3SI5A

Kinetochore-bubr1 kinase complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
152
structure length
152
Chain Sequence
TGSQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
publication title Structure of a Blinkin-BUBR1 Complex Reveals an Interaction Crucial for Kinetochore-Mitotic Checkpoint Regulation via an Unanticipated Binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 64
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08311 Mad3_BUB1_I Mad3/BUB1 homology region 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.430 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3si5A00
4A1GA 4AEZC 2LAHA 2WVIA 3SI5A
chains in the Genus database with same CATH superfamily
3ZW3A 1HG2A 5AYWD 3LY7A 3ZYKA 4NRHB 3FTSA 4OYSA 2L0IA 2MYOA 3FEYA 4G2VA 4GTOA 3IEGA 2EINE 5D0QD 4GA0A 2HO1A 5FWQA 3ZXPA 2QYUA 3BEEA 3PVLA 2MHKA 2OEWA 2IONA 4V3IA 1UJKA 4GTRA 1O1TA 4WAFA 1LTXA 3ISMC 4LEUA 1OWNA 1D8DA 3P2BA 2GW1A 2WXLA 4BTAA 3CVYA 4RVBA 3MGBA 3FUFA 1EF1C 3HIZA 5JJ6A 1Z5SC 3SFXA 1AWCB 3G2WA 3HYMB 4LNBA 2V5FA 4J8SA 1U2VG 2GRQB 3CHSA 3MJWA 1INZA 1X5BA 4AP2A 5B1BE 3X2QE 2R05A 5LCWC 3ASFA 3E30A 3Q4AB 4JHKA 3NB2A 2FEZA 4RG6A 4N3BA 4KYOB 3SD5A 4GYOA 4UQZA 4U07A 1V55E 3LVRE 1SQMA 4BX9A 3MV2B 4CDMA 4JPSA 3VTYA 4XKBA 3CVWA 2IY0C 5KJLA 4FJYA 3SZ7A 2E0IA 1A17A 4UWKA 2OEVA 5G05C 4HI9A 4AIFA 2PQNA 3CVQA 3D9PA 3R9MA 1N52A 3PE4A 1EPUA 3FTYA 5LX8A 2X3MA 1MHQA 1NI1A 1Z3XA 1NA3A 4ACKA 2YNQA 3TJPA 3FHEA 2V4LA 3PZDA 2BF0X 2RKKA 1H2UA 3FH8A 5FQ8A 3ULYA 1ZB1A 3BUAA 4J8FA 3F6QA 1ZBPA 2QFCA 4K03A 2J8SD 3TWUA 2EIME 1K8KG 3CKCA 2MOWA 4FADA 3AU5A 4BT8A 4ABNA 3DEOA 3SFZA 3R9AB 3ZUVB 4XI9A 3LCAA 2L6BA 3ZYMA 3PH0C 3QWPA 1E7VA 1KZOA 1NFIE 3Q49B 2EIKE 3QC1A 1OWLA 5EYPF 3PDNA 5FZQA 4D10C 4K0RA 5G2NA 4J6IA 1QNFA 2ZGGA 2PM7A 3QOUA 2V4HC 4A1GA 3UM1A 5KJMA 4E6HA 3B7TA 1QZ2A 3E33A 3CVPA 4EZKA 4WNDA 2V5QC 4FLHA 2CFZA 2WMNA 3L54A 4JB8P 4PS8A 3HXCA 1Z6TA 4GPMA 1HH8A 2YHEA 3APDA 3DBSA 4AJWA 3KEZA 5HKPA 1A5EA 4G26A 5CCMA 5BT1A 2H6GA 1OUVA 4L2YA 4OAVB 4Q69A 4F53A 5LFAA 1PC2A 3GZSA 2ZGDA 3ESKA 2QY7A 2F8YA 4L7TA 4APFA 1LD8A 3TG4A 5ARFA 5BV1A 5AQAA 4GMRA 3U64A 3JYSA 3KEAA 1DVPA 4WWPA 1JCQA 3SBTB 3HRAA 3IHVA 5EX3A 4AXHA 3RJVA 4K5BA 4AY6A 4A63B 3FULA 4K5CA 2AWIA 4DPRA 3URZA 1HF8A 1S63A 5A7DB 3I5PA 2VSYA 5ANLA 2YINA 2ZIRA 3Q7FA 3NZUA 5FQ4A 3B95A 2J4DA 4JZYA 1SW6A 2J07A 2VGXB 4CYMD 3ZHEB 3V2OA 4XZ4A 2BTDA 4GTVA 3TXMA 2J09A 2XENA 1YA0A 2L0TB 5E76A 3CVNA 3CSFA 4HRNA 2XPZA 4IULA 4UQYA 4CGVA 2IO3C 2VGYA 2P58C 2VGEA 1OT8A 5AN8A 1E8XA 4BSZB 1TN7A 2RD0A 3CHPA 3WXXA 2FBNA 4RG9A 4ILGA 4FP7A 3NAWA 4I6EA 5CRUA 3V2XA 2CHXA 3EU9A 2WPVA 2IFUA 1O1SA 4HBDA 2I1KA 1MX2A 1DCQA 4DX6D 3SY2A 2XZDG 5BXUA 1ZU2A 3JUIA 1JWGA 2J49A 2I2OA 1FVFA 1UW4B 3FUEA 3AJIA 2WXKA 3EU5A 2Y3AA 3L08A 4LERA 3RIBA 2XZTG 3TAXA 4GU5A 4IRUA 4M3OA 3PZ3A 1DNPA 3JXIA 4GTSA 4KT6B 4LNGA 4JA7A 5ARGA 4BTBA 1K3ZD 3FUMA 2B6CA 1HE8A 4U7EB 4DUIA 1JPLA 3C3OA 3PEUB 2DYSE 2AW6A 3QAQA 5AENA 2ILRA 3BU8A 5BW8C 1N95A 4J7WA 3FY4A 3KD7A 4KXKB 3UM3A 1WDYA 3VLEA 4PH4B 2HYZA 1BU9A 5KNGA 1KPSB 3FTVA 3APCA 2OCCE 3UKUG 4NQ0A 4EBAA 3D3MA 5EKQD 4UI9J 2LUHA 3LY9A 4U0SA 3BG0B 3ZYLA 4NURA 2X6FA 4WWOA 1BLXB 3GYZA 1AP7A 4GZ5A 5ITZF 3CQCB 3APFA 1RW2A 3CSTA 2F37A 4WNFA 3N71A 2KZTB 3UINC 3FTUA 4OAUC 5LP0A 3ONKA 3VLFA 3RRUA 3FTZA 3S2AA 2X6IA 1N0QA 3C3RA 2FI7A 2GRPB 4ACLA 1D8EA 4CDNA 3ONLA 3ZXSA 4YDYA 2VTBB 3D9IA 3TXNA 2P9IG 2KBXA 4GA1A 4EZLA 3L22A 4G8KA 2PQRA 1NA0A 3T8KA 2P9UG 3RRNB 1H0AA 4XE0A 2J9QA 3ZYQA 3AG1E 4ILIA 4PS7A 2E2EA 5KJNA 2LNIA 1HU3A 2OVBA 1H2TC 3SHFA 3T5XA 5FIOA 3AS5A 4BY6A 3ASGA 2B0OE 2VQ2A 4O60A 2FF4A 3S7JA 3TWQA 3DSUA 2XPIA 3PNLB 3KSQA 1HG5A 2BKGA 4BT9A 3PZ1A 1TJCA 4BWRA 3W9FA 1WG0A 4DK5A 4I6GA 3AG3E 3FEXA 3AS4A 4N2SA 3TWXA 1IXVA 2UY1B 2Y4TA 3MX3A 4EQFA 3ABKE 5EILA 2NXPA 1N0RA 3EHNA 1ELRA 4FLBA 2P9KG 4CCAA 2RFAA 3FH5A 1YCSB 2DCPA 2IU1A 4DRXE 3RSEG 3CLJA 5KCMA 2GRLA 3E32A 3UIPC 4YDEA 4OVUA 4U04A 4KVOA 3O48A 3IBEA 4TRQA 1Q2ZA 3AAAC 2XEHA 3JUEA 5AIJA 1E7UA 3HG0D 5FTPA 1KT1A 3IKOB 3ASNE 3BG1B 3KAEA 3R7QA 4RLYA 4LCTA 4UUCA 1TEZA 3FU3A 3S7BA 1UJJA 1HZ4A 2VGXA 1OY3D 2A5UA 2V0PA 3ASOE 5KNHD 5BPPA 1EYHA 4JHRA 4JVSA 4A55A 3NBNB 3ZHEA 1KLXA 2R17C 3ENEA 3EHMA 4B94A 4AVXA 4N2QA 2R2LA 4LG6A 1HO8A 5D0OD 4CDRA 2WM9A 4F3VA 4HLLA 3OXLA 1SZ9A 3EIQC 4GYYA 4MLPA 1IQUA 2WXQA 1E96B 2LAHA 5CHEE 4GTMA 2PNNA 3MYVA 2XS8A 2C0MA 4HOSA 2VSNA 2AJAA 5CMWA 4MS6A 4APOA 3ZN3A 3ZIMA 2KXPC 4N5QA 4I1MA 1TNUA 4GZCA 4M7CA 3LDZA 1G3NB 5EX0A 2AXVA 4PS3A 2XCCA 3QNKA 4GAAA 4TXRA 1ELKA 3FTXA 2HM8A 3DXKG 3ZU7B 4C0EA 2WQ6A 3NOGD 3Q75A 4KVMA 3S7DA 1UOHA 2R03A 4LNUD 4DLQA 3FH7A 2CG3A 3G2UA 2WXJA 1TN8A 3GZ2A 1TNBA 1Z3YA 1U3CA 2P9LG 4ZFHA 3V31A 3U9WA 2LAIA 3IXEA 4I2ZA 3SF4A 4BEPA 3HXDA 2NSZA 4IYPA 2XQ0A 2V8SE 3FUIA 3AS8A 3WG7E 3Q79A 3PZ4A 5LCWJ 4U95D 5FQ7A 4ANUA 3PUJA 2WXPA 1N9AA 1TR4A 3UIOC 4Q96A 2WXMA 4H7XA 5C2YA 1OXJA 2H6FA 1WAO1 1KT0A 1MQSA 3LXUX 4UWGA 2LXMA 2ETBA 1S70B 4C0MA 2XGSA 1MZCA 3D9HA 3E34A 2XEVA 2X38A 3I4GA 2KZTA 1UN8A 3RKVA 2DZOA 2FULA 3DWLG 3JQ1A 3S7FA 4I2WA 4MBGA 5G05J 3DSVA 3LY8A 2WXNA 4GZDA 1FCHA 3JQ0A 4YDOA 2VTBA 1IHBA 4EHMA 2PZIA 3TWTA 5EIDA 3DXMG 3K9IA 1NL4A 3MZLB 2C2LA 2KATA 1RZ4A 2ZXWE 3CK9A 4YDWA 2XRZA 1IYGA 3RK6A 2XEEA 4HRMB 2P2CP 2HR2A 4A3VA 2WXHA 1EDUA 5AQ9A 3CIAA 3AG2E 4ZHBA 3PREA 1SA5A 3LYAA 4K5AB 4WUYA 3SQVA 1O1RA 3ASHA 3D9KA 4N3AA 3CVLA 4Q94A 1N4RA 3IV0A 3TL5A 3HXEA 4YVQC 3CV0A 1QBQA 4CT0A 4B8CB 1PAQA 4I6JA 4ANVA 2ZU6B 1N94A 2KCKA 3G2VA 1TNOA 3C3QA 5FJYA 3DEPA 4DX2A 2UY1A 4G1TA 5A6CA 2KCLA 2BUGA 3JCKC 4DI4A 1JCSA 4I1AA 2CHWA 4A1SA 1X81A 3OXGA 5ENPD 3B13A 2WXOA 4HOTA 4TUMA 5G04C 4UI9K 1E8WA 1JWFA 2XHEA 3MCXA 3CHRA 1Y6IA 4I9CA 4PDXA 5CBNA 1OCRE 4N3CA 5HS0A 3CGHA 1DCEA 4XX5A 5JHBA 3OTNA 3CHQA 4BSXA 4OVVA 4J8YA 3ABLE 4DX1A 2VSXE 3ZVVA 1H19A 3P1UA 5CCLA 4L1BA 4BESA 4WNEA 1OCCE 4GPKA 5D2MC 3GW4A 3UPVA 3I3NA 3MEKA 5KJKA 3FUJA 3L82A 2L6JA 4B8AA 4BERA 5CBOA 2RG8A 4HOUA 2F0YA 3CK7A 2NYJA 4GZ6A 4I17A 4XKCA 3MKQB 5T3RA 1YYHA 2DYRE 4LSZE 3DPDA 1TYQG 5JHAA 4QQIA 3Q78A 3SNXA 4CGWA 2EQXA 3FP3A 4DI3A 5AARA 1W3BA 3UM0A 5C1DA 1BI7B 2R5SA 5HI7A 3HVEB 2GGFA 1MYOA 1MJ0A 2LO6A 4O1OA 4AV7A 3FUNA 1QQEA 5G55A 4GCNA 3LJNA 1TN6A 2ETAA 4U8VD 3BQOA 3UKRG 2PL2A 3LS8A 4NIKA 3TGOA 1U3DA 3UTMA 2GROB 3NQPA 1OWMA 3CEQA 2GRNB 2P9NG 1XNFA 2YHCA 5CEDB 5M72A 4KZCA 4YVOA 3TWWA 4A3TA 4MRUA 2P9PG 3Q5MA 1UG3A 2OV8A 3FDHA 2I9CA 3QWWA 3ZGQA 1FPPA 5DBKA 3D9NA 4FU3A 3LJ3A 3G2SA 1O5MA 4R7LA 4C9BB 4FULA 1NP7A 2HE0A 4TV3A 1ELWA 1D9SA 4IN3B 2WXRA 2WXFA 2X6KA 2Q7FA 1TNYA 4HOQA 2A5EA 3FU0A 4LUNU 4U8YD 4U8HA 2VYIA 1H6PA 4U63A 4J8DA 3ULEG 3ASDA 5BNWA 4KMOA 4WNGA 5B3SE 4ANXA 4L9PA 2WQHA 1YMPA 3UT4A 3ZKJA 5AJLA 1KZPA 3ML9A 4EBAG 2M63A 2QZAA 3FUDA 4N39A 3KS2A 5CEAA 3NF1A 4WWNA 4XIFA 4HORA 4TUUA 3U4TA 4GYWA 2EIJE 3FTWA 3AG4E 4B89A 3Q9NC 1B89A 4HI8A 3B7SA 2A4ZA 4JW1A 2LSVA 3NZSA 3ML8A 4J8EA 3J5PA 2VSOE 2CG2A 3B7UX 4DJAA 3T8MA 4RQIA 4RSYA 4P29A 3RO2A 3FWVA 3FFLA 1H2VC 1LF8A 5EDSA 2JLBA 4BX8A 1E8ZA 3PRZA 4JHJA 3LPZA 4UWFA 3HDXA 4AEZC 1QYMA 2C0LA 5CECB 3UUXA 3CVVA 3Q15A 3C5RA 5ENSD 4EPZA 2XCBA 4FHJA 1S64A 3CVUA 1OWOA 3W9GA 4GTTA 5BUZA 3TWVA 2Y0BG 5BXOA 3TWRA 3QK0A 1P5QA 3C98A 3UMVA 4E85A 1MX4A 4F7AA 3RRMB 2VJ8A 2GRMA 1IQRA 1HS6A 3L6AA 1FVHA 3T5VA 1N11A 2XGOA 5T8IA 5CERB 3AU4A 2DWZA 3CKBA 3SFYA 4CRWA 2CHZA 1HX8A 3HXBA 4UQXA 5B1AE 2IEJA 4FHKA 3Q9UC 3GZ1A 3QJZA 3QDNA 3UXGA 4URKA 2BKKB 4HXIA 3MV3B 3MA5A 3G2TA 1NZNA 3PUKA 2BEDA 3B7BA 5KWDA 1V54E 3SI5A 4MKTA 3CVXA 1BPOA 2R02A 1SVXA 4BFRA 2WVIA 4CT4A 5AQ7A 2IQCA 3FUHA 3UT7A 1H6KA 3D9MA 3E4BA 1E90A 4J0UA 3ULQA 2J08A 3MKQA 4HRLA 3L16A 3EDTB 3KSLA 3EUVA 2LXLA 2P9SG 2XPYA 3QKYA 3ABME 4HLEA 3DSWA 4TXPA 5JJTA 4PUCA 4G25A 4GMJA 1PY1A 4F6RD 3O4ZA 4ME2A 4JD2G 3HVEA 3PZ2A 2AXUA 1SZAA 1FT1A 4JA9A 4DX5D 2R59A 3R7RA 3TWSA 1SA4A 4AM9A 4I43A 5EYLA 2EILE 3VLDA 2IJGX 3RU0A 4JEUA 1H6OA 4FC8A 5JMND 5ENQD 2DZNA 4HS2A 4HNAD 2UWJG 1IHGA 1BI8B 1UN9A 4HQDA 2Y69E 1OCZE 3CHMA 4F1SA 1DC2A 1S0PA 4I9EA 4CZ2D 2I1JA 5BV0A 1TJFA 5EN5D 3NOCD 5FINA 2WMOA 1JUQA 4GZ3A 2KCVA 1L5JA 2IO2C 5KBAA 2CFUA 1N54A 2DBAA 2DVWA 4GMLA 3D9OA 1K1AA 2YQ8A 4QFVA 3ZNGA 2IF4A 2ZISA 2MRIA 4EECA 4C48B 3DRAA 4L23A 5ENNA 5DIZA 2XRYA 5J08A 4HB5A 3L13A 3TG5A 3V79K 4EZJA 3ZRHA 1OCOE 3PS6A 5JA4D 1LD7A 4ILHB 2QYJA 2GRRB 4U0ZA 2FO7A 4DLOA 4W9RA 3U66A 4UWLA 2F8XK 5LOZA 3CHOA 3C72A 4X8QA 4UI9C 4B93B 4L2LA 4YNDA 3DSSA 4JEHA 3D9LA 2OOEA 2KC7A 3L9TA 2FO1E 2JABA 1E8YA 4AOFA 5H7PA 3I4RB 5FZSA 4U0UA 3DSXA 1HXIA 2WXIA 5AQBA 3VTXA 2X6JA 2WXGA 4CEMA 5HQ8A 3QWVA 5A23A 2H6HA 1HFAA 5EIBE 3CK8A 3EJNA 4AY5A 3SGHA 3PEVB 3SO8A 5AJDA 1GW6A 4H7YA 3LKUA 2OVFA 3EHRA 4I1OB 5JJ7A 2WQ7A 3V30A 3ESLA 3MKRA 2WB2A 2IOLA 4ANWA 3FUKA 2XGMA 4U96D 1WM5A 3LEWA 1OWPA 3SBSA 1FT2A 5T4YA 4ATZD 3PNTB 2L9BA 2NC9A 5FQ6A 5CMYA 4FA6A 1IKND 4JXTA 4G11A 1JCRA 4O6FA 3B7RL 1TNZA 3FU5A 4GCOA 4G24A 2LSUA 2IOSA 3E37A 3RAUA 1N4QA 3HXFA 3ZPJA 3U3WA 5CRVA 3UM2A 4GTPA 3DPYA 3T9KA 4KZ0A 4GB9A 5IY5E 4NACA 3QB2A 5FT9A 2DIWA 3ZEFA 4O1PA 4KBQA 1BD8A 4Z68A 5D66A 1VDYA 3OAWA 5ANRA 3QARA 1XGWA 4LRZA 4Y6CA 3CR3A 2AXZA 4XI0A 5ENOD 3Q47B 5G04J 3LVQE 2ONDA 2RFMA 2QC9A 3D9JA 4HVBA 5ENTD 3EHQA 2Y4UA 4FJZA 4XEIG 3OXFA 4DX7D 3JXJA 3UI2A 5HRYA 4ATGA 3Q73A 1MX6A 3PE3A 3Q7AA 4F1PA 1N4PA 4TXQA 1WY6A 5E75A 3UX4A 5FZRA 4N5CA 4UWHA 4GA2A 2AVPA 1K1BA 4G23A 3L17A 2KM4A 2JEKA 5AAOA 3DSTA 3J5QB 4G8LA 4JC8A 4Y6WA 2I6HA 3ZFWA 2PM6A 4B0ZA 2X6HA 3CQGB 3RO3A 2ETCA 4GTQA 2XS1A 5ENRD 1N4SA 2J4BA 3IHYA 3HHMA 5J90A 4BETA 3UQ3A 3FU6A 3EIJA 3UT8A 2H6IA 4JL0A 2Y1LE 4HFGA 1Y8MA
chains in the Genus database with same CATH topology
3QJZA 2Y3AA 3ZW3A 2PZIA 3L08A 3QDNA 1HG2A 5AYWD 3K9IA 4LERA 3LY7A 4URKA 3RIBA 3MZLB 2C2LA 2KATA 3ZYKA 4HXIA 3MV3B 4NRHB 3TAXA 3CK9A 4GU5A 3FTSA 4IRUA 4M3OA 4OYSA 2XRZA 3MA5A 3G2TA 1IYGA 1DNPA 2L0IA 3RK6A 1NZNA 3FEYA 3PUKA 4G2VA 4KT6B 2HR2A 3SI5A 4MKTA 3IEGA 1BPOA 3CVXA 4JA7A 5ARGA 4A3VA 4BTBA 4BFRA 5D0QD 2WVIA 2WXHA 3FUMA 1EDUA 4GA0A 4CT4A 3CIAA 1HE8A 2HO1A 1JPLA 5FWQA 3PREA 2IQCA 3FUHA 3PEUB 1H6KA 3LYAA 4WUYA 3UT7A 2AW6A 3ASHA 3BEEA 3D9MA 3D9KA 3E4BA 2ILRA 3QAQA 5BW8C 5AENA 3PVLA 2MHKA 3CVLA 2IONA 4N3AA 1E90A 1UJKA 3FY4A 3KD7A 4J0UA 4KXKB 4V3IA 4Q94A 3ULQA 3VLEA 2J08A 4PH4B 3IV0A 4WAFA 2HYZA 3TL5A 4YVQC 4LEUA 3CV0A 3FTVA 3MKQA 3APCA 4CT0A 4B8CB 1OWNA 1PAQA 4I6JA 4ANVA 2ZU6B 4NQ0A 4EBAA 3P2BA 3D3MA 2GW1A 2WXLA 2KCKA 3L16A 5EKQD 3EDTB 3G2VA 4BTAA 4UI9J 3CVYA 5FJYA 3LY9A 4U0SA 4RVBA 3MGBA 3BG0B 2XPYA 3QKYA 2UY1A 4NURA 4G1TA 3ZYLA 2X6FA 3FUFA 4WWOA 5A6CA 2KCLA 4HLEA 2BUGA 1EF1C 3GYZA 3JCKC 4DI4A 3HIZA 4I1AA 5JJ6A 2CHWA 4GZ5A 5JJTA 4PUCA 4G25A 4GMJA 1PY1A 3CQCB 4A1SA 3OXGA 3O4ZA 3G2WA 3APFA 3HYMB 3B13A 4ME2A 3HVEA 2V5FA 2WXOA 4HOTA 4J8SA 3CSTA 4WNFA 3CHSA 3N71A 3MJWA 1INZA 5G04C 1X5BA 2AXUA 2KZTB 4AP2A 4UI9K 1E8WA 1JWFA 2XHEA 3MCXA 1SZAA 3FTUA 3CHRA 1Y6IA 4I9CA 4PDXA 5LCWC 5LP0A 4JA9A 4N3CA 3ONKA 2R59A 3VLFA 3CGHA 3ASFA 3R7RA 3RRUA 3FTZA 4XX5A 3S2AA 2X6IA 3Q4AB 4JHKA 4AM9A 4I43A 2FI7A 4ACLA 5JHBA 4CDNA 3VLDA 2IJGX 3ONLA 3RU0A 3ZXSA 3OTNA 2FEZA 4RG6A 3CHQA 4N3BA 3D9IA 3TXNA 2VTBB 4GA1A 4KYOB 4BSXA 4JEUA 3SD5A 4EZLA 4OVVA 4FC8A 3L22A 4GYOA 2PQRA 4HS2A 1NA0A 2VSXE 3ZVVA 3RRNB 1H19A 4UQZA 2UWJG 1IHGA 3P1UA 1H0AA 5CCLA 4U07A 1UN9A 4XE0A 2J9QA 3LVRE 4ILIA 3ZYQA 1SQMA 4BX9A 4PS7A 4L1BA 2E2EA 3MV2B 5KJNA 2LNIA 1HU3A 2OVBA 1H2TC 3SHFA 4CDMA 3CHMA 4JPSA 3T5XA 4XKBA 3VTYA 4F1SA 4WNEA 3CVWA 4GPKA 1S0PA 4I9EA 3AS5A 2I1JA 5BV0A 5KJLA 1TJFA 4FJYA 3GW4A 4BY6A 3ASGA 3UPVA 3I3NA 3SZ7A 3MEKA 5KJKA 3FUJA 2E0IA 1A17A 2L6JA 2VQ2A 2WMOA 4UWKA 1JUQA 4B8AA 2RG8A 2FF4A 5G05C 4HOUA 3S7JA 4AIFA 2XPIA 4GZ3A 2KCVA 3PNLB 1L5JA 1HG5A 2PQNA 3CK7A 3CVQA 3D9PA 4BT9A 4GZ6A 4I17A 1TJCA 1N52A 1N54A 2CFUA 1EPUA 2DBAA 3PE4A 4GMLA 3D9OA 4BWRA 4XKCA 3MKQB 3FTYA 4I6GA 5T3RA 4DK5A 5LX8A 2X3MA 2YQ8A 4QFVA 1MHQA 1Z3XA 2IF4A 1NA3A 3FEXA 3AS4A 4N2SA 2MRIA 4EECA 4ACKA 2YNQA 3DPDA 3TJPA 5JHAA 3FHEA 2V4LA 3PZDA 2BF0X 4L23A 2UY1B 5DIZA 2Y4TA 3MX3A 5ENNA 3SNXA 4CGWA 4EQFA 2EQXA 1H2UA 2XRYA 3FH8A 3FP3A 4DI3A 5FQ8A 1W3BA 5J08A 5C1DA 4J8FA 2R5SA 5HI7A 2NXPA 3L13A 3HVEB 3EHNA 3TG5A 1ELRA 1ZBPA 2QFCA 4FLBA 2GGFA 4EZJA 3ZRHA 3PS6A 2LO6A 4K03A 4CCAA 4AV7A 3FH5A 3FUNA 2DCPA 2IU1A 4ILHB 1QQEA 3CKCA 5G55A 4GCNA 2MOWA 3CLJA 5KCMA 4FADA 3AU5A 4BT8A 2GRLA 4U0ZA 4ABNA 2FO7A 3SFZA 4DLOA 3R9AB 4XI9A 4W9RA 3LCAA 3U66A 4UWLA 5LOZA 3CHOA 2PL2A 4OVUA 4U04A 4KVOA 3ZYMA 3LS8A 3PH0C 3TGOA 4UI9C 4L2LA 3QWPA 3O48A 1E7VA 1U3DA 3GZ1A 4JEHA 4YNDA 3IBEA 4TRQA 3Q49B 3QC1A 3D9LA 5AIJA 3NQPA 1E7UA 1OWMA 2OOEA 3CEQA 5FTPA 1OWLA 1KT1A 3PDNA 2KC7A 3IKOB 5FZQA 4D10C 4K0RA 1XNFA 2YHCA 5G2NA 3BG1B 3KAEA 4J6IA 1QNFA 1E8YA 5M72A 4AOFA 3R7QA 2PM7A 4KZCA 4YVOA 4A3TA 3QOUA 4MRUA 3I4RB 5FZSA 4U0UA 4A1GA 3Q5MA 1HXIA 1UG3A 2OV8A 3FDHA 2WXIA 2I9CA 3QWWA 3VTXA 4LCTA 2X6JA 3ZGQA 1TEZA 2WXGA 3FU3A 3S7BA 1UJJA 4E6HA 5KJMA 1HZ4A 3B7TA 1QZ2A 2VGXA 5DBKA 3D9NA 4CEMA 5HQ8A 2A5UA 4FU3A 3LJ3A 3QWVA 3CVPA 2V0PA 4EZKA 5A23A 4WNDA 4FLHA 2CFZA 3G2SA 1HFAA 5BPPA 1EYHA 2WMNA 4JHRA 4R7LA 4JVSA 4A55A 4C9BB 3CK8A 3ZHEA 1KLXA 2R17C 3ENEA 4FULA 3EJNA 3EHMA 3L54A 3SGHA 4AY5A 1NP7A 3PEVB 4B94A 4AVXA 5AJDA 4N2QA 4TV3A 1ELWA 4PS8A 1GW6A 4H7YA 3LKUA 2OVFA 1Z6TA 4I1OB 4IN3B 5JJ7A 2WXRA 2WQ7A 1HH8A 2WXFA 2YHEA 3ESLA 1HO8A 2X6KA 3APDA 2Q7FA 5D0OD 3DBSA 3MKRA 2WB2A 4AJWA 4CDRA 2WM9A 3KEZA 4F3VA 2IOLA 4G26A 3OXLA 4ANWA 5CCMA 3FUKA 2XGMA 5BT1A 4HOQA 1OUVA 4L2YA 3FU0A 1SZ9A 3EIQC 4GYYA 1WM5A 3LEWA 4MLPA 4Q69A 4LUNU 1IQUA 4F53A 4U8HA 1OWPA 2VYIA 1E96B 2LAHA 2WXQA 1PC2A 5LFAA 3GZSA 3SBSA 5CHEE 5T4YA 4U63A 4J8DA 3PNTB 3MYVA 3ESKA 2C0MA 3ASDA 5BNWA 2QY7A 2L9BA 2VSNA 4HOSA 2NC9A 5FQ6A 4KMOA 4WNGA 5CMYA 5CMWA 4ANXA 4FA6A 4L7TA 2WQHA 4MS6A 4JXTA 4APFA 3UT4A 4G11A 3TG4A 5AJLA 4APOA 4O6FA 3B7RL 3ZN3A 3FU5A 3ZIMA 4GCOA 4G24A 3ML9A 2LSUA 4I1MA 5ARFA 2IOSA 2M63A 4EBAG 5BV1A 3FUDA 4N39A 3KS2A 4GZCA 3ZPJA 3LDZA 3JYSA 3U64A 5EX0A 3U3WA 3NF1A 2AXVA 4PS3A 2XCCA 4WWNA 4XIFA 1DVPA 4WWPA 3QNKA 4GAAA 3SBTB 4HORA 1ELKA 4TUUA 3U4TA 3FTXA 2HM8A 4GYWA 3IHVA 4KZ0A 5EX3A 4AXHA 3RJVA 4AY6A 4GB9A 3FTWA 4C0EA 3FULA 2AWIA 4DPRA 2WQ6A 4B89A 3URZA 4KVMA 1HF8A 4NACA 5A7DB 3S7DA 1B89A 3I5PA 2VSYA 3B7SA 2A4ZA 3QB2A 5ANLA 2YINA 4DLQA 4JW1A 3FH7A 2LSVA 3NZSA 3ML8A 2CG3A 3NZUA 4J8EA 5FQ4A 5FT9A 2VSOE 3G2UA 2WXJA 2DIWA 2J4DA 3ZEFA 2CG2A 3B7UX 4JZYA 2J07A 2VGXB 4KBQA 4DJAA 3GZ2A 3T8MA 4RSYA 1VDYA 4P29A 3OAWA 1Z3YA 5ANRA 3RO2A 1U3CA 3QARA 1XGWA 3FWVA 3FFLA 4LRZA 1H2VC 4Y6CA 3U9WA 1LF8A 3ZHEB 5EDSA 2LAIA 3CR3A 2AXZA 4I2ZA 2JLBA 3SF4A 4XI0A 4BX8A 1E8ZA 3PRZA 2NSZA 4IYPA 3Q47B 4JHJA 3LPZA 4XZ4A 2BTDA 4UWFA 3HDXA 2XQ0A 2V8SE 4AEZC 3FUIA 2C0LA 3AS8A 5G04J 3UUXA 3CVVA 3LVQE 3TXMA 2J09A 3Q15A 1YA0A 2ONDA 2L0TB 2XCBA 4FHJA 5E76A 4EPZA 5LCWJ 3CVNA 5FQ7A 3D9JA 3CSFA 3CVUA 4HVBA 1OWOA 2XPZA 4IULA 2Y4UA 4FJZA 3OXFA 4UQYA 5BUZA 4ANUA 3PUJA 2WXPA 4ATGA 4CGVA 3QK0A 1P5QA 2VGYA 2P58C 3PE3A 4Q96A 3C98A 2WXMA 4H7XA 1E8XA 5C2YA 3UMVA 4E85A 1WAO1 4F7AA 1KT0A 1WY6A 5E75A 1MQSA 5FZRA 3RRMB 3LXUX 3UX4A 4UWGA 2RD0A 3CHPA 4N5CA 4UWHA 3WXXA 2FBNA 4GA2A 4RG9A 2AVPA 4ILGA 2VJ8A 4FP7A 4C0MA 4G23A 3L17A 2GRMA 2KM4A 4I6EA 1IQRA 2JEKA 2XGSA 2CHXA 1HS6A 3L6AA 2WPVA 4JC8A 2XEVA 2X38A 4Y6WA 1FVHA 2I6HA 2IFUA 3I4GA 2KZTA 3T5VA 2I1KA 1UN8A 3RKVA 3ZFWA 2XGOA 2PM6A 4B0ZA 2X6HA 3CQGB 3RO3A 2FULA 5T8IA 3AU4A 3CKBA 4CRWA 3JQ1A 1ZU2A 2J4BA 3S7FA 3IHYA 4I2WA 5G05J 2CHZA 1HX8A 3HHMA 3JUIA 4UQXA 1JWGA 3LY8A 2WXNA 4GZDA 5J90A 3UQ3A 3FU6A 2J49A 3EIJA 2I2OA 3UT8A 1FVFA 1FCHA 1UW4B 3FUEA 4FHKA 4JL0A 3JQ0A 2VTBA 4HFGA 2WXKA 1Y8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A1G A;  4AEZ C;  2LAH A;  2WVI A;  3SI5 A; 
#chains in the Genus database with same CATH topology
 3ZW3 A;  1HG2 A;  5AYW D;  3LY7 A;  3ZYK A;  4NRH B;  3FTS A;  4OYS A;  2L0I A;  2MYO A;  3FEY A;  4G2V A;  4GTO A;  3IEG A;  2EIN E;  5D0Q D;  4GA0 A;  2HO1 A;  5FWQ A;  3ZXP A;  2QYU A;  3BEE A;  3PVL A;  2MHK A;  2OEW A;  2ION A;  4V3I A;  1UJK A;  4GTR A;  1O1T A;  4WAF A;  1LTX A;  3ISM C;  4LEU A;  1OWN A;  1D8D A;  3P2B A;  2GW1 A;  2WXL A;  4BTA A;  3CVY A;  4RVB A;  3MGB A;  3FUF A;  1EF1 C;  3HIZ A;  5JJ6 A;  1Z5S C;  3SFX A;  1AWC B;  3G2W A;  3HYM B;  4LNB A;  2V5F A;  4J8S A;  1U2V G;  2GRQ B;  3CHS A;  3MJW A;  1INZ A;  1X5B A;  4AP2 A;  5B1B E;  3X2Q E;  2R05 A;  5LCW C;  3ASF A;  3E30 A;  3Q4A B;  4JHK A;  3NB2 A;  2FEZ A;  4RG6 A;  4N3B A;  4KYO B;  3SD5 A;  4GYO A;  4UQZ A;  4U07 A;  1V55 E;  3LVR E;  1SQM A;  4BX9 A;  3MV2 B;  4CDM A;  4JPS A;  3VTY A;  4XKB A;  3CVW A;  2IY0 C;  5KJL A;  4FJY A;  3SZ7 A;  2E0I A;  1A17 A;  4UWK A;  2OEV A;  5G05 C;  4HI9 A;  4AIF A;  2PQN A;  3CVQ A;  3D9P A;  3R9M A;  1N52 A;  3PE4 A;  1EPU A;  3FTY A;  5LX8 A;  2X3M A;  1MHQ A;  1NI1 A;  1Z3X A;  1NA3 A;  4ACK A;  2YNQ A;  3TJP A;  3FHE A;  2V4L A;  3PZD A;  2BF0 X;  2RKK A;  1H2U A;  3FH8 A;  5FQ8 A;  3ULY A;  1ZB1 A;  3BUA A;  4J8F A;  3F6Q A;  1ZBP A;  2QFC A;  4K03 A;  2J8S D;  3TWU A;  2EIM E;  1K8K G;  3CKC A;  2MOW A;  4FAD A;  3AU5 A;  4BT8 A;  4ABN A;  3DEO A;  3SFZ A;  3R9A B;  3ZUV B;  4XI9 A;  3LCA A;  2L6B A;  3ZYM A;  3PH0 C;  3QWP A;  1E7V A;  1KZO A;  1NFI E;  3Q49 B;  2EIK E;  3QC1 A;  1OWL A;  5EYP F;  3PDN A;  5FZQ A;  4D10 C;  4K0R A;  5G2N A;  4J6I A;  1QNF A;  2ZGG A;  2PM7 A;  3QOU A;  2V4H C;  4A1G A;  3UM1 A;  5KJM A;  4E6H A;  3B7T A;  1QZ2 A;  3E33 A;  3CVP A;  4EZK A;  4WND A;  2V5Q C;  4FLH A;  2CFZ A;  2WMN A;  3L54 A;  4JB8 P;  4PS8 A;  3HXC A;  1Z6T A;  4GPM A;  1HH8 A;  2YHE A;  3APD A;  3DBS A;  4AJW A;  3KEZ A;  5HKP A;  1A5E A;  4G26 A;  5CCM A;  5BT1 A;  2H6G A;  1OUV A;  4L2Y A;  4OAV B;  4Q69 A;  4F53 A;  5LFA A;  1PC2 A;  3GZS A;  2ZGD A;  3ESK A;  2QY7 A;  2F8Y A;  4L7T A;  4APF A;  1LD8 A;  3TG4 A;  5ARF A;  5BV1 A;  5AQA A;  4GMR A;  3U64 A;  3JYS A;  3KEA A;  1DVP A;  4WWP A;  1JCQ A;  3SBT B;  3HRA A;  3IHV A;  5EX3 A;  4AXH A;  3RJV A;  4K5B A;  4AY6 A;  4A63 B;  3FUL A;  4K5C A;  2AWI A;  4DPR A;  3URZ A;  1HF8 A;  1S63 A;  5A7D B;  3I5P A;  2VSY A;  5ANL A;  2YIN A;  2ZIR A;  3Q7F A;  3NZU A;  5FQ4 A;  3B95 A;  2J4D A;  4JZY A;  1SW6 A;  2J07 A;  2VGX B;  4CYM D;  3ZHE B;  3V2O A;  4XZ4 A;  2BTD A;  4GTV A;  3TXM A;  2J09 A;  2XEN A;  1YA0 A;  2L0T B;  5E76 A;  3CVN A;  3CSF A;  4HRN A;  2XPZ A;  4IUL A;  4UQY A;  4CGV A;  2IO3 C;  2VGY A;  2P58 C;  2VGE A;  1OT8 A;  5AN8 A;  1E8X A;  4BSZ B;  1TN7 A;  2RD0 A;  3CHP A;  3WXX A;  2FBN A;  4RG9 A;  4ILG A;  4FP7 A;  3NAW A;  4I6E A;  5CRU A;  3V2X A;  2CHX A;  3EU9 A;  2WPV A;  2IFU A;  1O1S A;  4HBD A;  2I1K A;  1MX2 A;  1DCQ A;  4DX6 D;  3SY2 A;  2XZD G;  5BXU A;  1ZU2 A;  3JUI A;  1JWG A;  2J49 A;  2I2O A;  1FVF A;  1UW4 B;  3FUE A;  3AJI A;  2WXK A;  3EU5 A;  2Y3A A;  3L08 A;  4LER A;  3RIB A;  2XZT G;  3TAX A;  4GU5 A;  4IRU A;  4M3O A;  3PZ3 A;  1DNP A;  3JXI A;  4GTS A;  4KT6 B;  4LNG A;  4JA7 A;  5ARG A;  4BTB A;  1K3Z D;  3FUM A;  2B6C A;  1HE8 A;  4U7E B;  4DUI A;  1JPL A;  3C3O A;  3PEU B;  2DYS E;  2AW6 A;  3QAQ A;  5AEN A;  2ILR A;  3BU8 A;  5BW8 C;  1N95 A;  4J7W A;  3FY4 A;  3KD7 A;  4KXK B;  3UM3 A;  1WDY A;  3VLE A;  4PH4 B;  2HYZ A;  1BU9 A;  5KNG A;  1KPS B;  3FTV A;  3APC A;  2OCC E;  3UKU G;  4NQ0 A;  4EBA A;  3D3M A;  5EKQ D;  4UI9 J;  2LUH A;  3LY9 A;  4U0S A;  3BG0 B;  3ZYL A;  4NUR A;  2X6F A;  4WWO A;  1BLX B;  3GYZ A;  1AP7 A;  4GZ5 A;  5ITZ F;  3CQC B;  3APF A;  1RW2 A;  3CST A;  2F37 A;  4WNF A;  3N71 A;  2KZT B;  3UIN C;  3FTU A;  4OAU C;  5LP0 A;  3ONK A;  3VLF A;  3RRU A;  3FTZ A;  3S2A A;  2X6I A;  1N0Q A;  3C3R A;  2FI7 A;  2GRP B;  4ACL A;  1D8E A;  4CDN A;  3ONL A;  3ZXS A;  4YDY A;  2VTB B;  3D9I A;  3TXN A;  2P9I G;  2KBX A;  4GA1 A;  4EZL A;  3L22 A;  4G8K A;  2PQR A;  1NA0 A;  3T8K A;  2P9U G;  3RRN B;  1H0A A;  4XE0 A;  2J9Q A;  3ZYQ A;  3AG1 E;  4ILI A;  4PS7 A;  2E2E A;  5KJN A;  2LNI A;  1HU3 A;  2OVB A;  1H2T C;  3SHF A;  3T5X A;  5FIO A;  3AS5 A;  4BY6 A;  3ASG A;  2B0O E;  2VQ2 A;  4O60 A;  2FF4 A;  3S7J A;  3TWQ A;  3DSU A;  2XPI A;  3PNL B;  3KSQ A;  1HG5 A;  2BKG A;  4BT9 A;  3PZ1 A;  1TJC A;  4BWR A;  3W9F A;  1WG0 A;  4DK5 A;  4I6G A;  3AG3 E;  3FEX A;  3AS4 A;  4N2S A;  3TWX A;  1IXV A;  2UY1 B;  2Y4T A;  3MX3 A;  4EQF A;  3ABK E;  5EIL A;  2NXP A;  1N0R A;  3EHN A;  1ELR A;  4FLB A;  2P9K G;  4CCA A;  2RFA A;  3FH5 A;  1YCS B;  2DCP A;  2IU1 A;  4DRX E;  3RSE G;  3CLJ A;  5KCM A;  2GRL A;  3E32 A;  3UIP C;  4YDE A;  4OVU A;  4U04 A;  4KVO A;  3O48 A;  3IBE A;  4TRQ A;  1Q2Z A;  3AAA C;  2XEH A;  3JUE A;  5AIJ A;  1E7U A;  3HG0 D;  5FTP A;  1KT1 A;  3IKO B;  3ASN E;  3BG1 B;  3KAE A;  3R7Q A;  4RLY A;  4LCT A;  4UUC A;  1TEZ A;  3FU3 A;  3S7B A;  1UJJ A;  1HZ4 A;  2VGX A;  1OY3 D;  2A5U A;  2V0P A;  3ASO E;  5KNH D;  5BPP A;  1EYH A;  4JHR A;  4JVS A;  4A55 A;  3NBN B;  3ZHE A;  1KLX A;  2R17 C;  3ENE A;  3EHM A;  4B94 A;  4AVX A;  4N2Q A;  2R2L A;  4LG6 A;  1HO8 A;  5D0O D;  4CDR A;  2WM9 A;  4F3V A;  4HLL A;  3OXL A;  1SZ9 A;  3EIQ C;  4GYY A;  4MLP A;  1IQU A;  2WXQ A;  1E96 B;  2LAH A;  5CHE E;  4GTM A;  2PNN A;  3MYV A;  2XS8 A;  2C0M A;  4HOS A;  2VSN A;  2AJA A;  5CMW A;  4MS6 A;  4APO A;  3ZN3 A;  3ZIM A;  2KXP C;  4N5Q A;  4I1M A;  1TNU A;  4GZC A;  4M7C A;  3LDZ A;  1G3N B;  5EX0 A;  2AXV A;  4PS3 A;  2XCC A;  3QNK A;  4GAA A;  4TXR A;  1ELK A;  3FTX A;  2HM8 A;  3DXK G;  3ZU7 B;  4C0E A;  2WQ6 A;  3NOG D;  3Q75 A;  4KVM A;  3S7D A;  1UOH A;  2R03 A;  4LNU D;  4DLQ A;  3FH7 A;  2CG3 A;  3G2U A;  2WXJ A;  1TN8 A;  3GZ2 A;  1TNB A;  1Z3Y A;  1U3C A;  2P9L G;  4ZFH A;  3V31 A;  3U9W A;  2LAI A;  3IXE A;  4I2Z A;  3SF4 A;  4BEP A;  3HXD A;  2NSZ A;  4IYP A;  2XQ0 A;  2V8S E;  3FUI A;  3AS8 A;  3WG7 E;  3Q79 A;  3PZ4 A;  5LCW J;  4U95 D;  5FQ7 A;  4ANU A;  3PUJ A;  2WXP A;  1N9A A;  1TR4 A;  3UIO C;  4Q96 A;  2WXM A;  4H7X A;  5C2Y A;  1OXJ A;  2H6F A;  1WAO 1;  1KT0 A;  1MQS A;  3LXU X;  4UWG A;  2LXM A;  2ETB A;  1S70 B;  4C0M A;  2XGS A;  1MZC A;  3D9H A;  3E34 A;  2XEV A;  2X38 A;  3I4G A;  2KZT A;  1UN8 A;  3RKV A;  2DZO A;  2FUL A;  3DWL G;  3JQ1 A;  3S7F A;  4I2W A;  4MBG A;  5G05 J;  3DSV A;  3LY8 A;  2WXN A;  4GZD A;  1FCH A;  3JQ0 A;  4YDO A;  2VTB A;  1IHB A;  4EHM A;  2PZI A;  3TWT A;  5EID A;  3DXM G;  3K9I A;  1NL4 A;  3MZL B;  2C2L A;  2KAT A;  1RZ4 A;  2ZXW E;  3CK9 A;  4YDW A;  2XRZ A;  1IYG A;  3RK6 A;  2XEE A;  4HRM B;  2P2C P;  2HR2 A;  4A3V A;  2WXH A;  1EDU A;  5AQ9 A;  3CIA A;  3AG2 E;  4ZHB A;  3PRE A;  1SA5 A;  3LYA A;  4K5A B;  4WUY A;  3SQV A;  1O1R A;  3ASH A;  3D9K A;  4N3A A;  3CVL A;  4Q94 A;  1N4R A;  3IV0 A;  3TL5 A;  3HXE A;  4YVQ C;  3CV0 A;  1QBQ A;  4CT0 A;  4B8C B;  1PAQ A;  4I6J A;  4ANV A;  2ZU6 B;  1N94 A;  2KCK A;  3G2V A;  1TNO A;  3C3Q A;  5FJY A;  3DEP A;  4DX2 A;  2UY1 A;  4G1T A;  5A6C A;  2KCL A;  2BUG A;  3JCK C;  4DI4 A;  1JCS A;  4I1A A;  2CHW A;  4A1S A;  1X81 A;  3OXG A;  5ENP D;  3B13 A;  2WXO A;  4HOT A;  4TUM A;  5G04 C;  4UI9 K;  1E8W A;  1JWF A;  2XHE A;  3MCX A;  3CHR A;  1Y6I A;  4I9C A;  4PDX A;  5CBN A;  1OCR E;  4N3C A;  5HS0 A;  3CGH A;  1DCE A;  4XX5 A;  5JHB A;  3OTN A;  3CHQ A;  4BSX A;  4OVV A;  4J8Y A;  3ABL E;  4DX1 A;  2VSX E;  3ZVV A;  1H19 A;  3P1U A;  5CCL A;  4L1B A;  4BES A;  4WNE A;  1OCC E;  4GPK A;  5D2M C;  3GW4 A;  3UPV A;  3I3N A;  3MEK A;  5KJK A;  3FUJ A;  3L82 A;  2L6J A;  4B8A A;  4BER A;  5CBO A;  2RG8 A;  4HOU A;  2F0Y A;  3CK7 A;  2NYJ A;  4GZ6 A;  4I17 A;  4XKC A;  3MKQ B;  5T3R A;  1YYH A;  2DYR E;  4LSZ E;  3DPD A;  1TYQ G;  5JHA A;  4QQI A;  3Q78 A;  3SNX A;  4CGW A;  2EQX A;  3FP3 A;  4DI3 A;  5AAR A;  1W3B A;  3UM0 A;  5C1D A;  1BI7 B;  2R5S A;  5HI7 A;  3HVE B;  2GGF A;  1MYO A;  1MJ0 A;  2LO6 A;  4O1O A;  4AV7 A;  3FUN A;  1QQE A;  5G55 A;  4GCN A;  3LJN A;  1TN6 A;  2ETA A;  4U8V D;  3BQO A;  3UKR G;  2PL2 A;  3LS8 A;  4NIK A;  3TGO A;  1U3D A;  3UTM A;  2GRO B;  3NQP A;  1OWM A;  3CEQ A;  2GRN B;  2P9N G;  1XNF A;  2YHC A;  5CED B;  5M72 A;  4KZC A;  4YVO A;  3TWW A;  4A3T A;  4MRU A;  2P9P G;  3Q5M A;  1UG3 A;  2OV8 A;  3FDH A;  2I9C A;  3QWW A;  3ZGQ A;  1FPP A;  5DBK A;  3D9N A;  4FU3 A;  3LJ3 A;  3G2S A;  1O5M A;  4R7L A;  4C9B B;  4FUL A;  1NP7 A;  2HE0 A;  4TV3 A;  1ELW A;  1D9S A;  4IN3 B;  2WXR A;  2WXF A;  2X6K A;  2Q7F A;  1TNY A;  4HOQ A;  2A5E A;  3FU0 A;  4LUN U;  4U8Y D;  4U8H A;  2VYI A;  1H6P A;  4U63 A;  4J8D A;  3ULE G;  3ASD A;  5BNW A;  4KMO A;  4WNG A;  5B3S E;  4ANX A;  4L9P A;  2WQH A;  1YMP A;  3UT4 A;  3ZKJ A;  5AJL A;  1KZP A;  3ML9 A;  4EBA G;  2M63 A;  2QZA A;  3FUD A;  4N39 A;  3KS2 A;  5CEA A;  3NF1 A;  4WWN A;  4XIF A;  4HOR A;  4TUU A;  3U4T A;  4GYW A;  2EIJ E;  3FTW A;  3AG4 E;  4B89 A;  3Q9N C;  1B89 A;  4HI8 A;  3B7S A;  2A4Z A;  4JW1 A;  2LSV A;  3NZS A;  3ML8 A;  4J8E A;  3J5P A;  2VSO E;  2CG2 A;  3B7U X;  4DJA A;  3T8M A;  4RQI A;  4RSY A;  4P29 A;  3RO2 A;  3FWV A;  3FFL A;  1H2V C;  1LF8 A;  5EDS A;  2JLB A;  4BX8 A;  1E8Z A;  3PRZ A;  4JHJ A;  3LPZ A;  4UWF A;  3HDX A;  4AEZ C;  1QYM A;  2C0L A;  5CEC B;  3UUX A;  3CVV A;  3Q15 A;  3C5R A;  5ENS D;  4EPZ A;  2XCB A;  4FHJ A;  1S64 A;  3CVU A;  1OWO A;  3W9G A;  4GTT A;  5BUZ A;  3TWV A;  2Y0B G;  5BXO A;  3TWR A;  3QK0 A;  1P5Q A;  3C98 A;  3UMV A;  4E85 A;  1MX4 A;  4F7A A;  3RRM B;  2VJ8 A;  2GRM A;  1IQR A;  1HS6 A;  3L6A A;  1FVH A;  3T5V A;  1N11 A;  2XGO A;  5T8I A;  5CER B;  3AU4 A;  2DWZ A;  3CKB A;  3SFY A;  4CRW A;  2CHZ A;  1HX8 A;  3HXB A;  4UQX A;  5B1A E;  2IEJ A;  4FHK A;  3Q9U C;  3GZ1 A;  3QJZ A;  3QDN A;  3UXG A;  4URK A;  2BKK B;  4HXI A;  3MV3 B;  3MA5 A;  3G2T A;  1NZN A;  3PUK A;  2BED A;  3B7B A;  5KWD A;  1V54 E;  3SI5 A;  4MKT A;  3CVX A;  1BPO A;  2R02 A;  1SVX A;  4BFR A;  2WVI A;  4CT4 A;  5AQ7 A;  2IQC A;  3FUH A;  3UT7 A;  1H6K A;  3D9M A;  3E4B A;  1E90 A;  4J0U A;  3ULQ A;  2J08 A;  3MKQ A;  4HRL A;  3L16 A;  3EDT B;  3KSL A;  3EUV A;  2LXL A;  2P9S G;  2XPY A;  3QKY A;  3ABM E;  4HLE A;  3DSW A;  4TXP A;  5JJT A;  4PUC A;  4G25 A;  4GMJ A;  1PY1 A;  4F6R D;  3O4Z A;  4ME2 A;  4JD2 G;  3HVE A;  3PZ2 A;  2AXU A;  1SZA A;  1FT1 A;  4JA9 A;  4DX5 D;  2R59 A;  3R7R A;  3TWS A;  1SA4 A;  4AM9 A;  4I43 A;  5EYL A;  2EIL E;  3VLD A;  2IJG X;  3RU0 A;  4JEU A;  1H6O A;  4FC8 A;  5JMN D;  5ENQ D;  2DZN A;  4HS2 A;  4HNA D;  2UWJ G;  1IHG A;  1BI8 B;  1UN9 A;  4HQD A;  2Y69 E;  1OCZ E;  3CHM A;  4F1S A;  1DC2 A;  1S0P A;  4I9E A;  4CZ2 D;  2I1J A;  5BV0 A;  1TJF A;  5EN5 D;  3NOC D;  5FIN A;  2WMO A;  1JUQ A;  4GZ3 A;  2KCV A;  1L5J A;  2IO2 C;  5KBA A;  2CFU A;  1N54 A;  2DBA A;  2DVW A;  4GML A;  3D9O A;  1K1A A;  2YQ8 A;  4QFV A;  3ZNG A;  2IF4 A;  2ZIS A;  2MRI A;  4EEC A;  4C48 B;  3DRA A;  4L23 A;  5ENN A;  5DIZ A;  2XRY A;  5J08 A;  4HB5 A;  3L13 A;  3TG5 A;  3V79 K;  4EZJ A;  3ZRH A;  1OCO E;  3PS6 A;  5JA4 D;  1LD7 A;  4ILH B;  2QYJ A;  2GRR B;  4U0Z A;  2FO7 A;  4DLO A;  4W9R A;  3U66 A;  4UWL A;  2F8X K;  5LOZ A;  3CHO A;  3C72 A;  4X8Q A;  4UI9 C;  4B93 B;  4L2L A;  4YND A;  3DSS A;  4JEH A;  3D9L A;  2OOE A;  2KC7 A;  3L9T A;  2FO1 E;  2JAB A;  1E8Y A;  4AOF A;  5H7P A;  3I4R B;  5FZS A;  4U0U A;  3DSX A;  1HXI A;  2WXI A;  5AQB A;  3VTX A;  2X6J A;  2WXG A;  4CEM A;  5HQ8 A;  3QWV A;  5A23 A;  2H6H A;  1HFA A;  5EIB E;  3CK8 A;  3EJN A;  4AY5 A;  3SGH A;  3PEV B;  3SO8 A;  5AJD A;  1GW6 A;  4H7Y A;  3LKU A;  2OVF A;  3EHR A;  4I1O B;  5JJ7 A;  2WQ7 A;  3V30 A;  3ESL A;  3MKR A;  2WB2 A;  2IOL A;  4ANW A;  3FUK A;  2XGM A;  4U96 D;  1WM5 A;  3LEW A;  1OWP A;  3SBS A;  1FT2 A;  5T4Y A;  4ATZ D;  3PNT B;  2L9B A;  2NC9 A;  5FQ6 A;  5CMY A;  4FA6 A;  1IKN D;  4JXT A;  4G11 A;  1JCR A;  4O6F A;  3B7R L;  1TNZ A;  3FU5 A;  4GCO A;  4G24 A;  2LSU A;  2IOS A;  3E37 A;  3RAU A;  1N4Q A;  3HXF A;  3ZPJ A;  3U3W A;  5CRV A;  3UM2 A;  4GTP A;  3DPY A;  3T9K A;  4KZ0 A;  4GB9 A;  5IY5 E;  4NAC A;  3QB2 A;  5FT9 A;  2DIW A;  3ZEF A;  4O1P A;  4KBQ A;  1BD8 A;  4Z68 A;  5D66 A;  1VDY A;  3OAW A;  5ANR A;  3QAR A;  1XGW A;  4LRZ A;  4Y6C A;  3CR3 A;  2AXZ A;  4XI0 A;  5ENO D;  3Q47 B;  5G04 J;  3LVQ E;  2OND A;  2RFM A;  2QC9 A;  3D9J A;  4HVB A;  5ENT D;  3EHQ A;  2Y4U A;  4FJZ A;  4XEI G;  3OXF A;  4DX7 D;  3JXJ A;  3UI2 A;  5HRY A;  4ATG A;  3Q73 A;  1MX6 A;  3PE3 A;  3Q7A A;  4F1P A;  1N4P A;  4TXQ A;  1WY6 A;  5E75 A;  3UX4 A;  5FZR A;  4N5C A;  4UWH A;  4GA2 A;  2AVP A;  1K1B A;  4G23 A;  3L17 A;  2KM4 A;  2JEK A;  5AAO A;  3DST A;  3J5Q B;  4G8L A;  4JC8 A;  4Y6W A;  2I6H A;  3ZFW A;  2PM6 A;  4B0Z A;  2X6H A;  3CQG B;  3RO3 A;  2ETC A;  4GTQ A;  2XS1 A;  5ENR D;  1N4S A;  2J4B A;  3IHY A;  3HHM A;  5J90 A;  4BET A;  3UQ3 A;  3FU6 A;  3EIJ A;  3UT8 A;  2H6I A;  4JL0 A;  2Y1L E;  4HFG A;  1Y8M A; 
#chains in the Genus database with same CATH homology
 3QJZ A;  2Y3A A;  3ZW3 A;  2PZI A;  3L08 A;  3QDN A;  1HG2 A;  5AYW D;  3K9I A;  4LER A;  3LY7 A;  4URK A;  3RIB A;  3MZL B;  2C2L A;  2KAT A;  3ZYK A;  4HXI A;  3MV3 B;  4NRH B;  3TAX A;  3CK9 A;  4GU5 A;  3FTS A;  4IRU A;  4M3O A;  4OYS A;  2XRZ A;  3MA5 A;  3G2T A;  1IYG A;  1DNP A;  2L0I A;  3RK6 A;  1NZN A;  3FEY A;  3PUK A;  4G2V A;  4KT6 B;  2HR2 A;  3SI5 A;  4MKT A;  3IEG A;  1BPO A;  3CVX A;  4JA7 A;  5ARG A;  4A3V A;  4BTB A;  4BFR A;  5D0Q D;  2WVI A;  2WXH A;  3FUM A;  1EDU A;  4GA0 A;  4CT4 A;  3CIA A;  1HE8 A;  2HO1 A;  1JPL A;  5FWQ A;  3PRE A;  2IQC A;  3FUH A;  3PEU B;  1H6K A;  3LYA A;  4WUY A;  3UT7 A;  2AW6 A;  3ASH A;  3BEE A;  3D9M A;  3D9K A;  3E4B A;  2ILR A;  3QAQ A;  5BW8 C;  5AEN A;  3PVL A;  2MHK A;  3CVL A;  2ION A;  4N3A A;  1E90 A;  1UJK A;  3FY4 A;  3KD7 A;  4J0U A;  4KXK B;  4V3I A;  4Q94 A;  3ULQ A;  3VLE A;  2J08 A;  4PH4 B;  3IV0 A;  4WAF A;  2HYZ A;  3TL5 A;  4YVQ C;  4LEU A;  3CV0 A;  3FTV A;  3MKQ A;  3APC A;  4CT0 A;  4B8C B;  1OWN A;  1PAQ A;  4I6J A;  4ANV A;  2ZU6 B;  4NQ0 A;  4EBA A;  3P2B A;  3D3M A;  2GW1 A;  2WXL A;  2KCK A;  3L16 A;  5EKQ D;  3EDT B;  3G2V A;  4BTA A;  4UI9 J;  3CVY A;  5FJY A;  3LY9 A;  4U0S A;  4RVB A;  3MGB A;  3BG0 B;  2XPY A;  3QKY A;  2UY1 A;  4NUR A;  4G1T A;  3ZYL A;  2X6F A;  3FUF A;  4WWO A;  5A6C A;  2KCL A;  4HLE A;  2BUG A;  1EF1 C;  3GYZ A;  3JCK C;  4DI4 A;  3HIZ A;  4I1A A;  5JJ6 A;  2CHW A;  4GZ5 A;  5JJT A;  4PUC A;  4G25 A;  4GMJ A;  1PY1 A;  3CQC B;  4A1S A;  3OXG A;  3O4Z A;  3G2W A;  3APF A;  3HYM B;  3B13 A;  4ME2 A;  3HVE A;  2V5F A;  2WXO A;  4HOT A;  4J8S A;  3CST A;  4WNF A;  3CHS A;  3N71 A;  3MJW A;  1INZ A;  5G04 C;  1X5B A;  2AXU A;  2KZT B;  4AP2 A;  4UI9 K;  1E8W A;  1JWF A;  2XHE A;  3MCX A;  1SZA A;  3FTU A;  3CHR A;  1Y6I A;  4I9C A;  4PDX A;  5LCW C;  5LP0 A;  4JA9 A;  4N3C A;  3ONK A;  2R59 A;  3VLF A;  3CGH A;  3ASF A;  3R7R A;  3RRU A;  3FTZ A;  4XX5 A;  3S2A A;  2X6I A;  3Q4A B;  4JHK A;  4AM9 A;  4I43 A;  2FI7 A;  4ACL A;  5JHB A;  4CDN A;  3VLD A;  2IJG X;  3ONL A;  3RU0 A;  3ZXS A;  3OTN A;  2FEZ A;  4RG6 A;  3CHQ A;  4N3B A;  3D9I A;  3TXN A;  2VTB B;  4GA1 A;  4KYO B;  4BSX A;  4JEU A;  3SD5 A;  4EZL A;  4OVV A;  4FC8 A;  3L22 A;  4GYO A;  2PQR A;  4HS2 A;  1NA0 A;  2VSX E;  3ZVV A;  3RRN B;  1H19 A;  4UQZ A;  2UWJ G;  1IHG A;  3P1U A;  1H0A A;  5CCL A;  4U07 A;  1UN9 A;  4XE0 A;  2J9Q A;  3LVR E;  4ILI A;  3ZYQ A;  1SQM A;  4BX9 A;  4PS7 A;  4L1B A;  2E2E A;  3MV2 B;  5KJN A;  2LNI A;  1HU3 A;  2OVB A;  1H2T C;  3SHF A;  4CDM A;  3CHM A;  4JPS A;  3T5X A;  4XKB A;  3VTY A;  4F1S A;  4WNE A;  3CVW A;  4GPK A;  1S0P A;  4I9E A;  3AS5 A;  2I1J A;  5BV0 A;  5KJL A;  1TJF A;  4FJY A;  3GW4 A;  4BY6 A;  3ASG A;  3UPV A;  3I3N A;  3SZ7 A;  3MEK A;  5KJK A;  3FUJ A;  2E0I A;  1A17 A;  2L6J A;  2VQ2 A;  2WMO A;  4UWK A;  1JUQ A;  4B8A A;  2RG8 A;  2FF4 A;  5G05 C;  4HOU A;  3S7J A;  4AIF A;  2XPI A;  4GZ3 A;  2KCV A;  3PNL B;  1L5J A;  1HG5 A;  2PQN A;  3CK7 A;  3CVQ A;  3D9P A;  4BT9 A;  4GZ6 A;  4I17 A;  1TJC A;  1N52 A;  1N54 A;  2CFU A;  1EPU A;  2DBA A;  3PE4 A;  4GML A;  3D9O A;  4BWR A;  4XKC A;  3MKQ B;  3FTY A;  4I6G A;  5T3R A;  4DK5 A;  5LX8 A;  2X3M A;  2YQ8 A;  4QFV A;  1MHQ A;  1Z3X A;  2IF4 A;  1NA3 A;  3FEX A;  3AS4 A;  4N2S A;  2MRI A;  4EEC A;  4ACK A;  2YNQ A;  3DPD A;  3TJP A;  5JHA A;  3FHE A;  2V4L A;  3PZD A;  2BF0 X;  4L23 A;  2UY1 B;  5DIZ A;  2Y4T A;  3MX3 A;  5ENN A;  3SNX A;  4CGW A;  4EQF A;  2EQX A;  1H2U A;  2XRY A;  3FH8 A;  3FP3 A;  4DI3 A;  5FQ8 A;  1W3B A;  5J08 A;  5C1D A;  4J8F A;  2R5S A;  5HI7 A;  2NXP A;  3L13 A;  3HVE B;  3EHN A;  3TG5 A;  1ELR A;  1ZBP A;  2QFC A;  4FLB A;  2GGF A;  4EZJ A;  3ZRH A;  3PS6 A;  2LO6 A;  4K03 A;  4CCA A;  4AV7 A;  3FH5 A;  3FUN A;  2DCP A;  2IU1 A;  4ILH B;  1QQE A;  3CKC A;  5G55 A;  4GCN A;  2MOW A;  3CLJ A;  5KCM A;  4FAD A;  3AU5 A;  4BT8 A;  2GRL A;  4U0Z A;  4ABN A;  2FO7 A;  3SFZ A;  4DLO A;  3R9A B;  4XI9 A;  4W9R A;  3LCA A;  3U66 A;  4UWL A;  5LOZ A;  3CHO A;  2PL2 A;  4OVU A;  4U04 A;  4KVO A;  3ZYM A;  3LS8 A;  3PH0 C;  3TGO A;  4UI9 C;  4L2L A;  3QWP A;  3O48 A;  1E7V A;  1U3D A;  3GZ1 A;  4JEH A;  4YND A;  3IBE A;  4TRQ A;  3Q49 B;  3QC1 A;  3D9L A;  5AIJ A;  3NQP A;  1E7U A;  1OWM A;  2OOE A;  3CEQ A;  5FTP A;  1OWL A;  1KT1 A;  3PDN A;  2KC7 A;  3IKO B;  5FZQ A;  4D10 C;  4K0R A;  1XNF A;  2YHC A;  5G2N A;  3BG1 B;  3KAE A;  4J6I A;  1QNF A;  1E8Y A;  5M72 A;  4AOF A;  3R7Q A;  2PM7 A;  4KZC A;  4YVO A;  4A3T A;  3QOU A;  4MRU A;  3I4R B;  5FZS A;  4U0U A;  4A1G A;  3Q5M A;  1HXI A;  1UG3 A;  2OV8 A;  3FDH A;  2WXI A;  2I9C A;  3QWW A;  3VTX A;  4LCT A;  2X6J A;  3ZGQ A;  1TEZ A;  2WXG A;  3FU3 A;  3S7B A;  1UJJ A;  4E6H A;  5KJM A;  1HZ4 A;  3B7T A;  1QZ2 A;  2VGX A;  5DBK A;  3D9N A;  4CEM A;  5HQ8 A;  2A5U A;  4FU3 A;  3LJ3 A;  3QWV A;  3CVP A;  2V0P A;  4EZK A;  5A23 A;  4WND A;  4FLH A;  2CFZ A;  3G2S A;  1HFA A;  5BPP A;  1EYH A;  2WMN A;  4JHR A;  4R7L A;  4JVS A;  4A55 A;  4C9B B;  3CK8 A;  3ZHE A;  1KLX A;  2R17 C;  3ENE A;  4FUL A;  3EJN A;  3EHM A;  3L54 A;  3SGH A;  4AY5 A;  1NP7 A;  3PEV B;  4B94 A;  4AVX A;  5AJD A;  4N2Q A;  4TV3 A;  1ELW A;  4PS8 A;  1GW6 A;  4H7Y A;  3LKU A;  2OVF A;  1Z6T A;  4I1O B;  4IN3 B;  5JJ7 A;  2WXR A;  2WQ7 A;  1HH8 A;  2WXF A;  2YHE A;  3ESL A;  1HO8 A;  2X6K A;  3APD A;  2Q7F A;  5D0O D;  3DBS A;  3MKR A;  2WB2 A;  4AJW A;  4CDR A;  2WM9 A;  3KEZ A;  4F3V A;  2IOL A;  4G26 A;  3OXL A;  4ANW A;  5CCM A;  3FUK A;  2XGM A;  5BT1 A;  4HOQ A;  1OUV A;  4L2Y A;  3FU0 A;  1SZ9 A;  3EIQ C;  4GYY A;  1WM5 A;  3LEW A;  4MLP A;  4Q69 A;  4LUN U;  1IQU A;  4F53 A;  4U8H A;  1OWP A;  2VYI A;  1E96 B;  2LAH A;  2WXQ A;  1PC2 A;  5LFA A;  3GZS A;  3SBS A;  5CHE E;  5T4Y A;  4U63 A;  4J8D A;  3PNT B;  3MYV A;  3ESK A;  2C0M A;  3ASD A;  5BNW A;  2QY7 A;  2L9B A;  2VSN A;  4HOS A;  2NC9 A;  5FQ6 A;  4KMO A;  4WNG A;  5CMY A;  5CMW A;  4ANX A;  4FA6 A;  4L7T A;  2WQH A;  4MS6 A;  4JXT A;  4APF A;  3UT4 A;  4G11 A;  3TG4 A;  5AJL A;  4APO A;  4O6F A;  3B7R L;  3ZN3 A;  3FU5 A;  3ZIM A;  4GCO A;  4G24 A;  3ML9 A;  2LSU A;  4I1M A;  5ARF A;  2IOS A;  2M63 A;  4EBA G;  5BV1 A;  3FUD A;  4N39 A;  3KS2 A;  4GZC A;  3ZPJ A;  3LDZ A;  3JYS A;  3U64 A;  5EX0 A;  3U3W A;  3NF1 A;  2AXV A;  4PS3 A;  2XCC A;  4WWN A;  4XIF A;  1DVP A;  4WWP A;  3QNK A;  4GAA A;  3SBT B;  4HOR A;  1ELK A;  4TUU A;  3U4T A;  3FTX A;  2HM8 A;  4GYW A;  3IHV A;  4KZ0 A;  5EX3 A;  4AXH A;  3RJV A;  4AY6 A;  4GB9 A;  3FTW A;  4C0E A;  3FUL A;  2AWI A;  4DPR A;  2WQ6 A;  4B89 A;  3URZ A;  4KVM A;  1HF8 A;  4NAC A;  5A7D B;  3S7D A;  1B89 A;  3I5P A;  2VSY A;  3B7S A;  2A4Z A;  3QB2 A;  5ANL A;  2YIN A;  4DLQ A;  4JW1 A;  3FH7 A;  2LSV A;  3NZS A;  3ML8 A;  2CG3 A;  3NZU A;  4J8E A;  5FQ4 A;  5FT9 A;  2VSO E;  3G2U A;  2WXJ A;  2DIW A;  2J4D A;  3ZEF A;  2CG2 A;  3B7U X;  4JZY A;  2J07 A;  2VGX B;  4KBQ A;  4DJA A;  3GZ2 A;  3T8M A;  4RSY A;  1VDY A;  4P29 A;  3OAW A;  1Z3Y A;  5ANR A;  3RO2 A;  1U3C A;  3QAR A;  1XGW A;  3FWV A;  3FFL A;  4LRZ A;  1H2V C;  4Y6C A;  3U9W A;  1LF8 A;  3ZHE B;  5EDS A;  2LAI A;  3CR3 A;  2AXZ A;  4I2Z A;  2JLB A;  3SF4 A;  4XI0 A;  4BX8 A;  1E8Z A;  3PRZ A;  2NSZ A;  4IYP A;  3Q47 B;  4JHJ A;  3LPZ A;  4XZ4 A;  2BTD A;  4UWF A;  3HDX A;  2XQ0 A;  2V8S E;  4AEZ C;  3FUI A;  2C0L A;  3AS8 A;  5G04 J;  3UUX A;  3CVV A;  3LVQ E;  3TXM A;  2J09 A;  3Q15 A;  1YA0 A;  2OND A;  2L0T B;  2XCB A;  4FHJ A;  5E76 A;  4EPZ A;  5LCW J;  3CVN A;  5FQ7 A;  3D9J A;  3CSF A;  3CVU A;  4HVB A;  1OWO A;  2XPZ A;  4IUL A;  2Y4U A;  4FJZ A;  3OXF A;  4UQY A;  5BUZ A;  4ANU A;  3PUJ A;  2WXP A;  4ATG A;  4CGV A;  3QK0 A;  1P5Q A;  2VGY A;  2P58 C;  3PE3 A;  4Q96 A;  3C98 A;  2WXM A;  4H7X A;  1E8X A;  5C2Y A;  3UMV A;  4E85 A;  1WAO 1;  4F7A A;  1KT0 A;  1WY6 A;  5E75 A;  1MQS A;  5FZR A;  3RRM B;  3LXU X;  3UX4 A;  4UWG A;  2RD0 A;  3CHP A;  4N5C A;  4UWH A;  3WXX A;  2FBN A;  4GA2 A;  4RG9 A;  2AVP A;  4ILG A;  2VJ8 A;  4FP7 A;  4C0M A;  4G23 A;  3L17 A;  2GRM A;  2KM4 A;  4I6E A;  1IQR A;  2JEK A;  2XGS A;  2CHX A;  1HS6 A;  3L6A A;  2WPV A;  4JC8 A;  2XEV A;  2X38 A;  4Y6W A;  1FVH A;  2I6H A;  2IFU A;  3I4G A;  2KZT A;  3T5V A;  2I1K A;  1UN8 A;  3RKV A;  3ZFW A;  2XGO A;  2PM6 A;  4B0Z A;  2X6H A;  3CQG B;  3RO3 A;  2FUL A;  5T8I A;  3AU4 A;  3CKB A;  4CRW A;  3JQ1 A;  1ZU2 A;  2J4B A;  3S7F A;  3IHY A;  4I2W A;  5G05 J;  2CHZ A;  1HX8 A;  3HHM A;  3JUI A;  4UQX A;  1JWG A;  3LY8 A;  2WXN A;  4GZD A;  5J90 A;  3UQ3 A;  3FU6 A;  2J49 A;  3EIJ A;  2I2O A;  3UT8 A;  1FVF A;  1FCH A;  1UW4 B;  3FUE A;  4FHK A;  4JL0 A;  3JQ0 A;  2VTB A;  4HFG A;  2WXK A;  1Y8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...