3SIGA

The x-ray crystal structure of poly(adp-ribose) glycohydrolase (parg) bound to adp-ribose from thermomonospora curvata
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
Knots found
sequence length
274
structure length
265
Chain Sequence
RHSRRAIAAETVEILERGRYTAPSGRVVPIADHVAQAVRGTRLYRPEKLAVLLEGTRIEVTEETTLAAARRLTGAAGDQVACLNFASAEHPGGGFLSGAHAQEEGLARSSGLYASLRAVPQFYAFHHRQRDPLYSDHLIYSPGVPVFRDDAGRLLEEPYRVAFLTSPAPNRRAIGDLRTVEEIGRVLRGRAAKVLAAARHHGHRRLVLGAWGCGVFGNDPAQVAETFAGLLLDGGPFAGRFAHVVFAVWDTAPGAPRHAAFARRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and catalytic mechanism of a poly(ADP-ribose) glycohydrolase.
pubmed doi rcsb
source organism Thermomonospora curvata
molecule tags Hydrolase
molecule keywords poly(ADP-ribose) glycohydrolase
total genus 92
structure length 265
sequence length 274
other databases KnotProt 2.0: K +31
ec nomenclature ec 3.2.1.143: Poly(ADP-ribose) glycohydrolase.
pdb deposition date 2011-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10021 DUF2263 Uncharacterized protein conserved in bacteria (DUF2263)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3sigA00
3IIDA 2BFRA 3EWOA 1ZR5A 3GPGA 3GQEA 1GYTA 3SIIA 2AFCA 2X47A 2FAVA 3IJ3A 4JVVA 4ZYQA 5DUSA 5AILA 2XD7A 5D8NA 5FSXA 2VRIA 4GUAA 2L8RA 3VFQA 4R6TA 4JLLA 1TXZA 5CB5A 3JRUA 4ZX8A 3EJGA 4JGKA 3EWQA 3SIGA 4ZY2A 1BLLE 4J5QA 4J5SA 5FSVA 4KSIA 5FSZA 2BFQA 5FSYA 3Q6ZA 1TY8A 4D86A 2J9AA 3JZTA 4KYBA 4R76A 3KZWA 2ACFA 3EKEA 3SIJA 3IIFA 3Q71A 3H8EA 3V45A 2EWBA 4R7MA 3KR4A 3H8GA 1LAMA 1NJRA 3EW5A 4JCAA 3ETIA 4TU0A 4ESSA 5E3BA 3EWPA 3GPOA 3SIHA 4GVVA 3V2BA 3GPQA 1SPVA 3EJFA 3PEIA 3KQZA 1LAPA 3GQOA 5HIHA 1LANA 3KQXA 2EEEA 2FG1A 4ZX9A 3T8WA 5HOLA 4ETJA 4ZY0A 5CBMA 4UMLA 4ABLA 4J4ZA 4IQYA 5CB3A 4K0CA 3EWRA 1BPNA 3KR5A 2LGRA 5CMSA 1YD9A 1BPMA 1HJZA 4J5RA 4ETKA 4ZY1A 4X2TA 2DX6A 1VHUA 4K3NA 4ABKA 5FSUA 4ZI6A 1LCPA 1ZR3A 4GVWA 2FXKA 3H8FA
chains in the Genus database with same CATH superfamily
3IIDA 2BFRA 3EWOA 1ZR5A 3GPGA 3GQEA 1GYTA 3SIIA 2AFCA 2X47A 2FAVA 3IJ3A 4JVVA 4ZYQA 2JZDA 5DUSA 5AILA 2XD7A 5D8NA 5FSXA 2VRIA 4GUAA 2L8RA 3VFQA 4R6TA 2JZEA 4JLLA 1TXZA 5CB5A 3JRUA 4ZX8A 3EJGA 4JGKA 3EWQA 3SIGA 4ZY2A 1BLLE 4J5QA 4J5SA 5FSVA 4KSIA 5FSZA 2BFQA 5FSYA 3Q6ZA 1TY8A 4D86A 2J9AA 3JZTA 4KYBA 4R76A 3KZWA 2ACFA 3EKEA 3SIJA 3IIFA 3Q71A 3H8EA 3V45A 2EWBA 4R7MA 3KR4A 2W2GA 2JZFA 3H8GA 1LAMA 1NJRA 3EW5A 4JCAA 3ETIA 4TU0A 4ESSA 5E3BA 3EWPA 3GPOA 3SIHA 4GVVA 3V2BA 3GPQA 1SPVA 2RNKA 3EJFA 3PEIA 3KQZA 1LAPA 3GQOA 2KQVA 5HIHA 1LANA 3KQXA 2EEEA 2FG1A 4ZX9A 3T8WA 5HOLA 4ETJA 4ZY0A 5CBMA 4UMLA 4ABLA 4J4ZA 4IQYA 5CB3A 4K0CA 3EWRA 1BPNA 3KR5A 2LGRA 5CMSA 1YD9A 1BPMA 2WCTA 1HJZA 4J5RA 4ETKA 4ZY1A 4X2TA 2DX6A 1VHUA 4K3NA 4ABKA 5FSUA 4ZI6A 1LCPA 1ZR3A 4GVWA 2FXKA 3H8FA
chains in the Genus database with same CATH topology
3IIDA 2BFRA 3EWOA 1ZR5A 3GPGA 3GQEA 1GYTA 3SIIA 2AFCA 2X47A 2FAVA 3IJ3A 4JVVA 4ZYQA 5DUSA 5AILA 2XD7A 5D8NA 5FSXA 2VRIA 4GUAA 2L8RA 3VFQA 4R6TA 4JLLA 1TXZA 5CB5A 3JRUA 4ZX8A 3EJGA 4JGKA 3EWQA 3SIGA 4ZY2A 1BLLE 4J5QA 4J5SA 5FSVA 4KSIA 5FSZA 2BFQA 5FSYA 3Q6ZA 1TY8A 4D86A 2J9AA 3JZTA 4KYBA 4R76A 3KZWA 2ACFA 3EKEA 3SIJA 3IIFA 3Q71A 3H8EA 3V45A 2EWBA 4R7MA 3KR4A 3H8GA 1LAMA 1NJRA 3EW5A 4JCAA 3ETIA 4TU0A 4ESSA 5E3BA 3EWPA 3GPOA 3SIHA 4GVVA 3V2BA 3GPQA 1SPVA 3EJFA 3PEIA 3KQZA 1LAPA 3GQOA 5HIHA 1LANA 3KQXA 2EEEA 2FG1A 4ZX9A 3T8WA 5HOLA 4ETJA 4ZY0A 5CBMA 4UMLA 4ABLA 4J4ZA 4IQYA 5CB3A 4K0CA 3EWRA 1BPNA 3KR5A 2LGRA 5CMSA 1YD9A 1BPMA 1HJZA 4J5RA 4ETKA 4ZY1A 4X2TA 2DX6A 1VHUA 4K3NA 4ABKA 5FSUA 4ZI6A 1LCPA 1ZR3A 4GVWA 2FXKA 3H8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IID A;  2BFR A;  3EWO A;  1ZR5 A;  3GPG A;  3GQE A;  1GYT A;  3SII A;  2AFC A;  2X47 A;  2FAV A;  3IJ3 A;  4JVV A;  4ZYQ A;  5DUS A;  5AIL A;  2XD7 A;  5D8N A;  5FSX A;  2VRI A;  4GUA A;  2L8R A;  3VFQ A;  4R6T A;  4JLL A;  1TXZ A;  5CB5 A;  3JRU A;  4ZX8 A;  3EJG A;  4JGK A;  3EWQ A;  3SIG A;  4ZY2 A;  1BLL E;  4J5Q A;  4J5S A;  5FSV A;  4KSI A;  5FSZ A;  2BFQ A;  5FSY A;  3Q6Z A;  1TY8 A;  4D86 A;  2J9A A;  3JZT A;  4KYB A;  4R76 A;  3KZW A;  2ACF A;  3EKE A;  3SIJ A;  3IIF A;  3Q71 A;  3H8E A;  3V45 A;  2EWB A;  4R7M A;  3KR4 A;  3H8G A;  1LAM A;  1NJR A;  3EW5 A;  4JCA A;  3ETI A;  4TU0 A;  4ESS A;  5E3B A;  3EWP A;  3GPO A;  3SIH A;  4GVV A;  3V2B A;  3GPQ A;  1SPV A;  3EJF A;  3PEI A;  3KQZ A;  1LAP A;  3GQO A;  5HIH A;  1LAN A;  3KQX A;  2EEE A;  2FG1 A;  4ZX9 A;  3T8W A;  5HOL A;  4ETJ A;  4ZY0 A;  5CBM A;  4UML A;  4ABL A;  4J4Z A;  4IQY A;  5CB3 A;  4K0C A;  3EWR A;  1BPN A;  3KR5 A;  2LGR A;  5CMS A;  1YD9 A;  1BPM A;  1HJZ A;  4J5R A;  4ETK A;  4ZY1 A;  4X2T A;  2DX6 A;  1VHU A;  4K3N A;  4ABK A;  5FSU A;  4ZI6 A;  1LCP A;  1ZR3 A;  4GVW A;  2FXK A;  3H8F A; 
#chains in the Genus database with same CATH topology
 3IID A;  2BFR A;  3EWO A;  1ZR5 A;  3GPG A;  3GQE A;  1GYT A;  3SII A;  2AFC A;  2X47 A;  2FAV A;  3IJ3 A;  4JVV A;  4ZYQ A;  2JZD A;  5DUS A;  5AIL A;  2XD7 A;  5D8N A;  5FSX A;  2VRI A;  4GUA A;  2L8R A;  3VFQ A;  4R6T A;  2JZE A;  4JLL A;  1TXZ A;  5CB5 A;  3JRU A;  4ZX8 A;  3EJG A;  4JGK A;  3EWQ A;  3SIG A;  4ZY2 A;  1BLL E;  4J5Q A;  4J5S A;  5FSV A;  4KSI A;  5FSZ A;  2BFQ A;  5FSY A;  3Q6Z A;  1TY8 A;  4D86 A;  2J9A A;  3JZT A;  4KYB A;  4R76 A;  3KZW A;  2ACF A;  3EKE A;  3SIJ A;  3IIF A;  3Q71 A;  3H8E A;  3V45 A;  2EWB A;  4R7M A;  3KR4 A;  2W2G A;  2JZF A;  3H8G A;  1LAM A;  1NJR A;  3EW5 A;  4JCA A;  3ETI A;  4TU0 A;  4ESS A;  5E3B A;  3EWP A;  3GPO A;  3SIH A;  4GVV A;  3V2B A;  3GPQ A;  1SPV A;  2RNK A;  3EJF A;  3PEI A;  3KQZ A;  1LAP A;  3GQO A;  2KQV A;  5HIH A;  1LAN A;  3KQX A;  2EEE A;  2FG1 A;  4ZX9 A;  3T8W A;  5HOL A;  4ETJ A;  4ZY0 A;  5CBM A;  4UML A;  4ABL A;  4J4Z A;  4IQY A;  5CB3 A;  4K0C A;  3EWR A;  1BPN A;  3KR5 A;  2LGR A;  5CMS A;  1YD9 A;  1BPM A;  2WCT A;  1HJZ A;  4J5R A;  4ETK A;  4ZY1 A;  4X2T A;  2DX6 A;  1VHU A;  4K3N A;  4ABK A;  5FSU A;  4ZI6 A;  1LCP A;  1ZR3 A;  4GVW A;  2FXK A;  3H8F A; 
#chains in the Genus database with same CATH homology
 3IID A;  2BFR A;  3EWO A;  1ZR5 A;  3GPG A;  3GQE A;  1GYT A;  3SII A;  2AFC A;  2X47 A;  2FAV A;  3IJ3 A;  4JVV A;  4ZYQ A;  5DUS A;  5AIL A;  2XD7 A;  5D8N A;  5FSX A;  2VRI A;  4GUA A;  2L8R A;  3VFQ A;  4R6T A;  4JLL A;  1TXZ A;  5CB5 A;  3JRU A;  4ZX8 A;  3EJG A;  4JGK A;  3EWQ A;  3SIG A;  4ZY2 A;  1BLL E;  4J5Q A;  4J5S A;  5FSV A;  4KSI A;  5FSZ A;  2BFQ A;  5FSY A;  3Q6Z A;  1TY8 A;  4D86 A;  2J9A A;  3JZT A;  4KYB A;  4R76 A;  3KZW A;  2ACF A;  3EKE A;  3SIJ A;  3IIF A;  3Q71 A;  3H8E A;  3V45 A;  2EWB A;  4R7M A;  3KR4 A;  3H8G A;  1LAM A;  1NJR A;  3EW5 A;  4JCA A;  3ETI A;  4TU0 A;  4ESS A;  5E3B A;  3EWP A;  3GPO A;  3SIH A;  4GVV A;  3V2B A;  3GPQ A;  1SPV A;  3EJF A;  3PEI A;  3KQZ A;  1LAP A;  3GQO A;  5HIH A;  1LAN A;  3KQX A;  2EEE A;  2FG1 A;  4ZX9 A;  3T8W A;  5HOL A;  4ETJ A;  4ZY0 A;  5CBM A;  4UML A;  4ABL A;  4J4Z A;  4IQY A;  5CB3 A;  4K0C A;  3EWR A;  1BPN A;  3KR5 A;  2LGR A;  5CMS A;  1YD9 A;  1BPM A;  1HJZ A;  4J5R A;  4ETK A;  4ZY1 A;  4X2T A;  2DX6 A;  1VHU A;  4K3N A;  4ABK A;  5FSU A;  4ZI6 A;  1LCP A;  1ZR3 A;  4GVW A;  2FXK A;  3H8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...