3SIGA

The x-ray crystal structure of poly(adp-ribose) glycohydrolase (parg) bound to adp-ribose from thermomonospora curvata
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
Knots found
sequence length
274
structure length
265
Chain Sequence
RHSRRAIAAETVEILERGRYTAPSGRVVPIADHVAQAVRGTRLYRPEKLAVLLEGTRIEVTEETTLAAARRLTGAAGDQVACLNFASAEHPGGGFLSGAHAQEEGLARSSGLYASLRAVPQFYAFHHRQRDPLYSDHLIYSPGVPVFRDDAGRLLEEPYRVAFLTSPAPNRRAIGDLRTVEEIGRVLRGRAAKVLAAARHHGHRRLVLGAWGCGVFGNDPAQVAETFAGLLLDGGPFAGRFAHVVFAVWDTAPGAPRHAAFARRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and catalytic mechanism of a poly(ADP-ribose) glycohydrolase.
pubmed doi rcsb
source organism Thermomonospora curvata
molecule tags Hydrolase
molecule keywords poly(ADP-ribose) glycohydrolase
total genus 92
structure length 265
sequence length 274
other databases KnotProt 2.0: K +31
ec nomenclature ec 3.2.1.143: Poly(ADP-ribose) glycohydrolase.
pdb deposition date 2011-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10021 DUF2263 Uncharacterized protein conserved in bacteria (DUF2263)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3sigA00
5HIHA 4JLLA 4ETKA 1LAMA 4ZX8A 4JVVA 3GPOA 4ZY1A 4GVVA 3KQZA 4ZY2A 5FSZA 4K0CA 3V2BA 5FSVA 3EWRA 5FSXA 2X47A 3ETIA 2EEEA 3EJFA 2BFQA 2FG1A 5CBMA 4JGKA 3KZWA 4D86A 4TU0A 3VFQA 1BPNA 4GVWA 2VRIA 3KR4A 4K3NA 5DUSA 4X2TA 1VHUA 3Q6ZA 2BFRA 2XD7A 2DX6A 4ZX9A 5E3BA 3GPGA 4KYBA 3H8EA 1HJZA 2ACFA 1GYTA 1TY8A 2L8RA 5CB3A 4R76A 4J4ZA 3JRUA 3EWQA 3GPQA 1LAPA 2FAVA 3T8WA 4R7MA 3EWPA 4ESSA 4JCAA 1ZR5A 4J5RA 3V45A 4J5SA 5HOLA 4ZY0A 3EJGA 3H8GA 1SPVA 5FSYA 5FSUA 3H8FA 5CB5A 3EWOA 3SIIA 2EWBA 4ZYQA 4R6TA 3EW5A 3JZTA 1ZR3A 2FXKA 3IIDA 3PEIA 3EKEA 1BLLE 1LANA 3KQXA 2AFCA 4ABKA 3GQEA 5AILA 3SIJA 1YD9A 3SIHA 3Q71A 4UMLA 4ABLA 5D8NA 4KSIA 3IIFA 1NJRA 3SIGA 1BPMA 3GQOA 4ZI6A 1TXZA 3KR5A 4GUAA 2J9AA 2LGRA 4IQYA 1LCPA 3IJ3A 5CMSA 4ETJA 4J5QA
chains in the Genus database with same CATH superfamily
5HIHA 4JLLA 4ETKA 1LAMA 4ZX8A 4JVVA 3GPOA 4ZY1A 4GVVA 3KQZA 4ZY2A 2W2GA 5FSZA 4K0CA 3V2BA 5FSVA 3EWRA 5FSXA 2X47A 2JZFA 3ETIA 2EEEA 3EJFA 2BFQA 2FG1A 5CBMA 4JGKA 3KZWA 4D86A 4TU0A 3VFQA 1BPNA 2KQVA 4GVWA 2VRIA 3KR4A 4K3NA 5DUSA 4X2TA 1VHUA 3Q6ZA 2BFRA 2XD7A 2DX6A 4ZX9A 5E3BA 3GPGA 4KYBA 3H8EA 1HJZA 2ACFA 1GYTA 1TY8A 2L8RA 5CB3A 4R76A 4J4ZA 3JRUA 3EWQA 3GPQA 1LAPA 2RNKA 2JZEA 2FAVA 3T8WA 4R7MA 3EWPA 4ESSA 4JCAA 1ZR5A 4J5RA 3V45A 4J5SA 5HOLA 4ZY0A 3EJGA 3H8GA 1SPVA 5FSYA 5FSUA 3H8FA 5CB5A 3EWOA 3SIIA 2EWBA 4ZYQA 3EW5A 4R6TA 3JZTA 1ZR3A 2FXKA 3IIDA 3PEIA 3EKEA 1BLLE 1LANA 3KQXA 2AFCA 4ABKA 3GQEA 5AILA 3SIJA 1YD9A 3SIHA 2WCTA 3Q71A 4UMLA 4ABLA 5D8NA 4KSIA 2JZDA 3IIFA 1NJRA 3SIGA 1BPMA 3GQOA 4ZI6A 1TXZA 3KR5A 4GUAA 2J9AA 2LGRA 4IQYA 1LCPA 3IJ3A 5CMSA 4ETJA 4J5QA
chains in the Genus database with same CATH topology
5HIHA 4JLLA 4ETKA 1LAMA 4ZX8A 4JVVA 3GPOA 4ZY1A 4GVVA 3KQZA 4ZY2A 5FSZA 4K0CA 3V2BA 5FSVA 3EWRA 5FSXA 2X47A 3ETIA 2EEEA 3EJFA 2BFQA 2FG1A 5CBMA 4JGKA 3KZWA 4D86A 4TU0A 3VFQA 1BPNA 4GVWA 2VRIA 3KR4A 4K3NA 5DUSA 4X2TA 1VHUA 3Q6ZA 2BFRA 2XD7A 2DX6A 4ZX9A 5E3BA 3GPGA 4KYBA 3H8EA 1HJZA 2ACFA 1GYTA 1TY8A 2L8RA 5CB3A 4R76A 4J4ZA 3JRUA 3EWQA 3GPQA 1LAPA 2FAVA 3T8WA 4R7MA 3EWPA 4ESSA 4JCAA 1ZR5A 4J5RA 3V45A 4J5SA 5HOLA 4ZY0A 3EJGA 3H8GA 1SPVA 5FSYA 5FSUA 3H8FA 5CB5A 3EWOA 3SIIA 2EWBA 4ZYQA 4R6TA 3EW5A 3JZTA 1ZR3A 2FXKA 3IIDA 3PEIA 3EKEA 1BLLE 1LANA 3KQXA 2AFCA 4ABKA 3GQEA 5AILA 3SIJA 1YD9A 3SIHA 3Q71A 4UMLA 4ABLA 5D8NA 4KSIA 3IIFA 1NJRA 3SIGA 1BPMA 3GQOA 4ZI6A 1TXZA 3KR5A 4GUAA 2J9AA 2LGRA 4IQYA 1LCPA 3IJ3A 5CMSA 4ETJA 4J5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HIH A;  4JLL A;  4ETK A;  1LAM A;  4ZX8 A;  4JVV A;  3GPO A;  4ZY1 A;  4GVV A;  3KQZ A;  4ZY2 A;  5FSZ A;  4K0C A;  3V2B A;  5FSV A;  3EWR A;  5FSX A;  2X47 A;  3ETI A;  2EEE A;  3EJF A;  2BFQ A;  2FG1 A;  5CBM A;  4JGK A;  3KZW A;  4D86 A;  4TU0 A;  3VFQ A;  1BPN A;  4GVW A;  2VRI A;  3KR4 A;  4K3N A;  5DUS A;  4X2T A;  1VHU A;  3Q6Z A;  2BFR A;  2XD7 A;  2DX6 A;  4ZX9 A;  5E3B A;  3GPG A;  4KYB A;  3H8E A;  1HJZ A;  2ACF A;  1GYT A;  1TY8 A;  2L8R A;  5CB3 A;  4R76 A;  4J4Z A;  3JRU A;  3EWQ A;  3GPQ A;  1LAP A;  2FAV A;  3T8W A;  4R7M A;  3EWP A;  4ESS A;  4JCA A;  1ZR5 A;  4J5R A;  3V45 A;  4J5S A;  5HOL A;  4ZY0 A;  3EJG A;  3H8G A;  1SPV A;  5FSY A;  5FSU A;  3H8F A;  5CB5 A;  3EWO A;  3SII A;  2EWB A;  4ZYQ A;  4R6T A;  3EW5 A;  3JZT A;  1ZR3 A;  2FXK A;  3IID A;  3PEI A;  3EKE A;  1BLL E;  1LAN A;  3KQX A;  2AFC A;  4ABK A;  3GQE A;  5AIL A;  3SIJ A;  1YD9 A;  3SIH A;  3Q71 A;  4UML A;  4ABL A;  5D8N A;  4KSI A;  3IIF A;  1NJR A;  3SIG A;  1BPM A;  3GQO A;  4ZI6 A;  1TXZ A;  3KR5 A;  4GUA A;  2J9A A;  2LGR A;  4IQY A;  1LCP A;  3IJ3 A;  5CMS A;  4ETJ A;  4J5Q A; 
#chains in the Genus database with same CATH topology
 5HIH A;  4JLL A;  4ETK A;  1LAM A;  4ZX8 A;  4JVV A;  3GPO A;  4ZY1 A;  4GVV A;  3KQZ A;  4ZY2 A;  2W2G A;  5FSZ A;  4K0C A;  3V2B A;  5FSV A;  3EWR A;  5FSX A;  2X47 A;  2JZF A;  3ETI A;  2EEE A;  3EJF A;  2BFQ A;  2FG1 A;  5CBM A;  4JGK A;  3KZW A;  4D86 A;  4TU0 A;  3VFQ A;  1BPN A;  2KQV A;  4GVW A;  2VRI A;  3KR4 A;  4K3N A;  5DUS A;  4X2T A;  1VHU A;  3Q6Z A;  2BFR A;  2XD7 A;  2DX6 A;  4ZX9 A;  5E3B A;  3GPG A;  4KYB A;  3H8E A;  1HJZ A;  2ACF A;  1GYT A;  1TY8 A;  2L8R A;  5CB3 A;  4R76 A;  4J4Z A;  3JRU A;  3EWQ A;  3GPQ A;  1LAP A;  2RNK A;  2JZE A;  2FAV A;  3T8W A;  4R7M A;  3EWP A;  4ESS A;  4JCA A;  1ZR5 A;  4J5R A;  3V45 A;  4J5S A;  5HOL A;  4ZY0 A;  3EJG A;  3H8G A;  1SPV A;  5FSY A;  5FSU A;  3H8F A;  5CB5 A;  3EWO A;  3SII A;  2EWB A;  4ZYQ A;  3EW5 A;  4R6T A;  3JZT A;  1ZR3 A;  2FXK A;  3IID A;  3PEI A;  3EKE A;  1BLL E;  1LAN A;  3KQX A;  2AFC A;  4ABK A;  3GQE A;  5AIL A;  3SIJ A;  1YD9 A;  3SIH A;  2WCT A;  3Q71 A;  4UML A;  4ABL A;  5D8N A;  4KSI A;  2JZD A;  3IIF A;  1NJR A;  3SIG A;  1BPM A;  3GQO A;  4ZI6 A;  1TXZ A;  3KR5 A;  4GUA A;  2J9A A;  2LGR A;  4IQY A;  1LCP A;  3IJ3 A;  5CMS A;  4ETJ A;  4J5Q A; 
#chains in the Genus database with same CATH homology
 5HIH A;  4JLL A;  4ETK A;  1LAM A;  4ZX8 A;  4JVV A;  3GPO A;  4ZY1 A;  4GVV A;  3KQZ A;  4ZY2 A;  5FSZ A;  4K0C A;  3V2B A;  5FSV A;  3EWR A;  5FSX A;  2X47 A;  3ETI A;  2EEE A;  3EJF A;  2BFQ A;  2FG1 A;  5CBM A;  4JGK A;  3KZW A;  4D86 A;  4TU0 A;  3VFQ A;  1BPN A;  4GVW A;  2VRI A;  3KR4 A;  4K3N A;  5DUS A;  4X2T A;  1VHU A;  3Q6Z A;  2BFR A;  2XD7 A;  2DX6 A;  4ZX9 A;  5E3B A;  3GPG A;  4KYB A;  3H8E A;  1HJZ A;  2ACF A;  1GYT A;  1TY8 A;  2L8R A;  5CB3 A;  4R76 A;  4J4Z A;  3JRU A;  3EWQ A;  3GPQ A;  1LAP A;  2FAV A;  3T8W A;  4R7M A;  3EWP A;  4ESS A;  4JCA A;  1ZR5 A;  4J5R A;  3V45 A;  4J5S A;  5HOL A;  4ZY0 A;  3EJG A;  3H8G A;  1SPV A;  5FSY A;  5FSU A;  3H8F A;  5CB5 A;  3EWO A;  3SII A;  2EWB A;  4ZYQ A;  4R6T A;  3EW5 A;  3JZT A;  1ZR3 A;  2FXK A;  3IID A;  3PEI A;  3EKE A;  1BLL E;  1LAN A;  3KQX A;  2AFC A;  4ABK A;  3GQE A;  5AIL A;  3SIJ A;  1YD9 A;  3SIH A;  3Q71 A;  4UML A;  4ABL A;  5D8N A;  4KSI A;  3IIF A;  1NJR A;  3SIG A;  1BPM A;  3GQO A;  4ZI6 A;  1TXZ A;  3KR5 A;  4GUA A;  2J9A A;  2LGR A;  4IQY A;  1LCP A;  3IJ3 A;  5CMS A;  4ETJ A;  4J5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...