3SIHA

The x-ray crystal structure of poly(adp-ribose) glycohydrolase (parg) from thermomonospora curvata
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
274
structure length
274
Chain Sequence
RHSRRAIAAETVEILERGRYTAPSGRVVPIADHVAQAVRGTRLYRPEKLAVLLEGLGAASDGAPTRIEVTEETTLAAARRLTGAAGDQVACLNFASAEHPGGGFLSGAHAQEEGLARSSGLYASLRAVPQFYAFHHRQRDPLYSDHLIYSPGVPVFRDDAGRLLEEPYRVAFLTSPAPNRRAIGDLRTVEEIGRVLRGRAAKVLAAARHHGHRRLVLGAWGCGVFGNDPAQVAETFAGLLLDGGPFAGRFAHVVFAVWDTAPGAPRHAAFARRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and catalytic mechanism of a poly(ADP-ribose) glycohydrolase.
pubmed doi rcsb
source organism Thermomonospora curvata
molecule tags Hydrolase
molecule keywords poly(ADP-ribose) glycohydrolase
total genus 94
structure length 274
sequence length 274
ec nomenclature ec 3.2.1.143: Poly(ADP-ribose) glycohydrolase.
pdb deposition date 2011-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10021 DUF2263 Uncharacterized protein conserved in bacteria (DUF2263)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3sihA00
3EWRA 3KR4A 3PEIA 1HJZA 3EWPA 3GPQA 4GVWA 5D8NA 1SPVA 1BPNA 3EWOA 4R7MA 4ZYQA 3IJ3A 1GYTA 5E3BA 4K3NA 5CB3A 1TY8A 2EWBA 1BLLE 2LGRA 4ZX9A 2ACFA 4ABKA 4ETJA 5FSVA 3SIHA 4D86A 2FG1A 4JGKA 4KYBA 3JRUA 4ESSA 2AFCA 3ETIA 3V45A 3T8WA 3Q71A 2FXKA 3GPOA 1LANA 1NJRA 2BFRA 1LAMA 2VRIA 3KQXA 4J4ZA 4ZI6A 4ETKA 2BFQA 4J5RA 5CB5A 2XD7A 3EJGA 3KQZA 2J9AA 2EEEA 4X2TA 5AILA 1LAPA 3IIFA 1VHUA 3SIJA 2L8RA 4R76A 3V2BA 3SIIA 1YD9A 4ZY1A 3GPGA 4GVVA 5FSXA 3IIDA 4ZY0A 4ABLA 2DX6A 4JVVA 4JCAA 1ZR3A 5HIHA 3EJFA 4J5SA 4TU0A 4J5QA 3EKEA 3Q6ZA 3SIGA 3H8FA 3H8GA 4UMLA 3KR5A 3KZWA 5FSZA 5CMSA 3EWQA 3JZTA 4ZX8A 4R6TA 4KSIA 3H8EA 3EW5A 4IQYA 5HOLA 3GQEA 4ZY2A 2X47A 1LCPA 5FSYA 5FSUA 2FAVA 4K0CA 3VFQA 1TXZA 5CBMA 1ZR5A 3GQOA 4JLLA 1BPMA 4GUAA 5DUSA
chains in the Genus database with same CATH superfamily
3EWRA 3KR4A 3PEIA 1HJZA 3EWPA 3GPQA 4GVWA 5D8NA 1SPVA 1BPNA 3EWOA 4R7MA 4ZYQA 3IJ3A 1GYTA 5E3BA 4K3NA 5CB3A 1TY8A 2EWBA 1BLLE 2LGRA 4ZX9A 2ACFA 4ABKA 4ETJA 5FSVA 3SIHA 4D86A 2FG1A 4JGKA 4KYBA 3JRUA 2JZDA 4ESSA 2AFCA 3ETIA 3V45A 3T8WA 3Q71A 2FXKA 3GPOA 2WCTA 1LANA 1NJRA 2BFRA 1LAMA 2VRIA 3KQXA 4J4ZA 4ZI6A 4ETKA 2BFQA 4J5RA 5CB5A 2XD7A 3EJGA 3KQZA 2J9AA 2EEEA 4X2TA 5AILA 1LAPA 3IIFA 1VHUA 3SIJA 2L8RA 4R76A 3V2BA 3SIIA 1YD9A 4ZY1A 3GPGA 4GVVA 5FSXA 3IIDA 4ZY0A 4ABLA 2DX6A 4JVVA 4JCAA 1ZR3A 5HIHA 2RNKA 3EJFA 4J5SA 4TU0A 4J5QA 3EKEA 3Q6ZA 3SIGA 3H8FA 3H8GA 4UMLA 3KR5A 3KZWA 5FSZA 5CMSA 3EWQA 3JZTA 4ZX8A 4R6TA 4KSIA 3H8EA 3EW5A 2KQVA 4IQYA 2W2GA 5HOLA 3GQEA 4ZY2A 2X47A 1LCPA 5FSYA 5FSUA 2FAVA 4K0CA 3VFQA 1TXZA 5CBMA 1ZR5A 4JLLA 3GQOA 1BPMA 4GUAA 5DUSA 2JZFA 2JZEA
chains in the Genus database with same CATH topology
3EWRA 3KR4A 3PEIA 1HJZA 3EWPA 3GPQA 4GVWA 5D8NA 1SPVA 1BPNA 3EWOA 4R7MA 4ZYQA 3IJ3A 1GYTA 5E3BA 4K3NA 5CB3A 1TY8A 2EWBA 1BLLE 2LGRA 4ZX9A 2ACFA 4ABKA 4ETJA 5FSVA 3SIHA 4D86A 2FG1A 4JGKA 4KYBA 3JRUA 4ESSA 2AFCA 3ETIA 3V45A 3T8WA 3Q71A 2FXKA 3GPOA 1LANA 1NJRA 2BFRA 1LAMA 2VRIA 3KQXA 4J4ZA 4ZI6A 4ETKA 2BFQA 4J5RA 5CB5A 2XD7A 3EJGA 3KQZA 2J9AA 2EEEA 4X2TA 5AILA 1LAPA 3IIFA 1VHUA 3SIJA 2L8RA 4R76A 3V2BA 3SIIA 1YD9A 4ZY1A 3GPGA 4GVVA 5FSXA 3IIDA 4ZY0A 4ABLA 2DX6A 4JVVA 4JCAA 1ZR3A 5HIHA 3EJFA 4J5SA 4TU0A 4J5QA 3EKEA 3Q6ZA 3SIGA 3H8FA 3H8GA 4UMLA 3KR5A 3KZWA 5FSZA 5CMSA 3EWQA 3JZTA 4ZX8A 4R6TA 4KSIA 3H8EA 3EW5A 4IQYA 5HOLA 3GQEA 4ZY2A 2X47A 1LCPA 5FSYA 5FSUA 2FAVA 4K0CA 3VFQA 1TXZA 5CBMA 1ZR5A 3GQOA 4JLLA 1BPMA 4GUAA 5DUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EWR A;  3KR4 A;  3PEI A;  1HJZ A;  3EWP A;  3GPQ A;  4GVW A;  5D8N A;  1SPV A;  1BPN A;  3EWO A;  4R7M A;  4ZYQ A;  3IJ3 A;  1GYT A;  5E3B A;  4K3N A;  5CB3 A;  1TY8 A;  2EWB A;  1BLL E;  2LGR A;  4ZX9 A;  2ACF A;  4ABK A;  4ETJ A;  5FSV A;  3SIH A;  4D86 A;  2FG1 A;  4JGK A;  4KYB A;  3JRU A;  4ESS A;  2AFC A;  3ETI A;  3V45 A;  3T8W A;  3Q71 A;  2FXK A;  3GPO A;  1LAN A;  1NJR A;  2BFR A;  1LAM A;  2VRI A;  3KQX A;  4J4Z A;  4ZI6 A;  4ETK A;  2BFQ A;  4J5R A;  5CB5 A;  2XD7 A;  3EJG A;  3KQZ A;  2J9A A;  2EEE A;  4X2T A;  5AIL A;  1LAP A;  3IIF A;  1VHU A;  3SIJ A;  2L8R A;  4R76 A;  3V2B A;  3SII A;  1YD9 A;  4ZY1 A;  3GPG A;  4GVV A;  5FSX A;  3IID A;  4ZY0 A;  4ABL A;  2DX6 A;  4JVV A;  4JCA A;  1ZR3 A;  5HIH A;  3EJF A;  4J5S A;  4TU0 A;  4J5Q A;  3EKE A;  3Q6Z A;  3SIG A;  3H8F A;  3H8G A;  4UML A;  3KR5 A;  3KZW A;  5FSZ A;  5CMS A;  3EWQ A;  3JZT A;  4ZX8 A;  4R6T A;  4KSI A;  3H8E A;  3EW5 A;  4IQY A;  5HOL A;  3GQE A;  4ZY2 A;  2X47 A;  1LCP A;  5FSY A;  5FSU A;  2FAV A;  4K0C A;  3VFQ A;  1TXZ A;  5CBM A;  1ZR5 A;  3GQO A;  4JLL A;  1BPM A;  4GUA A;  5DUS A; 
#chains in the Genus database with same CATH topology
 3EWR A;  3KR4 A;  3PEI A;  1HJZ A;  3EWP A;  3GPQ A;  4GVW A;  5D8N A;  1SPV A;  1BPN A;  3EWO A;  4R7M A;  4ZYQ A;  3IJ3 A;  1GYT A;  5E3B A;  4K3N A;  5CB3 A;  1TY8 A;  2EWB A;  1BLL E;  2LGR A;  4ZX9 A;  2ACF A;  4ABK A;  4ETJ A;  5FSV A;  3SIH A;  4D86 A;  2FG1 A;  4JGK A;  4KYB A;  3JRU A;  2JZD A;  4ESS A;  2AFC A;  3ETI A;  3V45 A;  3T8W A;  3Q71 A;  2FXK A;  3GPO A;  2WCT A;  1LAN A;  1NJR A;  2BFR A;  1LAM A;  2VRI A;  3KQX A;  4J4Z A;  4ZI6 A;  4ETK A;  2BFQ A;  4J5R A;  5CB5 A;  2XD7 A;  3EJG A;  3KQZ A;  2J9A A;  2EEE A;  4X2T A;  5AIL A;  1LAP A;  3IIF A;  1VHU A;  3SIJ A;  2L8R A;  4R76 A;  3V2B A;  3SII A;  1YD9 A;  4ZY1 A;  3GPG A;  4GVV A;  5FSX A;  3IID A;  4ZY0 A;  4ABL A;  2DX6 A;  4JVV A;  4JCA A;  1ZR3 A;  5HIH A;  2RNK A;  3EJF A;  4J5S A;  4TU0 A;  4J5Q A;  3EKE A;  3Q6Z A;  3SIG A;  3H8F A;  3H8G A;  4UML A;  3KR5 A;  3KZW A;  5FSZ A;  5CMS A;  3EWQ A;  3JZT A;  4ZX8 A;  4R6T A;  4KSI A;  3H8E A;  3EW5 A;  2KQV A;  4IQY A;  2W2G A;  5HOL A;  3GQE A;  4ZY2 A;  2X47 A;  1LCP A;  5FSY A;  5FSU A;  2FAV A;  4K0C A;  3VFQ A;  1TXZ A;  5CBM A;  1ZR5 A;  4JLL A;  3GQO A;  1BPM A;  4GUA A;  5DUS A;  2JZF A;  2JZE A; 
#chains in the Genus database with same CATH homology
 3EWR A;  3KR4 A;  3PEI A;  1HJZ A;  3EWP A;  3GPQ A;  4GVW A;  5D8N A;  1SPV A;  1BPN A;  3EWO A;  4R7M A;  4ZYQ A;  3IJ3 A;  1GYT A;  5E3B A;  4K3N A;  5CB3 A;  1TY8 A;  2EWB A;  1BLL E;  2LGR A;  4ZX9 A;  2ACF A;  4ABK A;  4ETJ A;  5FSV A;  3SIH A;  4D86 A;  2FG1 A;  4JGK A;  4KYB A;  3JRU A;  4ESS A;  2AFC A;  3ETI A;  3V45 A;  3T8W A;  3Q71 A;  2FXK A;  3GPO A;  1LAN A;  1NJR A;  2BFR A;  1LAM A;  2VRI A;  3KQX A;  4J4Z A;  4ZI6 A;  4ETK A;  2BFQ A;  4J5R A;  5CB5 A;  2XD7 A;  3EJG A;  3KQZ A;  2J9A A;  2EEE A;  4X2T A;  5AIL A;  1LAP A;  3IIF A;  1VHU A;  3SIJ A;  2L8R A;  4R76 A;  3V2B A;  3SII A;  1YD9 A;  4ZY1 A;  3GPG A;  4GVV A;  5FSX A;  3IID A;  4ZY0 A;  4ABL A;  2DX6 A;  4JVV A;  4JCA A;  1ZR3 A;  5HIH A;  3EJF A;  4J5S A;  4TU0 A;  4J5Q A;  3EKE A;  3Q6Z A;  3SIG A;  3H8F A;  3H8G A;  4UML A;  3KR5 A;  3KZW A;  5FSZ A;  5CMS A;  3EWQ A;  3JZT A;  4ZX8 A;  4R6T A;  4KSI A;  3H8E A;  3EW5 A;  4IQY A;  5HOL A;  3GQE A;  4ZY2 A;  2X47 A;  1LCP A;  5FSY A;  5FSU A;  2FAV A;  4K0C A;  3VFQ A;  1TXZ A;  5CBM A;  1ZR5 A;  3GQO A;  4JLL A;  1BPM A;  4GUA A;  5DUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...