3SIHA

The x-ray crystal structure of poly(adp-ribose) glycohydrolase (parg) from thermomonospora curvata
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
274
structure length
274
Chain Sequence
RHSRRAIAAETVEILERGRYTAPSGRVVPIADHVAQAVRGTRLYRPEKLAVLLEGLGAASDGAPTRIEVTEETTLAAARRLTGAAGDQVACLNFASAEHPGGGFLSGAHAQEEGLARSSGLYASLRAVPQFYAFHHRQRDPLYSDHLIYSPGVPVFRDDAGRLLEEPYRVAFLTSPAPNRRAIGDLRTVEEIGRVLRGRAAKVLAAARHHGHRRLVLGAWGCGVFGNDPAQVAETFAGLLLDGGPFAGRFAHVVFAVWDTAPGAPRHAAFARRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and catalytic mechanism of a poly(ADP-ribose) glycohydrolase.
pubmed doi rcsb
molecule keywords poly(ADP-ribose) glycohydrolase
molecule tags Hydrolase
source organism Thermomonospora curvata
total genus 94
structure length 274
sequence length 274
ec nomenclature ec 3.2.1.143: Poly(ADP-ribose) glycohydrolase.
pdb deposition date 2011-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10021 DUF2263 Uncharacterized protein conserved in bacteria (DUF2263)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3sihA00
5D8NA 4IQYA 4ZY1A 2DX6A 4TU0A 3EWPA 3H8EA 3PEIA 1BLLE 4R76A 4R6TA 3EWOA 2EEEA 3KQZA 3Q71A 3ETIA 3GPGA 2X47A 4ESSA 3SIGA 3JRUA 2ACFA 3EKEA 4J4ZA 2J9AA 2XD7A 3IIDA 4ZX8A 4ZYQA 4J5SA 3GQOA 3KZWA 5FSVA 5HOLA 3SIIA 4ETKA 3GQEA 5DUSA 5HIHA 4GUAA 2FXKA 4GVVA 5CMSA 4JVVA 1NJRA 2BFQA 4ZI6A 5FSUA 3VFQA 3KQXA 4K3NA 5FSXA 3EJGA 3GPQA 3T8WA 2VRIA 3V45A 2FAVA 1TXZA 1YD9A 3Q6ZA 4J5QA 3IJ3A 5FSZA 4D86A 4ETJA 4X2TA 1ZR3A 1BPMA 3V2BA 5CB5A 1SPVA 2L8RA 4UMLA 4K0CA 2BFRA 3EWRA 3EJFA 3KR5A 1TY8A 4JGKA 4ABKA 1HJZA 1GYTA 3H8FA 3SIJA 3EW5A 1VHUA 1BPNA 1LCPA 5E3BA 3GPOA 5FSYA 5CB3A 3IIFA 3JZTA 4J5RA 3KR4A 4KSIA 2AFCA 4ZX9A 1LAMA 4GVWA 4R7MA 2FG1A 3SIHA 4ABLA 4ZY0A 4KYBA 3EWQA 1LAPA 4JLLA 5CBMA 2EWBA 3H8GA 5AILA 1ZR5A 4JCAA 2LGRA 4ZY2A 1LANA
chains in the Genus database with same CATH superfamily
5D8NA 2JZFA 4IQYA 4ZY1A 2DX6A 4TU0A 3EWPA 3H8EA 3PEIA 1BLLE 4R76A 4R6TA 3EWOA 2EEEA 3KQZA 3Q71A 3ETIA 3GPGA 2X47A 4ESSA 3SIGA 3JRUA 2ACFA 3EKEA 4J4ZA 2J9AA 2KQVA 2XD7A 3IIDA 4ZX8A 4ZYQA 4J5SA 3GQOA 2RNKA 3KZWA 5FSVA 5HOLA 3SIIA 4ETKA 3GQEA 5DUSA 5HIHA 4GUAA 2FXKA 2WCTA 4GVVA 5CMSA 4JVVA 1NJRA 2BFQA 4ZI6A 5FSUA 3VFQA 3KQXA 4K3NA 5FSXA 3EJGA 3GPQA 3T8WA 2VRIA 3V45A 2FAVA 1TXZA 1YD9A 3Q6ZA 4J5QA 3IJ3A 5FSZA 4D86A 2W2GA 4ETJA 4X2TA 1ZR3A 1BPMA 3V2BA 5CB5A 1SPVA 2L8RA 4UMLA 4K0CA 2JZEA 2BFRA 3EWRA 3EJFA 3KR5A 1TY8A 4JGKA 4ABKA 1HJZA 1GYTA 3H8FA 2JZDA 3SIJA 3EW5A 1VHUA 1BPNA 1LCPA 5E3BA 3GPOA 5FSYA 5CB3A 3IIFA 3JZTA 4J5RA 3KR4A 4KSIA 2AFCA 4ZX9A 1LAMA 4GVWA 4R7MA 2FG1A 3SIHA 4ABLA 4ZY0A 4KYBA 3EWQA 1LAPA 4JLLA 5CBMA 2EWBA 3H8GA 5AILA 1ZR5A 4JCAA 2LGRA 4ZY2A 1LANA
chains in the Genus database with same CATH topology
5D8NA 4IQYA 4ZY1A 2DX6A 4TU0A 3EWPA 3H8EA 3PEIA 1BLLE 4R76A 4R6TA 3EWOA 2EEEA 3KQZA 3Q71A 3ETIA 3GPGA 2X47A 4ESSA 3SIGA 3JRUA 2ACFA 3EKEA 4J4ZA 2J9AA 2XD7A 3IIDA 4ZX8A 4ZYQA 4J5SA 3GQOA 3KZWA 5FSVA 5HOLA 3SIIA 4ETKA 3GQEA 5DUSA 5HIHA 4GUAA 2FXKA 4GVVA 5CMSA 4JVVA 1NJRA 2BFQA 4ZI6A 5FSUA 3VFQA 3KQXA 4K3NA 5FSXA 3EJGA 3GPQA 3T8WA 2VRIA 3V45A 2FAVA 1TXZA 1YD9A 3Q6ZA 4J5QA 3IJ3A 5FSZA 4D86A 4ETJA 4X2TA 1ZR3A 1BPMA 3V2BA 5CB5A 1SPVA 2L8RA 4UMLA 4K0CA 2BFRA 3EWRA 3EJFA 3KR5A 1TY8A 4JGKA 4ABKA 1HJZA 1GYTA 3H8FA 3SIJA 3EW5A 1VHUA 1BPNA 1LCPA 5E3BA 3GPOA 5FSYA 5CB3A 3IIFA 3JZTA 4J5RA 3KR4A 4KSIA 2AFCA 4ZX9A 1LAMA 4GVWA 4R7MA 2FG1A 3SIHA 4ABLA 4ZY0A 4KYBA 3EWQA 1LAPA 4JLLA 5CBMA 2EWBA 3H8GA 5AILA 1ZR5A 4JCAA 2LGRA 4ZY2A 1LANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D8N A;  4IQY A;  4ZY1 A;  2DX6 A;  4TU0 A;  3EWP A;  3H8E A;  3PEI A;  1BLL E;  4R76 A;  4R6T A;  3EWO A;  2EEE A;  3KQZ A;  3Q71 A;  3ETI A;  3GPG A;  2X47 A;  4ESS A;  3SIG A;  3JRU A;  2ACF A;  3EKE A;  4J4Z A;  2J9A A;  2XD7 A;  3IID A;  4ZX8 A;  4ZYQ A;  4J5S A;  3GQO A;  3KZW A;  5FSV A;  5HOL A;  3SII A;  4ETK A;  3GQE A;  5DUS A;  5HIH A;  4GUA A;  2FXK A;  4GVV A;  5CMS A;  4JVV A;  1NJR A;  2BFQ A;  4ZI6 A;  5FSU A;  3VFQ A;  3KQX A;  4K3N A;  5FSX A;  3EJG A;  3GPQ A;  3T8W A;  2VRI A;  3V45 A;  2FAV A;  1TXZ A;  1YD9 A;  3Q6Z A;  4J5Q A;  3IJ3 A;  5FSZ A;  4D86 A;  4ETJ A;  4X2T A;  1ZR3 A;  1BPM A;  3V2B A;  5CB5 A;  1SPV A;  2L8R A;  4UML A;  4K0C A;  2BFR A;  3EWR A;  3EJF A;  3KR5 A;  1TY8 A;  4JGK A;  4ABK A;  1HJZ A;  1GYT A;  3H8F A;  3SIJ A;  3EW5 A;  1VHU A;  1BPN A;  1LCP A;  5E3B A;  3GPO A;  5FSY A;  5CB3 A;  3IIF A;  3JZT A;  4J5R A;  3KR4 A;  4KSI A;  2AFC A;  4ZX9 A;  1LAM A;  4GVW A;  4R7M A;  2FG1 A;  3SIH A;  4ABL A;  4ZY0 A;  4KYB A;  3EWQ A;  1LAP A;  4JLL A;  5CBM A;  2EWB A;  3H8G A;  5AIL A;  1ZR5 A;  4JCA A;  2LGR A;  4ZY2 A;  1LAN A; 
#chains in the Genus database with same CATH topology
 5D8N A;  2JZF A;  4IQY A;  4ZY1 A;  2DX6 A;  4TU0 A;  3EWP A;  3H8E A;  3PEI A;  1BLL E;  4R76 A;  4R6T A;  3EWO A;  2EEE A;  3KQZ A;  3Q71 A;  3ETI A;  3GPG A;  2X47 A;  4ESS A;  3SIG A;  3JRU A;  2ACF A;  3EKE A;  4J4Z A;  2J9A A;  2KQV A;  2XD7 A;  3IID A;  4ZX8 A;  4ZYQ A;  4J5S A;  3GQO A;  2RNK A;  3KZW A;  5FSV A;  5HOL A;  3SII A;  4ETK A;  3GQE A;  5DUS A;  5HIH A;  4GUA A;  2FXK A;  2WCT A;  4GVV A;  5CMS A;  4JVV A;  1NJR A;  2BFQ A;  4ZI6 A;  5FSU A;  3VFQ A;  3KQX A;  4K3N A;  5FSX A;  3EJG A;  3GPQ A;  3T8W A;  2VRI A;  3V45 A;  2FAV A;  1TXZ A;  1YD9 A;  3Q6Z A;  4J5Q A;  3IJ3 A;  5FSZ A;  4D86 A;  2W2G A;  4ETJ A;  4X2T A;  1ZR3 A;  1BPM A;  3V2B A;  5CB5 A;  1SPV A;  2L8R A;  4UML A;  4K0C A;  2JZE A;  2BFR A;  3EWR A;  3EJF A;  3KR5 A;  1TY8 A;  4JGK A;  4ABK A;  1HJZ A;  1GYT A;  3H8F A;  2JZD A;  3SIJ A;  3EW5 A;  1VHU A;  1BPN A;  1LCP A;  5E3B A;  3GPO A;  5FSY A;  5CB3 A;  3IIF A;  3JZT A;  4J5R A;  3KR4 A;  4KSI A;  2AFC A;  4ZX9 A;  1LAM A;  4GVW A;  4R7M A;  2FG1 A;  3SIH A;  4ABL A;  4ZY0 A;  4KYB A;  3EWQ A;  1LAP A;  4JLL A;  5CBM A;  2EWB A;  3H8G A;  5AIL A;  1ZR5 A;  4JCA A;  2LGR A;  4ZY2 A;  1LAN A; 
#chains in the Genus database with same CATH homology
 5D8N A;  4IQY A;  4ZY1 A;  2DX6 A;  4TU0 A;  3EWP A;  3H8E A;  3PEI A;  1BLL E;  4R76 A;  4R6T A;  3EWO A;  2EEE A;  3KQZ A;  3Q71 A;  3ETI A;  3GPG A;  2X47 A;  4ESS A;  3SIG A;  3JRU A;  2ACF A;  3EKE A;  4J4Z A;  2J9A A;  2XD7 A;  3IID A;  4ZX8 A;  4ZYQ A;  4J5S A;  3GQO A;  3KZW A;  5FSV A;  5HOL A;  3SII A;  4ETK A;  3GQE A;  5DUS A;  5HIH A;  4GUA A;  2FXK A;  4GVV A;  5CMS A;  4JVV A;  1NJR A;  2BFQ A;  4ZI6 A;  5FSU A;  3VFQ A;  3KQX A;  4K3N A;  5FSX A;  3EJG A;  3GPQ A;  3T8W A;  2VRI A;  3V45 A;  2FAV A;  1TXZ A;  1YD9 A;  3Q6Z A;  4J5Q A;  3IJ3 A;  5FSZ A;  4D86 A;  4ETJ A;  4X2T A;  1ZR3 A;  1BPM A;  3V2B A;  5CB5 A;  1SPV A;  2L8R A;  4UML A;  4K0C A;  2BFR A;  3EWR A;  3EJF A;  3KR5 A;  1TY8 A;  4JGK A;  4ABK A;  1HJZ A;  1GYT A;  3H8F A;  3SIJ A;  3EW5 A;  1VHU A;  1BPN A;  1LCP A;  5E3B A;  3GPO A;  5FSY A;  5CB3 A;  3IIF A;  3JZT A;  4J5R A;  3KR4 A;  4KSI A;  2AFC A;  4ZX9 A;  1LAM A;  4GVW A;  4R7M A;  2FG1 A;  3SIH A;  4ABL A;  4ZY0 A;  4KYB A;  3EWQ A;  1LAP A;  4JLL A;  5CBM A;  2EWB A;  3H8G A;  5AIL A;  1ZR5 A;  4JCA A;  2LGR A;  4ZY2 A;  1LAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...