3SI5A

Kinetochore-bubr1 kinase complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
152
structure length
152
Chain Sequence
TGSQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Blinkin-BUBR1 Complex Reveals an Interaction Crucial for Kinetochore-Mitotic Checkpoint Regulation via an Unanticipated Binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
total genus 64
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08311 Mad3_BUB1_I Mad3/BUB1 homology region 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.430 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3si5A00
2WVIA 4AEZC 3SI5A 2LAHA 4A1GA
chains in the Genus database with same CATH superfamily
1LD7A 2VYIA 3BU8A 5FT9A 3ONKA 2DIWA 3T8KA 5DIZA 3C98A 4G24A 3L17A 4JEUA 5D0QD 1N52A 3DPYA 3MJWA 3UTMA 3SD5A 3CKCA 2J07A 3T5XA 4TRQA 4HOQA 3TWTA 3QWWA 3TAXA 4APOA 2RFAA 4G11A 4XKBA 1QYMA 3I3NA 4LSZE 3HRAA 4JW1A 2V5QC 1N4QA 3ULEG 3FTYA 2CFUA 1YCSB 2VSYA 2UWJG 3FUKA 4O60A 3FU0A 4I17A 2CHZA 1EF1C 4CGVA 4NRHB 3UT8A 4LNBA 3B13A 4V3IA 1TYQG 4PS7A 3D9KA 2OVFA 5LOZA 3ZYQA 4B8CB 1FPPA 2PM6A 3G2SA 2E2EA 4N3AA 3CK9A 4GCNA 2XRZA 3V31A 3FTZA 2HYZA 4YDEA 2NSZA 3G2UA 3CVUA 1K1BA 3EDTB 3W9FA 4YDYA 1OWNA 3APCA 1XGWA 3LS8A 2J49A 4ME2A 5G55A 1E96B 2M63A 2EIKE 3I4GA 3MYVA 1N4PA 5KCMA 3RJVA 3AG1E 4EBAA 2XGOA 2QC9A 4W9RA 1KZOA 4FP7A 5BXOA 1FT1A 2WM9A 1UOHA 2WXHA 2EIME 3ASOE 3ABKE 4AV7A 1BU9A 4OVVA 3CK7A 3U66A 2XS8A 2ILRA 2RG8A 5G04C 5JMND 3SFYA 4CDMA 3LY9A 4DUIA 4KXKB 1HF8A 4UQYA 1N11A 4GZDA 1HS6A 4AIFA 2YHCA 3B7TA 2XGMA 2PNNA 2LXLA 4TV3A 2AXVA 4N5QA 5FZRA 4CYMD 1HX8A 1PC2A 4ILIA 3JQ0A 3Q75A 2WXGA 3PH0C 4EPZA 4GTSA 1A5EA 3ASDA 2WXOA 2WQHA 5FIOA 5HS0A 4J8YA 2V4LA 2X6KA 4TUMA 2CFZA 5ENNA 4CZ2D 3QB2A 2KCVA 3MA5A 3LY7A 3Q7AA 1Z5SC 3UIPC 1O1RA 4C0MA 1QNFA 3E4BA 1QQEA 3UKRG 3V30A 4L7TA 2DWZA 4X8QA 4FLHA 3BQOA 3SFZA 2UY1B 1K1AA 4AXHA 1N95A 1E8WA 3ML9A 1Z3XA 4RLYA 2UY1A 2VJ8A 4QFVA 2LAIA 4N2QA 1SVXA 1WG0A 3U3WA 4HB5A 3QC1A 5H7PA 1U2VG 2XPIA 1E8XA 2YQ8A 4U07A 3CHPA 3DSXA 5KJLA 2L6BA 4NACA 4UQXA 5T3RA 5LX8A 3KSQA 5B1BE 2R02A 4IRUA 1ZBPA 3GZ1A 3R9AB 2WXFA 3CHOA 3Q47B 3AG3E 2XPZA 3ASGA 1S64A 4XZ4A 3UUXA 2OEWA 3C3RA 1JPLA 4U0UA 4BESA 2DCPA 1UW4B 3NZUA 5BXUA 3PRZA 5AENA 3RKVA 2WB2A 3QWPA 4GYWA 3CVYA 3CVQA 2RFMA 3Q9UC 1E90A 1TN7A 4N2SA 4DX1A 2WXMA 2WXIA 4M7CA 4U8VD 3SY2A 3TXMA 1GW6A 3R7QA 4Z68A 3ZYKA 4YNDA 4CGWA 2XEEA 2VSNA 3S7FA 4YDWA 3I5PA 3FTXA 2H6FA 3T8MA 2NC9A 1IHBA 3D9JA 5BNWA 4ATGA 3DRAA 3U4TA 1WM5A 1VDYA 3DSVA 4MRUA 3ZPJA 4AJWA 5ENRD 5AQ9A 3FP3A 1OY3D 4FHKA 4DRXE 3LKUA 1KZPA 2P2CP 1OT8A 3FUDA 5BPPA 3ZFWA 3GW4A 1BI7B 4BSZB 1TNOA 2V5FA 4TXQA 3CR3A 3NB2A 4JVSA 4BY6A 5M72A 4UWLA 3UINC 3MKQB 1H6KA 4K5AB 3WG7E 4BT8A 2V8SE 2GRRB 1HH8A 4EHMA 5FQ6A 2X6JA 5KNGA 1IQUA 1N0RA 4B8AA 3IBEA 4G25A 1S0PA 3ZNGA 3JUIA 3D9LA 5EX3A 3QKYA 3KD7A 5KJKA 4HNAD 2DVWA 1A17A 4GCOA 3HXCA 1AP7A 2DZNA 2HE0A 3PZDA 1UG3A 2LSUA 4HBDA 3DXMG 3FFLA 2QZAA 1SZAA 3EIJA 3UM1A 5BV1A 1FT2A 1TEZA 5KNHD 4GB9A 3NOCD 3QWVA 4HOUA 5ANRA 2LAHA 3CQCB 1JCQA 2WXNA 3ZRHA 2J08A 3TG4A 3AS4A 4LCTA 4FC8A 3HVEA 4C0EA 3JQ1A 4G2VA 3CVLA 3S7DA 1WY6A 2XZTG 3LVQE 4HRLA 2GW1A 3TWUA 4CT0A 4GZ3A 4UQZA 4XE0A 4L1BA 1MYOA 5T8IA 4EECA 3NBNB 4KT6B 1MX4A 5D0OD 4K0RA 2V4HC 1HFAA 2JLBA 2QYUA 4EZKA 5EIBE 2X6HA 2XGSA 2R05A 3P2BA 2BEDA 3Q4AB 2A5EA 5EN5D 3FTWA 4JA9A 3VLFA 1PY1A 2L0IA 4A3TA 1OWPA 3NF1A 1K3ZD 3UM0A 5B1AE 1OWOA 3IEGA 3IV0A 1SW6A 1N4SA 1TJFA 3TWXA 4DK5A 3D9OA 4G8KA 3CIAA 4L2LA 2Y1LE 2DYRE 5HQ8A 5CCLA 2IEJA 3S7JA 1TNYA 4WNEA 2IY0C 5JHBA 2WMOA 5FZQA 3TL5A 3CEQA 1DVPA 4L2YA 3ASHA 4J8FA 4GMRA 4GTPA 3ZIMA 2KCLA 4XX5A 2KATA 3RSEG 3JXIA 3KS2A 5AN8A 2F8YA 1HZ4A 4WNFA 4JC8A 3LCAA 5D2MC 3WXXA 3CVPA 3CHRA 3ABME 3E33A 4GTVA 2IOSA 3FU5A 3EJNA 1L5JA 1RW2A 4I6EA 3FTSA 3OXFA 3SQVA 1D8EA 2IOLA 4KZ0A 1Q2ZA 3UM3A 3ISMC 3FULA 2XEHA 4BSXA 1JWGA 3ZW3A 2KBXA 2CHWA 3KEAA 1N54A 3RRUA 1D8DA 1SZ9A 1AWCB 2BUGA 3GYZA 2XHEA 3VLEA 4K5BA 2VGEA 3PEUB 2XEVA 1QBQA 4URKA 2JEKA 4B89A 3TXNA 1FVFA 3FWVA 4GA2A 2OVBA 1QZ2A 4GU5A 2IO2C 3RAUA 1UN8A 3S7BA 4AM9A 3TWWA 5JJTA 4G1TA 1NP7A 3HXEA 3D3MA 4Q96A 3NAWA 4GZ6A 5KBAA 2I9CA 3PE3A 1JUQA 3B7RL 2P9LG 2CHXA 3CKBA 3HXDA 3BEEA 4A1SA 4N5CA 4ANWA 3MKQA 2PL2A 4Y6WA 5CCMA 4TUUA 2QFCA 2VGXB 2BKGA 4DX2A 5LCWC 2R03A 2P9NG 3TWQA 4LERA 4HVBA 2DYSE 5G05J 2F0YA 4LNGA 3ZYLA 3UXGA 1HU3A 4EBAG 1TNZA 2ZGDA 3L82A 4E85A 3APDA 3L22A 4DX5D 3VTXA 1E7VA 1D9SA 4GYOA 5AIJA 4ACKA 1U3DA 4XKCA 2HO1A 4ANUA 3CSTA 2FO7A 2P9UG 4BETA 3LXUX 4R7LA 5IY5E 1SA5A 3T5VA 4GTQA 4J8SA 4XI0A 4YVQC 1UJKA 4I9EA 4HRMB 3ZU7B 4JL0A 3ESLA 3K9IA 4BX9A 4HLEA 4C48B 1BD8A 4GA1A 2LUHA 5T4YA 4GMLA 2LXMA 4P29A 3O48A 4DLQA 2Y3AA 4ANVA 2WVIA 4ILHB 2FI7A 3Q5MA 3PZ1A 3BUAA 2OCCE 3PNTB 2MHKA 4UI9J 1JCRA 4I6JA 1IQRA 2IF4A 3O4ZA 3ZEFA 5JJ7A 3HIZA 3J5QB 4YDOA 2NXPA 4A1GA 1H6OA 2VSOE 5ENQD 2AXZA 2LSVA 2ETBA 1G3NB 3MX3A 5D66A 1HXIA 4BX8A 4CRWA 3V2XA 4U0ZA 3W9GA 3RO2A 4GTMA 3FUEA 3SF4A 2GRPB 3C3QA 4CT4A 4F1PA 2CG3A 4H7YA 1PAQA 4HLLA 2XS1A 4OVUA 4GTRA 4KVMA 4QQIA 2QY7A 4BWRA 5LFAA 1H0AA 4A3VA 4HRNA 2VQ2A 3FUNA 3ASFA 3U64A 2Q7FA 4UI9K 2J09A 3NOGD 3Q79A 2Y4UA 4TXPA 5KJNA 3Q9NC 3Q78A 4LNUD 3LY8A 1TN6A 4LUNU 2ZIRA 1OUVA 5A7DB 3ULYA 4FJZA 2FULA 4F3VA 2BTDA 5CMWA 1SQMA 2YHEA 4GTOA 3QARA 4E6HA 4MS6A 3E30A 2R59A 3D9HA 3ML8A 5BUZA 3PS6A 2EQXA 3UT4A 2PQRA 2C0LA 2OOEA 4FHJA 5HKPA 1X5BA 4BT9A 1INZA 2OV8A 4Y6CA 3SGHA 1EPUA 3C5RA 3KAEA 3IXEA 4WWOA 5J90A 3JXJA 2XENA 5KJMA 3L6AA 3FTVA 5EKQD 3TWSA 3CHMA 2J4BA 4J8DA 4ATZD 3DSUA 3AS8A 1U3CA 5C1DA 2AVPA 3ONLA 4I6GA 3FU6A 2WPVA 2YNQA 2Y0BG 1N4RA 4PS8A 4MLPA 3Q15A 4I2ZA 3PNLB 2EIJE 4HI8A 3ZXPA 4DI3A 3Q7FA 4FULA 3EHNA 2PZIA 3UIOC 2CG2A 2A5UA 1IXVA 1FVHA 5FTPA 3CSFA 3TWVA 2Y69E 4GYYA 3R7RA 5JJ6A 1TJCA 3TG5A 5CERB 1O1SA 4NIKA 1NZNA 4HOSA 1DNPA 1N0QA 4UUCA 2VTBA 1H2TC 2VSXE 5CBOA 3GZ2A 2ZU6B 4AY6A 4Q94A 3DWLG 4NQ0A 2VGXA 2ETAA 2BKKB 3UMVA 1UJJA 5BT1A 2P58C 3ZGQA 5AQAA 3F6QA 4BTBA 3EHMA 3DSWA 3MGBA 2F37A 4IYPA 5EYLA 3CLJA 3QOUA 4A55A 5LCWJ 4AVXA 3DBSA 1ZB1A 4LRZA 4ILGA 2AJAA 3JUEA 3D9NA 3KEZA 2WQ6A 3DEOA 5ENPD 1MX2A 3UQ3A 4EZJA 3C3OA 2LNIA 3FH7A 4CDRA 4U8YD 5AQ7A 5ARFA 3PZ4A 1TNUA 4BERA 5FQ7A 2FO1E 3CHQA 2XRYA 3EUVA 1YA0A 1ZU2A 3G2VA 2IFUA 4D10C 2ETCA 4BFRA 1DC2A 4IN3B 1KLXA 1W3BA 2IO3C 4N3CA 5EDSA 2PQNA 4EZLA 2L0TB 4B93B 1EYHA 3S2AA 1TR4A 3AU5A 2L6JA 3QJZA 2DZOA 2R5SA 3L9TA 3IHYA 4JEHA 4CCAA 2VGYA 4RG9A 5HI7A 3UM2A 5JHAA 5AJLA 1TNBA 5FQ4A 4WNDA 2C0MA 3Q73A 2XQ0A 1JCSA 2ONDA 5FJYA 4BTAA 2P9PG 3JYSA 4AEZC 3ZVVA 4DLOA 1E8YA 3I4RB 2RD0A 4DX6D 3VTYA 3FUFA 3HVEB 1E8ZA 3ESKA 2X3MA 5C2YA 4C9BB 4FLBA 3AJIA 4O1OA 5G04J 2HR2A 1V54E 2FEZA 3OAWA 3PZ3A 4JHRA 3FTUA 2I1KA 4ZFHA 1HO8A 5CECB 3FH5A 3FY4A 3UPVA 4UWHA 2AWIA 3URZA 3ZUVB 4JB8P 1Z6TA 3L16A 3FUMA 2J4DA 1DCEA 4YVOA 2WXRA 5E76A 3FUJA 1OCCE 4AY5A 3FDHA 3CVVA 1YYHA 4JXTA 2EINE 1DCQA 3TGOA 2NYJA 3APFA 5ANLA 1V55E 2H6IA 1BLXB 2AXUA 3ZYMA 4HQDA 3C72A 4RVBA 4UWFA 4FU3A 4F6RD 4FJYA 2KC7A 3HXBA 2KXPC 1K8KG 1XNFA 4WNGA 4A63B 3PREA 3RRNB 2GRNB 4KMOA 1IYGA 4FADA 5CHEE 3PDNA 3B95A 1MX6A 4XEIG 4XI9A 1N9AA 2XCCA 3FUHA 1MZCA 3UKUG 4FA6A 3B7UX 3ABLE 4HXIA 3IKOB 4HI9A 1Y8MA 1ELRA 2I6HA 2X6IA 3QAQA 2KM4A 3ZXSA 3N71A 3SFXA 3SHFA 1NL4A 3T9KA 4I1OB 3KSLA 4MKTA 1RZ4A 4DJAA 5B3SE 5CBNA 2GRMA 3QDNA 1Y6IA 3P1UA 4U63A 3MV2B 3X2QE 2B6CA 3DSSA 3TWRA 3FHEA 4GTTA 4K5CA 2I1JA 5AAOA 1H6PA 4RSYA 4F53A 1O1TA 2XZDG 5DBKA 2XCBA 3EU9A 4AOFA 3LJ3A 3FEYA 3OXGA 1P5QA 1IKND 4GA0A 1TN8A 3ENEA 4I43A 3AAAC 4DPRA 4GZCA 4MBGA 3AU4A 2GGFA 3RU0A 3QNKA 2ZGGA 5ENOD 4ACLA 4N3BA 4OYSA 4O6FA 1WDYA 3LDZA 3UX4A 2ZXWE 3G2TA 3SBSA 4U8HA 3D9IA 1JWFA 3B7SA 3LVRE 3L13A 3L54A 5EIDA 4J7WA 3FU3A 1BPOA 3RRMB 1HG5A 2I2OA 2P9KG 3SNXA 3MEKA 4JA7A 3DEPA 4APFA 4PUCA 4U95D 4I1MA 3SO8A 2R17C 4WWNA 2WXLA 2X6FA 3SBTB 2A4ZA 4JHJA 3CHSA 4CEMA 3U9WA 5ARGA 4PH4B 1HG2A 1OCZE 1OCRE 3RIBA 4O1PA 5JA4D 1LTXA 2KZTA 4HOTA 4XIFA 4JZYA 5CRUA 3D9PA 2J9QA 3SI5A 2IONA 1WAO1 3PUJA 4DI4A 3QK0A 5FQ8A 1HE8A 3E32A 2J8SD 3HYMB 1LD8A 4PDXA 5ITZF 5LP0A 2MOWA 3E37A 4U04A 4KZCA 4DX7D 3BG1B 1OCOE 1FCHA 4NURA 4U96D 2BF0X 3DXKG 4ABNA 2ZISA 1SA4A 4I1AA 4WAFA 4KYOB 2B0OE 3PUKA 1S70B 2VTBB 4UI9C 2H6GA 4RG6A 2C2LA 3CK8A 5BV0A 3CQGB 1B89A 1OXJA 3PEVB 3UI2A 1NA0A 4G26A 1YMPA 3HHMA 3G2WA 4J6IA 2KZTB 1H2UA 3CGHA 1KT0A 4GPKA 1BI8B 4PS3A 3CVNA 5FINA 3UT7A 5G2NA 4LG6A 1MQSA 3J5PA 4I2WA 3DPDA 3HDXA 5AQBA 4JHKA 3VLDA 3AG2E 2WXKA 5EX0A 3RO3A 5ENSD 1OWLA 4AP2A 1KPSB 1S63A 4GMJA 3CV0A 3ULQA 3V79K 4I9CA 3DSTA 4K03A 4HS2A 4OAVB 3CVWA 3BG0B 3R9MA 3RK6A 5G05C 2X38A 1LF8A 4OAUC 3FUIA 2QYJA 2OEVA 3ZN3A 4IULA 2WXQA 3HG0D 3PE4A 3MCXA 4J0UA 3GZSA 4B94A 2E0IA 3LYAA 4B0ZA 2L9BA 4JD2G 3OTNA 5CEAA 5AYWD 2LO6A 3AG4E 3LEWA 2WXJA 2P9SG 4TXRA 3HXFA 3D9MA 1NA3A 5J08A 3NQPA 4EQFA 3CVXA 2F8XK 4U7EB 5CMYA 4WWPA 3SZ7A 4WUYA 4LEUA 4JPSA 3EHQA 5FWQA 1NFIE 3MV3B 4N39A 3V2OA 4U0SA 1H19A 2GRLA 3FH8A 1KT1A 2R2LA 1UN9A 4ZHBA 5EILA 2WMNA 4H7XA 2P9IG 2DBAA 3MKRA 5BW8C 3ASNE 2XPYA 2KCKA 1Z3YA 4M3OA 5ENTD 2WXPA 3Q49B 2GRQB 3ZHEB 1X81A 5A6CA 4G8LA 3PVLA 2RKKA 4HORA 2HM8A 3LPZA 5E75A 3IHVA 2FBNA 3L08A 5AARA 3OXLA 4UWKA 5HRYA 4GAAA 2AW6A 3EU5A 3ZKJA 3LJNA 2IQCA 2EILE 3TJPA 2FF4A 2GROB 3FEXA 5KWDA 1EDUA 2Y4TA 2WQ7A 4HFGA 1OWMA 4GPMA 1NI1A 1IHGA 3PZ2A 2V0PA 2IJGX 3AS5A 5A23A 2MRIA 1MJ0A 3JCKC 1MHQA 2PM7A 4F7AA 3EIQC 5AJDA 1N94A 4BEPA 2YINA 4L23A 5CEDB 4UWGA 4Q69A 2JABA 4KVOA 1ELKA 3B7BA 4L9PA 2IU1A 4RQIA 5FZSA 5EYPF 1O5MA 4ANXA 4CDNA 1H2VC 3MZLB 4G23A 1E7UA 2H6HA 4J8EA 3ZHEA 3NZSA 3EHRA 3E34A 1ELWA 4F1SA 4GZ5A 5CRVA 2MYOA 4KBQA
chains in the Genus database with same CATH topology
1TEZA 2VQ2A 4MKTA 4GB9A 2VYIA 3QWVA 4DJAA 3FUNA 3ASFA 5FT9A 3ONKA 2DIWA 4HOUA 5DIZA 3C98A 4G24A 5ANRA 3U64A 2Q7FA 2GRMA 3L17A 2LAHA 4JEUA 3CQCB 3QDNA 4UI9K 5D0QD 2WXNA 1N52A 3MJWA 1Y6IA 3P1UA 2J09A 4U63A 3ZRHA 2J08A 3SD5A 3CKCA 2Y4UA 2J07A 3MV2B 3TG4A 5KJNA 3T5XA 3AS4A 4TRQA 4HOQA 3QWWA 4FC8A 3HVEA 4LCTA 3TAXA 4APOA 3FHEA 4C0EA 2I1JA 3JQ1A 4RSYA 4F53A 3LY8A 4G11A 4XKBA 4G2VA 4LUNU 3CVLA 1WY6A 3I3NA 3S7DA 1OUVA 5DBKA 2XCBA 4JW1A 5A7DB 3LVQE 2GW1A 4AOFA 4FJZA 3LJ3A 3FTYA 3FEYA 3OXGA 2FULA 1P5QA 4CT0A 4F3VA 4GZ3A 4UQZA 2CFUA 4XE0A 2VSYA 4L1BA 2BTDA 2UWJG 3FUKA 5T8IA 5CMWA 4GA0A 4EECA 1SQMA 3ENEA 4KT6B 5D0OD 4I43A 3FU0A 2YHEA 4K0RA 4DPRA 4GZCA 4I17A 2CHZA 1EF1C 1HFAA 2JLBA 4CGVA 3QARA 4E6HA 4EZKA 3AU4A 2GGFA 4NRHB 3RU0A 4MS6A 3QNKA 2X6HA 3UT8A 4ACLA 3B13A 4N3BA 4V3IA 4OYSA 4PS7A 4O6FA 2R59A 2XGSA 3D9KA 3ML8A 2OVFA 3LDZA 5LOZA 5BUZA 3ZYQA 3UX4A 3P2BA 4B8CB 3G2TA 3PS6A 3SBSA 2EQXA 3Q4AB 3D9IA 1JWFA 2PQRA 3B7SA 2C0LA 3LVRE 2PM6A 3L13A 3G2SA 3L54A 2E2EA 2OOEA 4N3AA 3FTWA 4FHJA 4JA9A 3VLFA 3CK9A 4GCNA 1PY1A 2XRZA 3FU3A 1X5BA 1BPOA 4BT9A 2L0IA 3FTZA 1HG5A 3RRMB 2HYZA 2I2OA 1INZA 4A3TA 2NSZA 3SNXA 3MEKA 2OV8A 1OWPA 3G2UA 3CVUA 3NF1A 4JA7A 4APFA 4Y6CA 1OWOA 4PUCA 3SGHA 3IEGA 1EPUA 3IV0A 4I1MA 2R17C 4WWNA 3EDTB 1TJFA 2WXLA 3KAEA 2X6FA 3SBTB 2A4ZA 4WWOA 5J90A 4JHJA 1OWNA 4DK5A 3CHSA 4CEMA 3APCA 3U9WA 1XGWA 3D9OA 3LS8A 2J49A 5KJMA 3CIAA 5ARGA 3L6AA 4ME2A 3FTVA 5G55A 5EKQD 4L2LA 4PH4B 1HG2A 1E96B 5HQ8A 5CCLA 3CHMA 2M63A 3RIBA 2J4BA 4J8DA 2KZTA 3S7JA 3I4GA 3MYVA 4HOTA 3AS8A 4XIFA 1U3CA 5C1DA 4WNEA 5KCMA 3RJVA 2AVPA 2XGOA 3ONLA 3D9PA 3FU6A 4I6GA 4JZYA 4EBAA 4W9RA 2WPVA 5JHBA 2YNQA 2J9QA 2WMOA 4FP7A 3SI5A 4PS8A 4MLPA 3Q15A 2IONA 2WM9A 1WAO1 2WXHA 4I2ZA 3PUJA 5FZQA 4DI4A 3QK0A 5FQ8A 1HE8A 3PNLB 3TL5A 4AV7A 3HYMB 4OVVA 3CEQA 3CK7A 1DVPA 3U66A 4L2YA 2ILRA 2RG8A 4PDXA 3ASHA 4J8FA 5G04C 5LP0A 3ZIMA 4DI3A 2MOWA 4CDMA 3LY9A 4FULA 4U04A 4KZCA 3EHNA 2PZIA 3BG1B 4KXKB 1FCHA 1HF8A 2KCLA 4UQYA 4XX5A 2KATA 4NURA 2BF0X 3KS2A 2CG2A 2A5UA 4ABNA 1HZ4A 4GZDA 4WNFA 1HS6A 4AIFA 4I1AA 2YHCA 1FVHA 3B7TA 2XGMA 5FTPA 3CSFA 4WAFA 4GYYA 4KYOB 4TV3A 2AXVA 5FZRA 5JJ6A 3R7RA 1TJCA 3PUKA 3TG5A 1HX8A 1PC2A 4ILIA 2VTBB 4UI9C 3JQ0A 4JC8A 3LCAA 3WXXA 4HOSA 1NZNA 4RG6A 2WXGA 3PH0C 2C2LA 3CVPA 3CK8A 1DNPA 5BV0A 3CQGB 3CHRA 4EPZA 1B89A 2IOSA 3FU5A 3EJNA 3ASDA 2VTBA 3PEVB 2WXOA 1L5JA 2WQHA 1H2TC 2VSXE 1NA0A 4G26A 2V4LA 4I6EA 3FTSA 2X6KA 3OXFA 3HHMA 3G2WA 3GZ2A 2IOLA 4KZ0A 2ZU6B 4AY6A 2CFZA 4J6IA 4Q94A 5ENNA 3QB2A 2KZTB 1H2UA 2KCVA 3FULA 3MA5A 3CGHA 1KT0A 4BSXA 4NQ0A 1JWGA 3LY7A 4GPKA 2VGXA 4PS3A 3ZW3A 3CVNA 3UMVA 3UT7A 5G2NA 1UJJA 2CHWA 2P58C 5BT1A 1MQSA 3ZGQA 1N54A 3RRUA 4BTBA 4C0MA 1QNFA 1SZ9A 3EHMA 3E4BA 1QQEA 4I2WA 3DPDA 3MGBA 2BUGA 3HDXA 4IYPA 3GYZA 3CLJA 4L7TA 3QOUA 4A55A 5LCWJ 4AVXA 4JHKA 2XHEA 3VLEA 3DBSA 3VLDA 2WXKA 4FLHA 4LRZA 2UY1B 4ILGA 3SFZA 5EX0A 3RO3A 3PEUB 4AXHA 3D9NA 3KEZA 2WQ6A 2XEVA 1E8WA 4URKA 2JEKA 4B89A 3TXNA 1OWLA 3ML9A 1Z3XA 1FVFA 3UQ3A 2UY1A 3FWVA 4GA2A 4AP2A 4EZJA 2OVBA 1QZ2A 2VJ8A 4GU5A 4QFVA 4GMJA 2LAIA 3CV0A 4N2QA 2LNIA 3ULQA 1UN8A 3S7BA 4I9CA 4AM9A 3FH7A 4CDRA 4K03A 4HS2A 5JJTA 3U3WA 4G1TA 1NP7A 3CVWA 3QC1A 3BG0B 3D3MA 2XPIA 5ARFA 4Q96A 1E8XA 2YQ8A 4U07A 3RK6A 2X38A 3CHPA 4GZ6A 5FQ7A 1LF8A 2I9CA 3PE3A 5G05C 3FUIA 4NACA 3CHQA 4UQXA 2XRYA 5KJLA 1JUQA 1YA0A 3B7RL 1ZU2A 3G2VA 2IFUA 5T3RA 5LX8A 4D10C 4BFRA 4IN3B 1KLXA 1W3BA 3ZN3A 4IULA 2CHXA 2WXQA 4IRUA 1ZBPA 3GZ1A 4N3CA 3PE4A 2PQNA 5EDSA 3R9AB 4EZLA 2L0TB 2WXFA 3CKBA 3MCXA 4J0UA 3CHOA 3GZSA 1EYHA 3Q47B 3S2AA 4B94A 3AU5A 2XPZA 2L6JA 3BEEA 3ASGA 4A1SA 2E0IA 3LYAA 4B0ZA 2L9BA 3QJZA 4XZ4A 4N5CA 4ANWA 3MKQA 2R5SA 3UUXA 2PL2A 3IHYA 4U8HA 3OTNA 4JEHA 4CCAA 5AYWD 2LO6A 4Y6WA 5CCMA 4TUUA 1JPLA 4U0UA 2VGYA 4RG9A 5HI7A 2QFCA 5JHAA 3LEWA 2WXJA 2DCPA 1UW4B 2VGXB 3NZUA 3PRZA 5AJLA 5AENA 3RKVA 3D9MA 5FQ4A 2WB2A 1NA3A 3QWPA 4WNDA 5LCWC 2C0MA 4GYWA 5J08A 2XQ0A 3NQPA 3CVYA 4EQFA 3CVQA 4LERA 4HVBA 3CVXA 5G05J 5CMYA 1E90A 2ONDA 4WWPA 5FJYA 3SZ7A 3ZYLA 1HU3A 4WUYA 4BTAA 4LEUA 4EBAG 4JPSA 5FWQA 4N2SA 3MV3B 2WXMA 4N39A 2WXIA 3JYSA 4E85A 4AEZC 4U0SA 1H19A 3ZVVA 2GRLA 4DLOA 1E8YA 3APDA 3FH8A 1KT1A 2RD0A 3I4RB 3TXMA 3VTYA 1GW6A 3FUFA 3R7QA 3L22A 3HVEB 1E8ZA 3ESKA 1E7VA 2X3MA 5C2YA 3VTXA 4GYOA 3ZYKA 4YNDA 1UN9A 4FLBA 4ACKA 4C9BB 5AIJA 4CGWA 1U3DA 2VSNA 5G04J 4XKCA 2HO1A 2HR2A 2WMNA 4H7XA 2FEZA 3OAWA 3S7FA 4ANUA 3CSTA 4JHRA 3FTUA 2DBAA 3I5PA 2FO7A 3MKRA 5BW8C 3FTXA 2I1KA 3LXUX 4R7LA 3T8MA 3T5VA 1HO8A 2NC9A 3D9JA 2XPYA 3FH5A 4J8SA 4XI0A 2KCKA 1Z3YA 4ATGA 3FY4A 4M3OA 5BNWA 3UPVA 2WXPA 4YVQC 1UJKA 4UWHA 3U4TA 1WM5A 4I9EA 2AWIA 5BV1A 3Q49B 1VDYA 4JL0A 3ESLA 3URZA 4MRUA 3K9IA 3ZPJA 1Z6TA 4AJWA 4BX9A 3ZHEB 4HLEA 3L16A 3FUMA 2J4DA 5A6CA 3FP3A 4GA1A 5T4YA 4GMLA 4YVOA 3PVLA 2WXRA 5E76A 4FHKA 4HORA 2HM8A 3LPZA 4P29A 3O48A 3FUJA 3IHVA 5E75A 4DLQA 4AY5A 2FBNA 2Y3AA 3L08A 4ANVA 3FDHA 3OXLA 3CVVA 2WVIA 4ILHB 3LKUA 2FI7A 3Q5MA 4JXTA 4UWKA 3TGOA 4GAAA 2AW6A 3FUDA 3APFA 5ANLA 5BPPA 2IQCA 3GW4A 3ZFWA 3ZYMA 2AXUA 3TJPA 2FF4A 3PNTB 3UT4A 4RVBA 3FEXA 2V5FA 4UWFA 2MHKA 4FU3A 4UI9J 3CR3A 1EDUA 2Y4TA 4I6JA 4JVSA 2WQ7A 4FJYA 2KC7A 1IQRA 4BY6A 4HFGA 2IF4A 1OWMA 3O4ZA 3ZEFA 1IHGA 5M72A 5JJ7A 4UWLA 1XNFA 2V0PA 4WNGA 2IJGX 3AS5A 3HIZA 5A23A 3MKQB 1H6KA 2MRIA 3JCKC 3PREA 3RRNB 4KMOA 1MHQA 1IYGA 2PM7A 2NXPA 4A1GA 2VSOE 4FADA 5CHEE 2AXZA 3PDNA 4F7AA 4BT8A 3EIQC 2V8SE 2LSVA 5AJDA 3MX3A 1HH8A 5FQ6A 2X6JA 2YINA 4L23A 1HXIA 4XI9A 4UWGA 2XCCA 3FUHA 4Q69A 1IQUA 4BX8A 4B8AA 4CRWA 3IBEA 4G25A 1S0PA 4KVOA 3JUIA 1ELKA 4FA6A 3D9LA 5EX3A 3QKYA 3KD7A 2IU1A 3B7UX 4U0ZA 5KJKA 4HXIA 3RO2A 5FZSA 1A17A 3FUEA 3SF4A 4GCOA 3IKOB 4ANXA 4CDNA 1H2VC 1Y8MA 1ELRA 2I6HA 3MZLB 4G23A 4CT4A 1E7UA 2CG3A 4H7YA 2X6IA 3PZDA 3QAQA 4J8EA 1PAQA 2KM4A 3ZHEA 3NZSA 3ZXSA 1UG3A 3N71A 2LSUA 4OVUA 4KVMA 3SHFA 1ELWA 2QY7A 4F1SA 3FFLA 4GZ5A 1SZAA 4BWRA 5LFAA 3EIJA 1H0AA 4A3VA 4I1OB 4KBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVI A;  4AEZ C;  3SI5 A;  2LAH A;  4A1G A; 
#chains in the Genus database with same CATH topology
 1LD7 A;  2VYI A;  3BU8 A;  5FT9 A;  3ONK A;  2DIW A;  3T8K A;  5DIZ A;  3C98 A;  4G24 A;  3L17 A;  4JEU A;  5D0Q D;  1N52 A;  3DPY A;  3MJW A;  3UTM A;  3SD5 A;  3CKC A;  2J07 A;  3T5X A;  4TRQ A;  4HOQ A;  3TWT A;  3QWW A;  3TAX A;  4APO A;  2RFA A;  4G11 A;  4XKB A;  1QYM A;  3I3N A;  4LSZ E;  3HRA A;  4JW1 A;  2V5Q C;  1N4Q A;  3ULE G;  3FTY A;  2CFU A;  1YCS B;  2VSY A;  2UWJ G;  3FUK A;  4O60 A;  3FU0 A;  4I17 A;  2CHZ A;  1EF1 C;  4CGV A;  4NRH B;  3UT8 A;  4LNB A;  3B13 A;  4V3I A;  1TYQ G;  4PS7 A;  3D9K A;  2OVF A;  5LOZ A;  3ZYQ A;  4B8C B;  1FPP A;  2PM6 A;  3G2S A;  2E2E A;  4N3A A;  3CK9 A;  4GCN A;  2XRZ A;  3V31 A;  3FTZ A;  2HYZ A;  4YDE A;  2NSZ A;  3G2U A;  3CVU A;  1K1B A;  3EDT B;  3W9F A;  4YDY A;  1OWN A;  3APC A;  1XGW A;  3LS8 A;  2J49 A;  4ME2 A;  5G55 A;  1E96 B;  2M63 A;  2EIK E;  3I4G A;  3MYV A;  1N4P A;  5KCM A;  3RJV A;  3AG1 E;  4EBA A;  2XGO A;  2QC9 A;  4W9R A;  1KZO A;  4FP7 A;  5BXO A;  1FT1 A;  2WM9 A;  1UOH A;  2WXH A;  2EIM E;  3ASO E;  3ABK E;  4AV7 A;  1BU9 A;  4OVV A;  3CK7 A;  3U66 A;  2XS8 A;  2ILR A;  2RG8 A;  5G04 C;  5JMN D;  3SFY A;  4CDM A;  3LY9 A;  4DUI A;  4KXK B;  1HF8 A;  4UQY A;  1N11 A;  4GZD A;  1HS6 A;  4AIF A;  2YHC A;  3B7T A;  2XGM A;  2PNN A;  2LXL A;  4TV3 A;  2AXV A;  4N5Q A;  5FZR A;  4CYM D;  1HX8 A;  1PC2 A;  4ILI A;  3JQ0 A;  3Q75 A;  2WXG A;  3PH0 C;  4EPZ A;  4GTS A;  1A5E A;  3ASD A;  2WXO A;  2WQH A;  5FIO A;  5HS0 A;  4J8Y A;  2V4L A;  2X6K A;  4TUM A;  2CFZ A;  5ENN A;  4CZ2 D;  3QB2 A;  2KCV A;  3MA5 A;  3LY7 A;  3Q7A A;  1Z5S C;  3UIP C;  1O1R A;  4C0M A;  1QNF A;  3E4B A;  1QQE A;  3UKR G;  3V30 A;  4L7T A;  2DWZ A;  4X8Q A;  4FLH A;  3BQO A;  3SFZ A;  2UY1 B;  1K1A A;  4AXH A;  1N95 A;  1E8W A;  3ML9 A;  1Z3X A;  4RLY A;  2UY1 A;  2VJ8 A;  4QFV A;  2LAI A;  4N2Q A;  1SVX A;  1WG0 A;  3U3W A;  4HB5 A;  3QC1 A;  5H7P A;  1U2V G;  2XPI A;  1E8X A;  2YQ8 A;  4U07 A;  3CHP A;  3DSX A;  5KJL A;  2L6B A;  4NAC A;  4UQX A;  5T3R A;  5LX8 A;  3KSQ A;  5B1B E;  2R02 A;  4IRU A;  1ZBP A;  3GZ1 A;  3R9A B;  2WXF A;  3CHO A;  3Q47 B;  3AG3 E;  2XPZ A;  3ASG A;  1S64 A;  4XZ4 A;  3UUX A;  2OEW A;  3C3R A;  1JPL A;  4U0U A;  4BES A;  2DCP A;  1UW4 B;  3NZU A;  5BXU A;  3PRZ A;  5AEN A;  3RKV A;  2WB2 A;  3QWP A;  4GYW A;  3CVY A;  3CVQ A;  2RFM A;  3Q9U C;  1E90 A;  1TN7 A;  4N2S A;  4DX1 A;  2WXM A;  2WXI A;  4M7C A;  4U8V D;  3SY2 A;  3TXM A;  1GW6 A;  3R7Q A;  4Z68 A;  3ZYK A;  4YND A;  4CGW A;  2XEE A;  2VSN A;  3S7F A;  4YDW A;  3I5P A;  3FTX A;  2H6F A;  3T8M A;  2NC9 A;  1IHB A;  3D9J A;  5BNW A;  4ATG A;  3DRA A;  3U4T A;  1WM5 A;  1VDY A;  3DSV A;  4MRU A;  3ZPJ A;  4AJW A;  5ENR D;  5AQ9 A;  3FP3 A;  1OY3 D;  4FHK A;  4DRX E;  3LKU A;  1KZP A;  2P2C P;  1OT8 A;  3FUD A;  5BPP A;  3ZFW A;  3GW4 A;  1BI7 B;  4BSZ B;  1TNO A;  2V5F A;  4TXQ A;  3CR3 A;  3NB2 A;  4JVS A;  4BY6 A;  5M72 A;  4UWL A;  3UIN C;  3MKQ B;  1H6K A;  4K5A B;  3WG7 E;  4BT8 A;  2V8S E;  2GRR B;  1HH8 A;  4EHM A;  5FQ6 A;  2X6J A;  5KNG A;  1IQU A;  1N0R A;  4B8A A;  3IBE A;  4G25 A;  1S0P A;  3ZNG A;  3JUI A;  3D9L A;  5EX3 A;  3QKY A;  3KD7 A;  5KJK A;  4HNA D;  2DVW A;  1A17 A;  4GCO A;  3HXC A;  1AP7 A;  2DZN A;  2HE0 A;  3PZD A;  1UG3 A;  2LSU A;  4HBD A;  3DXM G;  3FFL A;  2QZA A;  1SZA A;  3EIJ A;  3UM1 A;  5BV1 A;  1FT2 A;  1TEZ A;  5KNH D;  4GB9 A;  3NOC D;  3QWV A;  4HOU A;  5ANR A;  2LAH A;  3CQC B;  1JCQ A;  2WXN A;  3ZRH A;  2J08 A;  3TG4 A;  3AS4 A;  4LCT A;  4FC8 A;  3HVE A;  4C0E A;  3JQ1 A;  4G2V A;  3CVL A;  3S7D A;  1WY6 A;  2XZT G;  3LVQ E;  4HRL A;  2GW1 A;  3TWU A;  4CT0 A;  4GZ3 A;  4UQZ A;  4XE0 A;  4L1B A;  1MYO A;  5T8I A;  4EEC A;  3NBN B;  4KT6 B;  1MX4 A;  5D0O D;  4K0R A;  2V4H C;  1HFA A;  2JLB A;  2QYU A;  4EZK A;  5EIB E;  2X6H A;  2XGS A;  2R05 A;  3P2B A;  2BED A;  3Q4A B;  2A5E A;  5EN5 D;  3FTW A;  4JA9 A;  3VLF A;  1PY1 A;  2L0I A;  4A3T A;  1OWP A;  3NF1 A;  1K3Z D;  3UM0 A;  5B1A E;  1OWO A;  3IEG A;  3IV0 A;  1SW6 A;  1N4S A;  1TJF A;  3TWX A;  4DK5 A;  3D9O A;  4G8K A;  3CIA A;  4L2L A;  2Y1L E;  2DYR E;  5HQ8 A;  5CCL A;  2IEJ A;  3S7J A;  1TNY A;  4WNE A;  2IY0 C;  5JHB A;  2WMO A;  5FZQ A;  3TL5 A;  3CEQ A;  1DVP A;  4L2Y A;  3ASH A;  4J8F A;  4GMR A;  4GTP A;  3ZIM A;  2KCL A;  4XX5 A;  2KAT A;  3RSE G;  3JXI A;  3KS2 A;  5AN8 A;  2F8Y A;  1HZ4 A;  4WNF A;  4JC8 A;  3LCA A;  5D2M C;  3WXX A;  3CVP A;  3CHR A;  3ABM E;  3E33 A;  4GTV A;  2IOS A;  3FU5 A;  3EJN A;  1L5J A;  1RW2 A;  4I6E A;  3FTS A;  3OXF A;  3SQV A;  1D8E A;  2IOL A;  4KZ0 A;  1Q2Z A;  3UM3 A;  3ISM C;  3FUL A;  2XEH A;  4BSX A;  1JWG A;  3ZW3 A;  2KBX A;  2CHW A;  3KEA A;  1N54 A;  3RRU A;  1D8D A;  1SZ9 A;  1AWC B;  2BUG A;  3GYZ A;  2XHE A;  3VLE A;  4K5B A;  2VGE A;  3PEU B;  2XEV A;  1QBQ A;  4URK A;  2JEK A;  4B89 A;  3TXN A;  1FVF A;  3FWV A;  4GA2 A;  2OVB A;  1QZ2 A;  4GU5 A;  2IO2 C;  3RAU A;  1UN8 A;  3S7B A;  4AM9 A;  3TWW A;  5JJT A;  4G1T A;  1NP7 A;  3HXE A;  3D3M A;  4Q96 A;  3NAW A;  4GZ6 A;  5KBA A;  2I9C A;  3PE3 A;  1JUQ A;  3B7R L;  2P9L G;  2CHX A;  3CKB A;  3HXD A;  3BEE A;  4A1S A;  4N5C A;  4ANW A;  3MKQ A;  2PL2 A;  4Y6W A;  5CCM A;  4TUU A;  2QFC A;  2VGX B;  2BKG A;  4DX2 A;  5LCW C;  2R03 A;  2P9N G;  3TWQ A;  4LER A;  4HVB A;  2DYS E;  5G05 J;  2F0Y A;  4LNG A;  3ZYL A;  3UXG A;  1HU3 A;  4EBA G;  1TNZ A;  2ZGD A;  3L82 A;  4E85 A;  3APD A;  3L22 A;  4DX5 D;  3VTX A;  1E7V A;  1D9S A;  4GYO A;  5AIJ A;  4ACK A;  1U3D A;  4XKC A;  2HO1 A;  4ANU A;  3CST A;  2FO7 A;  2P9U G;  4BET A;  3LXU X;  4R7L A;  5IY5 E;  1SA5 A;  3T5V A;  4GTQ A;  4J8S A;  4XI0 A;  4YVQ C;  1UJK A;  4I9E A;  4HRM B;  3ZU7 B;  4JL0 A;  3ESL A;  3K9I A;  4BX9 A;  4HLE A;  4C48 B;  1BD8 A;  4GA1 A;  2LUH A;  5T4Y A;  4GML A;  2LXM A;  4P29 A;  3O48 A;  4DLQ A;  2Y3A A;  4ANV A;  2WVI A;  4ILH B;  2FI7 A;  3Q5M A;  3PZ1 A;  3BUA A;  2OCC E;  3PNT B;  2MHK A;  4UI9 J;  1JCR A;  4I6J A;  1IQR A;  2IF4 A;  3O4Z A;  3ZEF A;  5JJ7 A;  3HIZ A;  3J5Q B;  4YDO A;  2NXP A;  4A1G A;  1H6O A;  2VSO E;  5ENQ D;  2AXZ A;  2LSV A;  2ETB A;  1G3N B;  3MX3 A;  5D66 A;  1HXI A;  4BX8 A;  4CRW A;  3V2X A;  4U0Z A;  3W9G A;  3RO2 A;  4GTM A;  3FUE A;  3SF4 A;  2GRP B;  3C3Q A;  4CT4 A;  4F1P A;  2CG3 A;  4H7Y A;  1PAQ A;  4HLL A;  2XS1 A;  4OVU A;  4GTR A;  4KVM A;  4QQI A;  2QY7 A;  4BWR A;  5LFA A;  1H0A A;  4A3V A;  4HRN A;  2VQ2 A;  3FUN A;  3ASF A;  3U64 A;  2Q7F A;  4UI9 K;  2J09 A;  3NOG D;  3Q79 A;  2Y4U A;  4TXP A;  5KJN A;  3Q9N C;  3Q78 A;  4LNU D;  3LY8 A;  1TN6 A;  4LUN U;  2ZIR A;  1OUV A;  5A7D B;  3ULY A;  4FJZ A;  2FUL A;  4F3V A;  2BTD A;  5CMW A;  1SQM A;  2YHE A;  4GTO A;  3QAR A;  4E6H A;  4MS6 A;  3E30 A;  2R59 A;  3D9H A;  3ML8 A;  5BUZ A;  3PS6 A;  2EQX A;  3UT4 A;  2PQR A;  2C0L A;  2OOE A;  4FHJ A;  5HKP A;  1X5B A;  4BT9 A;  1INZ A;  2OV8 A;  4Y6C A;  3SGH A;  1EPU A;  3C5R A;  3KAE A;  3IXE A;  4WWO A;  5J90 A;  3JXJ A;  2XEN A;  5KJM A;  3L6A A;  3FTV A;  5EKQ D;  3TWS A;  3CHM A;  2J4B A;  4J8D A;  4ATZ D;  3DSU A;  3AS8 A;  1U3C A;  5C1D A;  2AVP A;  3ONL A;  4I6G A;  3FU6 A;  2WPV A;  2YNQ A;  2Y0B G;  1N4R A;  4PS8 A;  4MLP A;  3Q15 A;  4I2Z A;  3PNL B;  2EIJ E;  4HI8 A;  3ZXP A;  4DI3 A;  3Q7F A;  4FUL A;  3EHN A;  2PZI A;  3UIO C;  2CG2 A;  2A5U A;  1IXV A;  1FVH A;  5FTP A;  3CSF A;  3TWV A;  2Y69 E;  4GYY A;  3R7R A;  5JJ6 A;  1TJC A;  3TG5 A;  5CER B;  1O1S A;  4NIK A;  1NZN A;  4HOS A;  1DNP A;  1N0Q A;  4UUC A;  2VTB A;  1H2T C;  2VSX E;  5CBO A;  3GZ2 A;  2ZU6 B;  4AY6 A;  4Q94 A;  3DWL G;  4NQ0 A;  2VGX A;  2ETA A;  2BKK B;  3UMV A;  1UJJ A;  5BT1 A;  2P58 C;  3ZGQ A;  5AQA A;  3F6Q A;  4BTB A;  3EHM A;  3DSW A;  3MGB A;  2F37 A;  4IYP A;  5EYL A;  3CLJ A;  3QOU A;  4A55 A;  5LCW J;  4AVX A;  3DBS A;  1ZB1 A;  4LRZ A;  4ILG A;  2AJA A;  3JUE A;  3D9N A;  3KEZ A;  2WQ6 A;  3DEO A;  5ENP D;  1MX2 A;  3UQ3 A;  4EZJ A;  3C3O A;  2LNI A;  3FH7 A;  4CDR A;  4U8Y D;  5AQ7 A;  5ARF A;  3PZ4 A;  1TNU A;  4BER A;  5FQ7 A;  2FO1 E;  3CHQ A;  2XRY A;  3EUV A;  1YA0 A;  1ZU2 A;  3G2V A;  2IFU A;  4D10 C;  2ETC A;  4BFR A;  1DC2 A;  4IN3 B;  1KLX A;  1W3B A;  2IO3 C;  4N3C A;  5EDS A;  2PQN A;  4EZL A;  2L0T B;  4B93 B;  1EYH A;  3S2A A;  1TR4 A;  3AU5 A;  2L6J A;  3QJZ A;  2DZO A;  2R5S A;  3L9T A;  3IHY A;  4JEH A;  4CCA A;  2VGY A;  4RG9 A;  5HI7 A;  3UM2 A;  5JHA A;  5AJL A;  1TNB A;  5FQ4 A;  4WND A;  2C0M A;  3Q73 A;  2XQ0 A;  1JCS A;  2OND A;  5FJY A;  4BTA A;  2P9P G;  3JYS A;  4AEZ C;  3ZVV A;  4DLO A;  1E8Y A;  3I4R B;  2RD0 A;  4DX6 D;  3VTY A;  3FUF A;  3HVE B;  1E8Z A;  3ESK A;  2X3M A;  5C2Y A;  4C9B B;  4FLB A;  3AJI A;  4O1O A;  5G04 J;  2HR2 A;  1V54 E;  2FEZ A;  3OAW A;  3PZ3 A;  4JHR A;  3FTU A;  2I1K A;  4ZFH A;  1HO8 A;  5CEC B;  3FH5 A;  3FY4 A;  3UPV A;  4UWH A;  2AWI A;  3URZ A;  3ZUV B;  4JB8 P;  1Z6T A;  3L16 A;  3FUM A;  2J4D A;  1DCE A;  4YVO A;  2WXR A;  5E76 A;  3FUJ A;  1OCC E;  4AY5 A;  3FDH A;  3CVV A;  1YYH A;  4JXT A;  2EIN E;  1DCQ A;  3TGO A;  2NYJ A;  3APF A;  5ANL A;  1V55 E;  2H6I A;  1BLX B;  2AXU A;  3ZYM A;  4HQD A;  3C72 A;  4RVB A;  4UWF A;  4FU3 A;  4F6R D;  4FJY A;  2KC7 A;  3HXB A;  2KXP C;  1K8K G;  1XNF A;  4WNG A;  4A63 B;  3PRE A;  3RRN B;  2GRN B;  4KMO A;  1IYG A;  4FAD A;  5CHE E;  3PDN A;  3B95 A;  1MX6 A;  4XEI G;  4XI9 A;  1N9A A;  2XCC A;  3FUH A;  1MZC A;  3UKU G;  4FA6 A;  3B7U X;  3ABL E;  4HXI A;  3IKO B;  4HI9 A;  1Y8M A;  1ELR A;  2I6H A;  2X6I A;  3QAQ A;  2KM4 A;  3ZXS A;  3N71 A;  3SFX A;  3SHF A;  1NL4 A;  3T9K A;  4I1O B;  3KSL A;  4MKT A;  1RZ4 A;  4DJA A;  5B3S E;  5CBN A;  2GRM A;  3QDN A;  1Y6I A;  3P1U A;  4U63 A;  3MV2 B;  3X2Q E;  2B6C A;  3DSS A;  3TWR A;  3FHE A;  4GTT A;  4K5C A;  2I1J A;  5AAO A;  1H6P A;  4RSY A;  4F53 A;  1O1T A;  2XZD G;  5DBK A;  2XCB A;  3EU9 A;  4AOF A;  3LJ3 A;  3FEY A;  3OXG A;  1P5Q A;  1IKN D;  4GA0 A;  1TN8 A;  3ENE A;  4I43 A;  3AAA C;  4DPR A;  4GZC A;  4MBG A;  3AU4 A;  2GGF A;  3RU0 A;  3QNK A;  2ZGG A;  5ENO D;  4ACL A;  4N3B A;  4OYS A;  4O6F A;  1WDY A;  3LDZ A;  3UX4 A;  2ZXW E;  3G2T A;  3SBS A;  4U8H A;  3D9I A;  1JWF A;  3B7S A;  3LVR E;  3L13 A;  3L54 A;  5EID A;  4J7W A;  3FU3 A;  1BPO A;  3RRM B;  1HG5 A;  2I2O A;  2P9K G;  3SNX A;  3MEK A;  4JA7 A;  3DEP A;  4APF A;  4PUC A;  4U95 D;  4I1M A;  3SO8 A;  2R17 C;  4WWN A;  2WXL A;  2X6F A;  3SBT B;  2A4Z A;  4JHJ A;  3CHS A;  4CEM A;  3U9W A;  5ARG A;  4PH4 B;  1HG2 A;  1OCZ E;  1OCR E;  3RIB A;  4O1P A;  5JA4 D;  1LTX A;  2KZT A;  4HOT A;  4XIF A;  4JZY A;  5CRU A;  3D9P A;  2J9Q A;  3SI5 A;  2ION A;  1WAO 1;  3PUJ A;  4DI4 A;  3QK0 A;  5FQ8 A;  1HE8 A;  3E32 A;  2J8S D;  3HYM B;  1LD8 A;  4PDX A;  5ITZ F;  5LP0 A;  2MOW A;  3E37 A;  4U04 A;  4KZC A;  4DX7 D;  3BG1 B;  1OCO E;  1FCH A;  4NUR A;  4U96 D;  2BF0 X;  3DXK G;  4ABN A;  2ZIS A;  1SA4 A;  4I1A A;  4WAF A;  4KYO B;  2B0O E;  3PUK A;  1S70 B;  2VTB B;  4UI9 C;  2H6G A;  4RG6 A;  2C2L A;  3CK8 A;  5BV0 A;  3CQG B;  1B89 A;  1OXJ A;  3PEV B;  3UI2 A;  1NA0 A;  4G26 A;  1YMP A;  3HHM A;  3G2W A;  4J6I A;  2KZT B;  1H2U A;  3CGH A;  1KT0 A;  4GPK A;  1BI8 B;  4PS3 A;  3CVN A;  5FIN A;  3UT7 A;  5G2N A;  4LG6 A;  1MQS A;  3J5P A;  4I2W A;  3DPD A;  3HDX A;  5AQB A;  4JHK A;  3VLD A;  3AG2 E;  2WXK A;  5EX0 A;  3RO3 A;  5ENS D;  1OWL A;  4AP2 A;  1KPS B;  1S63 A;  4GMJ A;  3CV0 A;  3ULQ A;  3V79 K;  4I9C A;  3DST A;  4K03 A;  4HS2 A;  4OAV B;  3CVW A;  3BG0 B;  3R9M A;  3RK6 A;  5G05 C;  2X38 A;  1LF8 A;  4OAU C;  3FUI A;  2QYJ A;  2OEV A;  3ZN3 A;  4IUL A;  2WXQ A;  3HG0 D;  3PE4 A;  3MCX A;  4J0U A;  3GZS A;  4B94 A;  2E0I A;  3LYA A;  4B0Z A;  2L9B A;  4JD2 G;  3OTN A;  5CEA A;  5AYW D;  2LO6 A;  3AG4 E;  3LEW A;  2WXJ A;  2P9S G;  4TXR A;  3HXF A;  3D9M A;  1NA3 A;  5J08 A;  3NQP A;  4EQF A;  3CVX A;  2F8X K;  4U7E B;  5CMY A;  4WWP A;  3SZ7 A;  4WUY A;  4LEU A;  4JPS A;  3EHQ A;  5FWQ A;  1NFI E;  3MV3 B;  4N39 A;  3V2O A;  4U0S A;  1H19 A;  2GRL A;  3FH8 A;  1KT1 A;  2R2L A;  1UN9 A;  4ZHB A;  5EIL A;  2WMN A;  4H7X A;  2P9I G;  2DBA A;  3MKR A;  5BW8 C;  3ASN E;  2XPY A;  2KCK A;  1Z3Y A;  4M3O A;  5ENT D;  2WXP A;  3Q49 B;  2GRQ B;  3ZHE B;  1X81 A;  5A6C A;  4G8L A;  3PVL A;  2RKK A;  4HOR A;  2HM8 A;  3LPZ A;  5E75 A;  3IHV A;  2FBN A;  3L08 A;  5AAR A;  3OXL A;  4UWK A;  5HRY A;  4GAA A;  2AW6 A;  3EU5 A;  3ZKJ A;  3LJN A;  2IQC A;  2EIL E;  3TJP A;  2FF4 A;  2GRO B;  3FEX A;  5KWD A;  1EDU A;  2Y4T A;  2WQ7 A;  4HFG A;  1OWM A;  4GPM A;  1NI1 A;  1IHG A;  3PZ2 A;  2V0P A;  2IJG X;  3AS5 A;  5A23 A;  2MRI A;  1MJ0 A;  3JCK C;  1MHQ A;  2PM7 A;  4F7A A;  3EIQ C;  5AJD A;  1N94 A;  4BEP A;  2YIN A;  4L23 A;  5CED B;  4UWG A;  4Q69 A;  2JAB A;  4KVO A;  1ELK A;  3B7B A;  4L9P A;  2IU1 A;  4RQI A;  5FZS A;  5EYP F;  1O5M A;  4ANX A;  4CDN A;  1H2V C;  3MZL B;  4G23 A;  1E7U A;  2H6H A;  4J8E A;  3ZHE A;  3NZS A;  3EHR A;  3E34 A;  1ELW A;  4F1S A;  4GZ5 A;  5CRV A;  2MYO A;  4KBQ A; 
#chains in the Genus database with same CATH homology
 1TEZ A;  2VQ2 A;  4MKT A;  4GB9 A;  2VYI A;  3QWV A;  4DJA A;  3FUN A;  3ASF A;  5FT9 A;  3ONK A;  2DIW A;  4HOU A;  5DIZ A;  3C98 A;  4G24 A;  5ANR A;  3U64 A;  2Q7F A;  2GRM A;  3L17 A;  2LAH A;  4JEU A;  3CQC B;  3QDN A;  4UI9 K;  5D0Q D;  2WXN A;  1N52 A;  3MJW A;  1Y6I A;  3P1U A;  2J09 A;  4U63 A;  3ZRH A;  2J08 A;  3SD5 A;  3CKC A;  2Y4U A;  2J07 A;  3MV2 B;  3TG4 A;  5KJN A;  3T5X A;  3AS4 A;  4TRQ A;  4HOQ A;  3QWW A;  4FC8 A;  3HVE A;  4LCT A;  3TAX A;  4APO A;  3FHE A;  4C0E A;  2I1J A;  3JQ1 A;  4RSY A;  4F53 A;  3LY8 A;  4G11 A;  4XKB A;  4G2V A;  4LUN U;  3CVL A;  1WY6 A;  3I3N A;  3S7D A;  1OUV A;  5DBK A;  2XCB A;  4JW1 A;  5A7D B;  3LVQ E;  2GW1 A;  4AOF A;  4FJZ A;  3LJ3 A;  3FTY A;  3FEY A;  3OXG A;  2FUL A;  1P5Q A;  4CT0 A;  4F3V A;  4GZ3 A;  4UQZ A;  2CFU A;  4XE0 A;  2VSY A;  4L1B A;  2BTD A;  2UWJ G;  3FUK A;  5T8I A;  5CMW A;  4GA0 A;  4EEC A;  1SQM A;  3ENE A;  4KT6 B;  5D0O D;  4I43 A;  3FU0 A;  2YHE A;  4K0R A;  4DPR A;  4GZC A;  4I17 A;  2CHZ A;  1EF1 C;  1HFA A;  2JLB A;  4CGV A;  3QAR A;  4E6H A;  4EZK A;  3AU4 A;  2GGF A;  4NRH B;  3RU0 A;  4MS6 A;  3QNK A;  2X6H A;  3UT8 A;  4ACL A;  3B13 A;  4N3B A;  4V3I A;  4OYS A;  4PS7 A;  4O6F A;  2R59 A;  2XGS A;  3D9K A;  3ML8 A;  2OVF A;  3LDZ A;  5LOZ A;  5BUZ A;  3ZYQ A;  3UX4 A;  3P2B A;  4B8C B;  3G2T A;  3PS6 A;  3SBS A;  2EQX A;  3Q4A B;  3D9I A;  1JWF A;  2PQR A;  3B7S A;  2C0L A;  3LVR E;  2PM6 A;  3L13 A;  3G2S A;  3L54 A;  2E2E A;  2OOE A;  4N3A A;  3FTW A;  4FHJ A;  4JA9 A;  3VLF A;  3CK9 A;  4GCN A;  1PY1 A;  2XRZ A;  3FU3 A;  1X5B A;  1BPO A;  4BT9 A;  2L0I A;  3FTZ A;  1HG5 A;  3RRM B;  2HYZ A;  2I2O A;  1INZ A;  4A3T A;  2NSZ A;  3SNX A;  3MEK A;  2OV8 A;  1OWP A;  3G2U A;  3CVU A;  3NF1 A;  4JA7 A;  4APF A;  4Y6C A;  1OWO A;  4PUC A;  3SGH A;  3IEG A;  1EPU A;  3IV0 A;  4I1M A;  2R17 C;  4WWN A;  3EDT B;  1TJF A;  2WXL A;  3KAE A;  2X6F A;  3SBT B;  2A4Z A;  4WWO A;  5J90 A;  4JHJ A;  1OWN A;  4DK5 A;  3CHS A;  4CEM A;  3APC A;  3U9W A;  1XGW A;  3D9O A;  3LS8 A;  2J49 A;  5KJM A;  3CIA A;  5ARG A;  3L6A A;  4ME2 A;  3FTV A;  5G55 A;  5EKQ D;  4L2L A;  4PH4 B;  1HG2 A;  1E96 B;  5HQ8 A;  5CCL A;  3CHM A;  2M63 A;  3RIB A;  2J4B A;  4J8D A;  2KZT A;  3S7J A;  3I4G A;  3MYV A;  4HOT A;  3AS8 A;  4XIF A;  1U3C A;  5C1D A;  4WNE A;  5KCM A;  3RJV A;  2AVP A;  2XGO A;  3ONL A;  3D9P A;  3FU6 A;  4I6G A;  4JZY A;  4EBA A;  4W9R A;  2WPV A;  5JHB A;  2YNQ A;  2J9Q A;  2WMO A;  4FP7 A;  3SI5 A;  4PS8 A;  4MLP A;  3Q15 A;  2ION A;  2WM9 A;  1WAO 1;  2WXH A;  4I2Z A;  3PUJ A;  5FZQ A;  4DI4 A;  3QK0 A;  5FQ8 A;  1HE8 A;  3PNL B;  3TL5 A;  4AV7 A;  3HYM B;  4OVV A;  3CEQ A;  3CK7 A;  1DVP A;  3U66 A;  4L2Y A;  2ILR A;  2RG8 A;  4PDX A;  3ASH A;  4J8F A;  5G04 C;  5LP0 A;  3ZIM A;  4DI3 A;  2MOW A;  4CDM A;  3LY9 A;  4FUL A;  4U04 A;  4KZC A;  3EHN A;  2PZI A;  3BG1 B;  4KXK B;  1FCH A;  1HF8 A;  2KCL A;  4UQY A;  4XX5 A;  2KAT A;  4NUR A;  2BF0 X;  3KS2 A;  2CG2 A;  2A5U A;  4ABN A;  1HZ4 A;  4GZD A;  4WNF A;  1HS6 A;  4AIF A;  4I1A A;  2YHC A;  1FVH A;  3B7T A;  2XGM A;  5FTP A;  3CSF A;  4WAF A;  4GYY A;  4KYO B;  4TV3 A;  2AXV A;  5FZR A;  5JJ6 A;  3R7R A;  1TJC A;  3PUK A;  3TG5 A;  1HX8 A;  1PC2 A;  4ILI A;  2VTB B;  4UI9 C;  3JQ0 A;  4JC8 A;  3LCA A;  3WXX A;  4HOS A;  1NZN A;  4RG6 A;  2WXG A;  3PH0 C;  2C2L A;  3CVP A;  3CK8 A;  1DNP A;  5BV0 A;  3CQG B;  3CHR A;  4EPZ A;  1B89 A;  2IOS A;  3FU5 A;  3EJN A;  3ASD A;  2VTB A;  3PEV B;  2WXO A;  1L5J A;  2WQH A;  1H2T C;  2VSX E;  1NA0 A;  4G26 A;  2V4L A;  4I6E A;  3FTS A;  2X6K A;  3OXF A;  3HHM A;  3G2W A;  3GZ2 A;  2IOL A;  4KZ0 A;  2ZU6 B;  4AY6 A;  2CFZ A;  4J6I A;  4Q94 A;  5ENN A;  3QB2 A;  2KZT B;  1H2U A;  2KCV A;  3FUL A;  3MA5 A;  3CGH A;  1KT0 A;  4BSX A;  4NQ0 A;  1JWG A;  3LY7 A;  4GPK A;  2VGX A;  4PS3 A;  3ZW3 A;  3CVN A;  3UMV A;  3UT7 A;  5G2N A;  1UJJ A;  2CHW A;  2P58 C;  5BT1 A;  1MQS A;  3ZGQ A;  1N54 A;  3RRU A;  4BTB A;  4C0M A;  1QNF A;  1SZ9 A;  3EHM A;  3E4B A;  1QQE A;  4I2W A;  3DPD A;  3MGB A;  2BUG A;  3HDX A;  4IYP A;  3GYZ A;  3CLJ A;  4L7T A;  3QOU A;  4A55 A;  5LCW J;  4AVX A;  4JHK A;  2XHE A;  3VLE A;  3DBS A;  3VLD A;  2WXK A;  4FLH A;  4LRZ A;  2UY1 B;  4ILG A;  3SFZ A;  5EX0 A;  3RO3 A;  3PEU B;  4AXH A;  3D9N A;  3KEZ A;  2WQ6 A;  2XEV A;  1E8W A;  4URK A;  2JEK A;  4B89 A;  3TXN A;  1OWL A;  3ML9 A;  1Z3X A;  1FVF A;  3UQ3 A;  2UY1 A;  3FWV A;  4GA2 A;  4AP2 A;  4EZJ A;  2OVB A;  1QZ2 A;  2VJ8 A;  4GU5 A;  4QFV A;  4GMJ A;  2LAI A;  3CV0 A;  4N2Q A;  2LNI A;  3ULQ A;  1UN8 A;  3S7B A;  4I9C A;  4AM9 A;  3FH7 A;  4CDR A;  4K03 A;  4HS2 A;  5JJT A;  3U3W A;  4G1T A;  1NP7 A;  3CVW A;  3QC1 A;  3BG0 B;  3D3M A;  2XPI A;  5ARF A;  4Q96 A;  1E8X A;  2YQ8 A;  4U07 A;  3RK6 A;  2X38 A;  3CHP A;  4GZ6 A;  5FQ7 A;  1LF8 A;  2I9C A;  3PE3 A;  5G05 C;  3FUI A;  4NAC A;  3CHQ A;  4UQX A;  2XRY A;  5KJL A;  1JUQ A;  1YA0 A;  3B7R L;  1ZU2 A;  3G2V A;  2IFU A;  5T3R A;  5LX8 A;  4D10 C;  4BFR A;  4IN3 B;  1KLX A;  1W3B A;  3ZN3 A;  4IUL A;  2CHX A;  2WXQ A;  4IRU A;  1ZBP A;  3GZ1 A;  4N3C A;  3PE4 A;  2PQN A;  5EDS A;  3R9A B;  4EZL A;  2L0T B;  2WXF A;  3CKB A;  3MCX A;  4J0U A;  3CHO A;  3GZS A;  1EYH A;  3Q47 B;  3S2A A;  4B94 A;  3AU5 A;  2XPZ A;  2L6J A;  3BEE A;  3ASG A;  4A1S A;  2E0I A;  3LYA A;  4B0Z A;  2L9B A;  3QJZ A;  4XZ4 A;  4N5C A;  4ANW A;  3MKQ A;  2R5S A;  3UUX A;  2PL2 A;  3IHY A;  4U8H A;  3OTN A;  4JEH A;  4CCA A;  5AYW D;  2LO6 A;  4Y6W A;  5CCM A;  4TUU A;  1JPL A;  4U0U A;  2VGY A;  4RG9 A;  5HI7 A;  2QFC A;  5JHA A;  3LEW A;  2WXJ A;  2DCP A;  1UW4 B;  2VGX B;  3NZU A;  3PRZ A;  5AJL A;  5AEN A;  3RKV A;  3D9M A;  5FQ4 A;  2WB2 A;  1NA3 A;  3QWP A;  4WND A;  5LCW C;  2C0M A;  4GYW A;  5J08 A;  2XQ0 A;  3NQP A;  3CVY A;  4EQF A;  3CVQ A;  4LER A;  4HVB A;  3CVX A;  5G05 J;  5CMY A;  1E90 A;  2OND A;  4WWP A;  5FJY A;  3SZ7 A;  3ZYL A;  1HU3 A;  4WUY A;  4BTA A;  4LEU A;  4EBA G;  4JPS A;  5FWQ A;  4N2S A;  3MV3 B;  2WXM A;  4N39 A;  2WXI A;  3JYS A;  4E85 A;  4AEZ C;  4U0S A;  1H19 A;  3ZVV A;  2GRL A;  4DLO A;  1E8Y A;  3APD A;  3FH8 A;  1KT1 A;  2RD0 A;  3I4R B;  3TXM A;  3VTY A;  1GW6 A;  3FUF A;  3R7Q A;  3L22 A;  3HVE B;  1E8Z A;  3ESK A;  1E7V A;  2X3M A;  5C2Y A;  3VTX A;  4GYO A;  3ZYK A;  4YND A;  1UN9 A;  4FLB A;  4ACK A;  4C9B B;  5AIJ A;  4CGW A;  1U3D A;  2VSN A;  5G04 J;  4XKC A;  2HO1 A;  2HR2 A;  2WMN A;  4H7X A;  2FEZ A;  3OAW A;  3S7F A;  4ANU A;  3CST A;  4JHR A;  3FTU A;  2DBA A;  3I5P A;  2FO7 A;  3MKR A;  5BW8 C;  3FTX A;  2I1K A;  3LXU X;  4R7L A;  3T8M A;  3T5V A;  1HO8 A;  2NC9 A;  3D9J A;  2XPY A;  3FH5 A;  4J8S A;  4XI0 A;  2KCK A;  1Z3Y A;  4ATG A;  3FY4 A;  4M3O A;  5BNW A;  3UPV A;  2WXP A;  4YVQ C;  1UJK A;  4UWH A;  3U4T A;  1WM5 A;  4I9E A;  2AWI A;  5BV1 A;  3Q49 B;  1VDY A;  4JL0 A;  3ESL A;  3URZ A;  4MRU A;  3K9I A;  3ZPJ A;  1Z6T A;  4AJW A;  4BX9 A;  3ZHE B;  4HLE A;  3L16 A;  3FUM A;  2J4D A;  5A6C A;  3FP3 A;  4GA1 A;  5T4Y A;  4GML A;  4YVO A;  3PVL A;  2WXR A;  5E76 A;  4FHK A;  4HOR A;  2HM8 A;  3LPZ A;  4P29 A;  3O48 A;  3FUJ A;  3IHV A;  5E75 A;  4DLQ A;  4AY5 A;  2FBN A;  2Y3A A;  3L08 A;  4ANV A;  3FDH A;  3OXL A;  3CVV A;  2WVI A;  4ILH B;  3LKU A;  2FI7 A;  3Q5M A;  4JXT A;  4UWK A;  3TGO A;  4GAA A;  2AW6 A;  3FUD A;  3APF A;  5ANL A;  5BPP A;  2IQC A;  3GW4 A;  3ZFW A;  3ZYM A;  2AXU A;  3TJP A;  2FF4 A;  3PNT B;  3UT4 A;  4RVB A;  3FEX A;  2V5F A;  4UWF A;  2MHK A;  4FU3 A;  4UI9 J;  3CR3 A;  1EDU A;  2Y4T A;  4I6J A;  4JVS A;  2WQ7 A;  4FJY A;  2KC7 A;  1IQR A;  4BY6 A;  4HFG A;  2IF4 A;  1OWM A;  3O4Z A;  3ZEF A;  1IHG A;  5M72 A;  5JJ7 A;  4UWL A;  1XNF A;  2V0P A;  4WNG A;  2IJG X;  3AS5 A;  3HIZ A;  5A23 A;  3MKQ B;  1H6K A;  2MRI A;  3JCK C;  3PRE A;  3RRN B;  4KMO A;  1MHQ A;  1IYG A;  2PM7 A;  2NXP A;  4A1G A;  2VSO E;  4FAD A;  5CHE E;  2AXZ A;  3PDN A;  4F7A A;  4BT8 A;  3EIQ C;  2V8S E;  2LSV A;  5AJD A;  3MX3 A;  1HH8 A;  5FQ6 A;  2X6J A;  2YIN A;  4L23 A;  1HXI A;  4XI9 A;  4UWG A;  2XCC A;  3FUH A;  4Q69 A;  1IQU A;  4BX8 A;  4B8A A;  4CRW A;  3IBE A;  4G25 A;  1S0P A;  4KVO A;  3JUI A;  1ELK A;  4FA6 A;  3D9L A;  5EX3 A;  3QKY A;  3KD7 A;  2IU1 A;  3B7U X;  4U0Z A;  5KJK A;  4HXI A;  3RO2 A;  5FZS A;  1A17 A;  3FUE A;  3SF4 A;  4GCO A;  3IKO B;  4ANX A;  4CDN A;  1H2V C;  1Y8M A;  1ELR A;  2I6H A;  3MZL B;  4G23 A;  4CT4 A;  1E7U A;  2CG3 A;  4H7Y A;  2X6I A;  3PZD A;  3QAQ A;  4J8E A;  1PAQ A;  2KM4 A;  3ZHE A;  3NZS A;  3ZXS A;  1UG3 A;  3N71 A;  2LSU A;  4OVU A;  4KVM A;  3SHF A;  1ELW A;  2QY7 A;  4F1S A;  3FFL A;  4GZ5 A;  1SZA A;  4BWR A;  5LFA A;  3EIJ A;  1H0A A;  4A3V A;  4I1O B;  4KBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...