1ELK A;  3ULQ A;  4BSX A;  2OND A;  3FEY A;  4G25 A;  3Q49 B;  4F6R D;  3FH7 A;  5CRV A;  4WWN A;  4AIF A;  3CVW A;  3MZL B;  4U96 D;  2NSZ A;  3VTX A;  1YMP A;  1JUQ A;  2WXK A;  3AG2 E;  2HO1 A;  5A23 A;  3CVY A;  2OEW A;  1TNY A;  4J0U A;  4I6E A;  5AIJ A;  4HB5 A;  4EZJ A;  3B7T A;  2RKK A;  1HX8 A;  2L0I A;  5ENS D;  5ENQ D;  5FQ4 A;  1HS6 A;  5JJT A;  1DNP A;  1G3N B;  1NI1 A;  2EQX A;  2CG2 A;  3HXC A;  4MS6 A;  1N4R A;  1OY3 D;  4OAU C;  3RJV A;  3RO3 A;  4ATG A;  4CYM D;  2XEN A;  3FTS A;  3R7Q A;  5BV1 A;  3D9O A;  3EJN A;  1N11 A;  4JPS A;  3T8M A;  2FI7 A;  5CHE E;  3QNK A;  2VGX A;  2WM9 A;  4Q94 A;  2WXJ A;  3HHM A;  2XCB A;  5BXU A;  1P5Q A;  2H6H A;  1TN7 A;  3DSW A;  1YCS B;  4N39 A;  4UWF A;  2LXM A;  2V8S E;  2P58 C;  5AN8 A;  3HDX A;  5AYW D;  3HVE B;  4FLB A;  3CVN A;  2J4B A;  3ASH A;  3QB2 A;  1IYG A;  1N4S A;  2EIL E;  4JHJ A;  4JHR A;  1BI7 B;  5FWQ A;  3FUE A;  2P9K G;  1IHG A;  2VQ2 A;  4DUI A;  3SI5 A;  4NAC A;  1E90 A;  1HU3 A;  2A5U A;  4I1A A;  5JA4 D;  5EX0 A;  3TWR A;  1FT2 A;  1SQM A;  3HRA A;  5AAO A;  2CHZ A;  4QQI A;  3AG3 E;  3ZN3 A;  4M3O A;  3GW4 A;  3ULE G;  4AEZ C;  1PC2 A;  4Y6W A;  2GRQ B;  3AS4 A;  2AVP A;  3EU5 A;  4KT6 B;  3Q79 A;  3TXN A;  2LAH A;  3PNT B;  4BEP A;  3CHR A;  3W9F A;  2CG3 A;  4RVB A;  4F7A A;  2CFU A;  4RLY A;  5LCW C;  4HBD A;  1U2V G;  1DCQ A;  3ABM E;  4YDY A;  1H2U A;  5E76 A;  4EPZ A;  2XEE A;  2EIM E;  4FJZ A;  5CCM A;  4EHM A;  4ACL A;  5CEC B;  4HFG A;  4GTO A;  2DVW A;  3QOU A;  4TUM A;  1OCO E;  1K3Z D;  1OCR E;  4GCO A;  4AVX A;  1KZO A;  1JWF A;  3RRU A;  5ANL A;  3FU6 A;  5D0Q D;  3B7S A;  3PNL B;  2XPZ A;  4BTB A;  1KT0 A;  3HXB A;  2B0O E;  3MKQ B;  3UKU G;  3AS5 A;  1H0A A;  3JUE A;  3FP3 A;  3SO8 A;  3LPZ A;  2R05 A;  2Y0B G;  3FH8 A;  3DEO A;  4AM9 A;  4NRH B;  1TNB A;  2Y1L E;  5JJ6 A;  3ONL A;  3HXE A;  3J5P A;  3OXF A;  4KZC A;  3LJ3 A;  4U8V D;  1MYO A;  4JD2 G;  4XEI G;  1QYM A;  3PH0 C;  3D9K A;  3MJW A;  4L23 A;  3PZ4 A;  1B89 A;  4GTV A;  4LCT A;  4C0M A;  3UI2 A;  3FY4 A;  3QJZ A;  3VLE A;  2CFZ A;  3UIN C;  3ZYK A;  4BER A;  4TXQ A;  1UN9 A;  3DPY A;  3APC A;  2AWI A;  3UXG A;  3D9M A;  3PRZ A;  3BG0 B;  3S7F A;  5ENP D;  1DVP A;  3NF1 A;  1MX2 A;  3I4R B;  3FTW A;  3PZ1 A;  2I1J A;  4ME2 A;  3TWW A;  5D2M C;  1BD8 A;  3V2O A;  4UQX A;  5JMN D;  4U0U A;  3Q7F A;  5FT9 A;  2ZIR A;  4A3V A;  4IYP A;  2XHE A;  1OXJ A;  4DX2 A;  4I6J A;  2VSX E;  2ETB A;  2BUG A;  2MHK A;  3I3N A;  4MBG A;  3U66 A;  3SFY A;  5EKQ D;  2WXF A;  2ZGG A;  5ARF A;  2R03 A;  4DJA A;  2E0I A;  2L6B A;  1UW4 B;  2B6C A;  3DPD A;  3AU4 A;  3NB2 A;  1WAO 1;  2L0T B;  4G24 A;  4OYS A;  4LUN U;  3UM0 A;  4J8E A;  3IXE A;  1D8D A;  1QBQ A;  2VYI A;  3SNX A;  4U8H A;  2WVI A;  1Z3X A;  2I6H A;  3T5V A;  3E37 A;  4FU3 A;  2WXR A;  1A5E A;  3ZKJ A;  2VGE A;  3QKY A;  4KXK B;  4H7X A;  2DYR E;  2ZGD A;  4GAA A;  3J5Q B;  2FBN A;  3Q7A A;  4HRL A;  3JXI A;  4TRQ A;  5LFA A;  2ETC A;  5FQ8 A;  5G04 J;  4I2W A;  1OWO A;  4QFV A;  1LD7 A;  3G2T A;  3SY2 A;  3TWX A;  5BUZ A;  3L6A A;  2MRI A;  2QFC A;  2CHX A;  3FUK A;  4WNG A;  2F0Y A;  3APF A;  4FHK A;  1UJK A;  2DCP A;  2YNQ A;  1UN8 A;  4FLH A;  3G2S A;  4GMR A;  2VTB A;  1W3B A;  4U0S A;  4LG6 A;  4B0Z A;  3ZRH A;  4J8Y A;  3AG4 E;  4Q96 A;  2GRL A;  2VJ8 A;  4CZ2 D;  3RSE G;  3X2Q E;  5IY5 E;  4L1B A;  5BV0 A;  3FU3 A;  3CVP A;  4PS7 A;  2WQ6 A;  4GTT A;  5AQ9 A;  3TWQ A;  3L13 A;  1MHQ A;  2BF0 X;  4GYW A;  4EQF A;  4HLE A;  4KBQ A;  4N3B A;  4UUC A;  1AWC B;  4F1P A;  4CT0 A;  3UIO C;  4N3A A;  3LY7 A;  2V5F A;  3UMV A;  1TJF A;  2H6F A;  5HS0 A;  2J08 A;  3IEG A;  3NZS A;  2KZT A;  3SD5 A;  5HRY A;  4HS2 A;  4ILG A;  3FH5 A;  5HI7 A;  2ZXW E;  4UWH A;  3QDN A;  1HZ4 A;  4DK5 A;  4KMO A;  4A63 B;  3RRN B;  1SVX A;  5ENO D;  2OVB A;  3HG0 D;  5AQB A;  1OCC E;  1E96 B;  5CEA A;  3L16 A;  4O1O A;  4CCA A;  1A17 A;  1UG3 A;  4TV3 A;  3ML9 A;  2BKK B;  2KC7 A;  2MYO A;  2WXG A;  4RG9 A;  4F3V A;  2AXU A;  4F53 A;  1HFA A;  3ISM C;  3CVL A;  2QYJ A;  1ELW A;  4HQD A;  2DYS E;  2WXM A;  3LEW A;  1N4Q A;  3CST A;  3RO2 A;  4JB8 P;  1S0P A;  2P2C P;  2IQC A;  5KJL A;  4DLQ A;  4UQY A;  2L6J A;  3IV0 A;  2Y69 E;  2HR2 A;  3P2B A;  2J4D A;  4FA6 A;  4U04 A;  1FVH A;  1N0Q A;  5T3R A;  3CIA A;  3BQO A;  2WXL A;  3ASD A;  4GYO A;  3EHQ A;  3Q78 A;  2XPY A;  3FTY A;  2QZA A;  4IN3 B;  5FQ6 A;  3DXK G;  3MV3 B;  3TG5 A;  4N2Q A;  2J8S D;  1H2T C;  4A3T A;  3VLD A;  3Q47 B;  3MV2 B;  3LY9 A;  3GYZ A;  1N4P A;  4DI3 A;  5T8I A;  4BES A;  3W9G A;  5KBA A;  5D0O D;  5H7P A;  1HE8 A;  1NFI E;  3PZD A;  3U3W A;  4R7L A;  3MCX A;  3CEQ A;  3MYV A;  2UY1 A;  2H6G A;  3S7J A;  4LSZ E;  4XKC A;  5ENT D;  2FO1 E;  4I1O B;  2WXN A;  2QYU A;  3PEV B;  4GPM A;  4X8Q A;  2AXZ A;  3B13 A;  5CRU A;  3MKQ A;  2P9I G;  3JYS A;  1TNU A;  2V0P A;  4GB9 A;  3DSV A;  3PUJ A;  2ION A;  4I9C A;  2KXP C;  2P9S G;  1MX6 A;  1HXI A;  2LSU A;  3ZW3 A;  4AV7 A;  3CVX A;  4MRU A;  3DWL G;  3WG7 E;  4YVQ C;  4AP2 A;  4ILH B;  1H6P A;  2IO3 C;  4ZFH A;  3ML8 A;  3FUH A;  3ZXP A;  2KCK A;  1OWN A;  4ABN A;  3OXG A;  3ENE A;  2I1K A;  2XGO A;  2KAT A;  1E8X A;  3D9H A;  5AQ7 A;  5CBO A;  2WMO A;  2OEV A;  3CKB A;  3IBE A;  4LNU D;  3D9N A;  3CLJ A;  4DPR A;  4OAV B;  2L9B A;  3N71 A;  1BLX B;  3QAQ A;  4C9B B;  2FF4 A;  1Q2Z A;  2X6K A;  3BU8 A;  3ESL A;  4XKB A;  1JCQ A;  4MLP A;  2UY1 B;  5CMW A;  1IKN D;  4WNF A;  4TXR A;  4AXH A;  1BPO A;  2XGM A;  1BI8 B;  3FHE A;  2KBX A;  2J9Q A;  3DSX A;  3B7U X;  3EIJ A;  3SHF A;  2LAI A;  5EDS A;  4BET A;  3ABK E;  3LVR E;  4HI8 A;  4CGW A;  1TR4 A;  2JEK A;  4JVS A;  3HYM B;  4JEH A;  3LYA A;  3TWU A;  3C3Q A;  2UWJ G;  4BX8 A;  3DRA A;  4WWO A;  3EHM A;  4URK A;  4GTM A;  4I9E A; 
#chains in the Genus database with same CATH homology
 4G24 A;  4HOR A;  2FO7 A;  4LUN U;  4HOU A;  4OYS A;  3TAX A;  3CVQ A;  4ILI A;  5LCW J;  2I2O A;  2RG8 A;  3SFZ A;  2Q7F A;  2WMN A;  1GW6 A;  4AY6 A;  4J8E A;  3ZYL A;  3PEU B;  1KLX A;  3CHS A;  5A7D B;  3U64 A;  3NQP A;  3PS6 A;  5G2N A;  3S7B A;  4APF A;  5C2Y A;  2PQN A;  5E75 A;  1NZN A;  4G23 A;  3CQG B;  4KZ0 A;  4Y6C A;  3ZGQ A;  1WM5 A;  2VYI A;  4I17 A;  4I2Z A;  3SNX A;  4BT9 A;  4U8H A;  2FUL A;  2X3M A;  2WVI A;  5CCL A;  1Z3X A;  2PL2 A;  2I6H A;  4CDN A;  1XGW A;  3VLF A;  3T5V A;  4FU3 A;  3CQC B;  3FUJ A;  4GZ5 A;  2WXR A;  2XGS A;  4LRZ A;  5JHB A;  1WY6 A;  4GA1 A;  4I43 A;  4CT4 A;  3SZ7 A;  5BV0 A;  2HM8 A;  4BTA A;  3T5X A;  2PQR A;  3QKY A;  4KXK B;  4H7X A;  2R17 C;  3K9I A;  4BT8 A;  4CEM A;  2HYZ A;  3RK6 A;  2IJG X;  2VSO E;  1QNF A;  4GML A;  3U4T A;  4JEU A;  1HG2 A;  4MKT A;  4GAA A;  2WXI A;  4G1T A;  4U63 A;  2FBN A;  3UUX A;  4ANX A;  5LX8 A;  2WXQ A;  5FQ7 A;  4RSY A;  4GPK A;  4TRQ A;  5LFA A;  3ZYQ A;  4UWK A;  4PH4 B;  5FQ8 A;  5G04 J;  2WQH A;  3B7R L;  4I2W A;  4WUY A;  1OWO A;  4QFV A;  3HVE A;  4Q69 A;  3CSF A;  2X6F A;  3GZ1 A;  3G2T A;  4KYO B;  3ZFW A;  3BEE A;  3ZVV A;  3P1U A;  4EZL A;  5BUZ A;  3L6A A;  2MRI A;  3R9A B;  2QFC A;  4GZC A;  2CHX A;  4HVB A;  3FUK A;  4L2L A;  1YA0 A;  2OV8 A;  2Y3A A;  4WNE A;  4B8C B;  2VTB B;  3MKR A;  4FHJ A;  4WNG A;  3APF A;  3MX3 A;  4FHK A;  4WWP A;  3UX4 A;  5BNW A;  3MGB A;  4NQ0 A;  2IFU A;  1UJK A;  2GGF A;  3CHP A;  2DCP A;  5KJM A;  3CVV A;  2YNQ A;  3JCK C;  4APO A;  1UN8 A;  1X5B A;  3D9L A;  3UT4 A;  3D9I A;  3KAE A;  4N5C A;  4FLH A;  3G2S A;  2VTB A;  1W3B A;  4U0S A;  2VGX B;  4RG6 A;  5BT1 A;  3CKC A;  3JUI A;  4B0Z A;  2VSY A;  4IRU A;  4HOS A;  3ZRH A;  4I1M A;  4XI9 A;  3QK0 A;  4FAD A;  2IOS A;  2WQ7 A;  3L17 A;  5DBK A;  2YHE A;  4BY6 A;  2LO6 A;  5M72 A;  4KVO A;  5ENN A;  4Q96 A;  2GRL A;  4GYY A;  2VJ8 A;  3G2U A;  1FVF A;  5FTP A;  3FDH A;  5JHA A;  4PUC A;  3CHO A;  1ELK A;  3QWW A;  4L1B A;  1QZ2 A;  3ULQ A;  4A55 A;  2WPV A;  4V3I A;  4BSX A;  3FU3 A;  2OND A;  3FEY A;  4K03 A;  3R7R A;  2I9C A;  3CVP A;  2ZU6 B;  4JA7 A;  4G25 A;  4K0R A;  3Q49 B;  3FTU A;  4PS7 A;  2WQ6 A;  4I6G A;  3UT7 A;  3FH7 A;  4WWN A;  1MQS A;  3L13 A;  1MHQ A;  4AIF A;  3CVW A;  2BF0 X;  3ASF A;  4GYW A;  3MZL B;  4O6F A;  4E6H A;  4EQF A;  4HLE A;  4FC8 A;  2NSZ A;  5G05 J;  3IHV A;  3CHQ A;  3VTX A;  3NZU A;  4KBQ A;  3LXU X;  2GRM A;  3KEZ A;  4N3B A;  3VTY A;  1JUQ A;  1U3D A;  2WXK A;  4B8A A;  3WXX A;  2HO1 A;  1OWP A;  2E2E A;  4CT0 A;  5A23 A;  2FEZ A;  3CVY A;  3MEK A;  4LER A;  4N3A A;  4UWL A;  4OVU A;  3LY7 A;  4FJY A;  4J0U A;  2V5F A;  4I6E A;  5AIJ A;  5LP0 A;  1INZ A;  3UMV A;  4EZJ A;  3EIQ C;  2OVF A;  3B7T A;  5HQ8 A;  4FP7 A;  1TJF A;  3FWV A;  1HX8 A;  2J08 A;  3IEG A;  3FTV A;  3NZS A;  2L0I A;  4UWG A;  2KZT A;  3ZYM A;  4ANW A;  1L5J A;  3SD5 A;  4HS2 A;  2J07 A;  4ILG A;  3FH5 A;  1HS6 A;  1H19 A;  2GW1 A;  2OOE A;  5FQ4 A;  4UWH A;  5HI7 A;  5JJT A;  1TEZ A;  3QDN A;  1DNP A;  1OWM A;  4GCN A;  1HZ4 A;  3TG4 A;  4DK5 A;  1EF1 C;  1KT1 A;  3CVU A;  4KMO A;  2EQX A;  4NUR A;  2M63 A;  5ANR A;  2CG2 A;  3RRN B;  2OVB A;  4MS6 A;  4AY5 A;  3RJV A;  4GZ3 A;  4PDX A;  3RO3 A;  3APD A;  1E96 B;  4ATG A;  3FTS A;  1EPU A;  2R59 A;  3PUK A;  1OUV A;  1N52 A;  3R7Q A;  5BV1 A;  3D9O A;  3EJN A;  3IKO B;  3L16 A;  3OTN A;  4JPS A;  3T8M A;  2FI7 A;  3FEX A;  3GZ2 A;  3PE4 A;  2VGX A;  2WM9 A;  1A17 A;  3QNK A;  4Q94 A;  5CHE E;  2KCV A;  4CCA A;  1UG3 A;  2CHW A;  1NA0 A;  2WXJ A;  4LEU A;  3HHM A;  4JA9 A;  5AJD A;  4TV3 A;  2XCB A;  3E4B A;  1P5Q A;  3ML9 A;  4U07 A;  2WXO A;  3L08 A;  4PS8 A;  2XPI A;  2KC7 A;  4HXI A;  4D10 C;  2YIN A;  2X6I A;  3L22 A;  4JXT A;  2WXG A;  1IQR A;  3SBT B;  2DIW A;  4N39 A;  4UWF A;  4L2Y A;  3AU5 A;  1HG5 A;  2V8S E;  4RG9 A;  2P58 C;  5T4Y A;  2AXU A;  4F3V A;  3DBS A;  3HDX A;  4F53 A;  5AYW D;  3RIB A;  1HFA A;  4AOF A;  3GZS A;  3CVL A;  4HOT A;  1PAQ A;  3HVE B;  4BFR A;  3CK7 A;  1ELW A;  4FLB A;  3CVN A;  3LCA A;  2J4B A;  2WXM A;  3ASH A;  3LEW A;  2NC9 A;  3QB2 A;  3LVQ E;  4GZD A;  1XNF A;  1IYG A;  3CR3 A;  4E85 A;  3QWV A;  3O4Z A;  4N3C A;  4JHJ A;  2RD0 A;  3CST A;  4G11 A;  4JHR A;  5J08 A;  3RO2 A;  4BX9 A;  3KS2 A;  4H7Y A;  3EDT B;  5KJK A;  1S0P A;  5KJL A;  2IQC A;  2XCC A;  4J6I A;  3EHN A;  1FCH A;  4UQY A;  4DLQ A;  2L6J A;  5FWQ A;  3FUE A;  3BG1 B;  4JZY A;  4YND A;  3IV0 A;  5BPP A;  1IHG A;  4XZ4 A;  2KM4 A;  2VQ2 A;  1Z6T A;  2HR2 A;  3P2B A;  2J4D A;  4FA6 A;  3SI5 A;  4BWR A;  3CK8 A;  3QC1 A;  4U04 A;  1SZ9 A;  1FVH A;  3Q5M A;  4NAC A;  2C2L A;  1E90 A;  5T3R A;  2V4L A;  2JLB A;  4GU5 A;  3FU0 A;  1HU3 A;  1ZU2 A;  3CIA A;  3LDZ A;  2WXL A;  2A5U A;  3ASD A;  1NP7 A;  4GYO A;  4F1S A;  4I1A A;  3D9P A;  4JW1 A;  2IF4 A;  5EX0 A;  1Z3Y A;  1SQM A;  2XEV A;  5C1D A;  2XPY A;  1U3C A;  5ARG A;  3FTY A;  4IN3 B;  3U9W A;  1TJC A;  3FUI A;  2CHZ A;  5FQ6 A;  4ANV A;  5BW8 C;  5A6C A;  3MV3 B;  4IUL A;  4J8D A;  2BTD A;  1PY1 A;  4PS3 A;  3ZN3 A;  3TG5 A;  4JC8 A;  4ACK A;  4M3O A;  4N2Q A;  3S2A A;  3GW4 A;  2J09 A;  3QWP A;  1ELR A;  4AEZ C;  1Y6I A;  1H2T C;  2WXP A;  1PC2 A;  4A3T A;  3TGO A;  4Y6W A;  4JHK A;  2KZT B;  3VLD A;  3Q47 B;  3AS4 A;  3MV2 B;  3LY9 A;  3FUD A;  2AVP A;  2IU1 A;  4KT6 B;  3GYZ A;  3TXN A;  2LAH A;  3TJP A;  3PNT B;  3CHR A;  2CG3 A;  4DI3 A;  4RVB A;  5T8I A;  4F7A A;  1UJJ A;  5DIZ A;  2CFU A;  1H2V C;  3JQ0 A;  2Y4U A;  5LCW C;  5D0O D;  3CV0 A;  4FUL A;  4J8F A;  1H2U A;  5E76 A;  1HE8 A;  3ZHE B;  3PE3 A;  1NA3 A;  2XQ0 A;  4U0Z A;  3PZD A;  4FJZ A;  4EBA A;  4EPZ A;  5CCM A;  3UT8 A;  4ACL A;  2R5S A;  1Y8M A;  3U3W A;  4R7L A;  3MCX A;  2X6J A;  3CEQ A;  5G04 C;  3MYV A;  2UY1 A;  4HFG A;  3I4G A;  4YVO A;  3S7J A;  3UPV A;  5JJ7 A;  3QOU A;  4G2V A;  4L7T A;  4XKC A;  2IOL A;  4WAF A;  1OWL A;  3I5P A;  4I1O B;  2WXN A;  4GCO A;  3D9J A;  3PEV B;  2C0L A;  4AVX A;  1JWF A;  2AXZ A;  4A1S A;  3B13 A;  1JPL A;  3MKQ A;  3RRU A;  3LY8 A;  4KVM A;  3JYS A;  4UQZ A;  5ANL A;  3FU6 A;  5D0Q D;  2C0M A;  2V0P A;  3B7S A;  5G05 C;  4C0E A;  3PNL B;  2XPZ A;  4GB9 A;  3PUJ A;  4GA2 A;  2AW6 A;  2ION A;  4I9C A;  4BTB A;  3QAR A;  1EYH A;  5FZS A;  1KT0 A;  4J8S A;  4CDM A;  3MKQ B;  1HXI A;  3AS5 A;  4TUU A;  2LSU A;  3ZW3 A;  4AV7 A;  4N2S A;  3CVX A;  1QQE A;  1H0A A;  3FP3 A;  3ESK A;  5AEN A;  4MRU A;  5CMY A;  3IHY A;  3LPZ A;  4DI4 A;  2Y4T A;  3FH8 A;  5KJN A;  4AM9 A;  4NRH B;  5G55 A;  2LNI A;  3SF4 A;  5JJ6 A;  1EDU A;  3ONL A;  4YVQ C;  4AP2 A;  3OXF A;  4KZC A;  2AXV A;  2MOW A;  3G2V A;  2YQ8 A;  4ILH B;  3LJ3 A;  1ZBP A;  1N54 A;  4XI0 A;  3ML8 A;  4XIF A;  3ZEF A;  3FUH A;  4CRW A;  2KCK A;  1OWN A;  3UQ3 A;  4EZK A;  3PH0 C;  4ABN A;  3RKV A;  3D3M A;  3D9K A;  4W9R A;  3FFL A;  3OXG A;  3ENE A;  3MJW A;  2X38 A;  2J49 A;  3SBS A;  2I1K A;  2ILR A;  4L23 A;  3ONK A;  5KCM A;  3CHM A;  3HIZ A;  3Q4A B;  1B89 A;  4LCT A;  3FUN A;  4C0M A;  2XGO A;  5AJL A;  3FTX A;  3JQ1 A;  4P29 A;  2KAT A;  1E8X A;  3FY4 A;  2LSV A;  2XRY A;  3QJZ A;  3VLE A;  2CFZ A;  3FUF A;  3S7D A;  1SZA A;  4XX5 A;  3ZIM A;  2WMO A;  3CKB A;  3O48 A;  3OAW A;  4JL0 A;  3ZYK A;  1H6K A;  3IBE A;  2PM7 A;  4UI9 C;  3ASG A;  5J90 A;  1E8Z A;  3MA5 A;  3D9N A;  1UN9 A;  3CLJ A;  1JWG A;  3AS8 A;  4DPR A;  4OVV A;  5FZQ A;  2L9B A;  3APC A;  3N71 A;  3QAQ A;  1IQU A;  2AWI A;  3G2W A;  4C9B B;  4CGV A;  3D9M A;  2FF4 A;  4GZ6 A;  2X6K A;  3PRZ A;  3BG0 B;  3ESL A;  3S7F A;  1DVP A;  2KCL A;  4XKB A;  4MLP A;  3NF1 A;  4GMJ A;  2PZI A;  3I4R B;  3PVL A;  4CDR A;  2UY1 B;  3LKU A;  2VSN A;  5CMW A;  3FTW A;  3OXL A;  4WND A;  3CGH A;  2I1J A;  4ME2 A;  3FUM A;  4WNF A;  2DBA A;  3ZXS A;  1HO8 A;  4AXH A;  1BPO A;  1LF8 A;  2XGM A;  4UQX A;  3Q15 A;  3FHE A;  4U0U A;  1HH8 A;  3FUL A;  5FT9 A;  5FJY A;  2J9Q A;  2VGY A;  3CK9 A;  4G26 A;  4HOQ A;  4A3V A;  4IYP A;  3FTZ A;  4UI9 J;  2XHE A;  2A4Z A;  4GA0 A;  3SGH A;  2PM6 A;  4B89 A;  3B7U X;  4I6J A;  2WB2 A;  3EIJ A;  2VSX E;  3SHF A;  2X6H A;  2MHK A;  2BUG A;  2LAI A;  4ANU A;  3PRE A;  5EDS A;  3TL5 A;  3KD7 A;  1E7U A;  3I3N A;  3LS8 A;  2YHC A;  4XE0 A;  3RU0 A;  3URZ A;  3U66 A;  4DLO A;  3LVR E;  3ZHE A;  4CGW A;  5EKQ D;  2JEK A;  4JVS A;  2WXF A;  2WXH A;  1E7V A;  3C98 A;  3FU5 A;  3HYM B;  3LYA A;  4JEH A;  5ARF A;  4A1G A;  3L54 A;  3PDN A;  1HF8 A;  2UWJ G;  3TXM A;  4DJA A;  1E8Y A;  3RRM B;  2E0I A;  4BX8 A;  1E8W A;  1UW4 B;  4B94 A;  3ZPJ A;  4UI9 K;  4EBA G;  4WWO A;  3DPD A;  2NXP A;  3EHM A;  5EX3 A;  5FZR A;  3AU4 A;  4EEC A;  1WAO 1;  2QY7 A;  4URK A;  5LOZ A;  4AJW A;  4I9E A;  2L0T B;  2XRZ A;  1VDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...