3SIHA

The x-ray crystal structure of poly(adp-ribose) glycohydrolase (parg) from thermomonospora curvata
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
274
structure length
274
Chain Sequence
RHSRRAIAAETVEILERGRYTAPSGRVVPIADHVAQAVRGTRLYRPEKLAVLLEGLGAASDGAPTRIEVTEETTLAAARRLTGAAGDQVACLNFASAEHPGGGFLSGAHAQEEGLARSSGLYASLRAVPQFYAFHHRQRDPLYSDHLIYSPGVPVFRDDAGRLLEEPYRVAFLTSPAPNRRAIGDLRTVEEIGRVLRGRAAKVLAAARHHGHRRLVLGAWGCGVFGNDPAQVAETFAGLLLDGGPFAGRFAHVVFAVWDTAPGAPRHAAFARRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and catalytic mechanism of a poly(ADP-ribose) glycohydrolase.
pubmed doi rcsb
source organism Thermomonospora curvata
molecule tags Hydrolase
molecule keywords poly(ADP-ribose) glycohydrolase
total genus 94
structure length 274
sequence length 274
ec nomenclature ec 3.2.1.143: Poly(ADP-ribose) glycohydrolase.
pdb deposition date 2011-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10021 DUF2263 Uncharacterized protein conserved in bacteria (DUF2263)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3sihA00
5HIHA 4ZX8A 5FSYA 1LCPA 1LAMA 3EWQA 3SIIA 5CB5A 5FSUA 3GQEA 3H8GA 3IJ3A 4ABKA 1TY8A 4JVVA 5HOLA 5CBMA 1BPNA 2FG1A 3Q71A 2EWBA 3EWOA 4ZYQA 1HJZA 4J5RA 1GYTA 3EKEA 3JRUA 3KQZA 4J5QA 5AILA 2BFRA 4ETJA 2L8RA 4R76A 2FAVA 1SPVA 4JCAA 4ZY0A 3V45A 3EWRA 5D8NA 1ZR3A 4K3NA 5FSXA 4D86A 4KYBA 4ESSA 1NJRA 4R7MA 4ETKA 2XD7A 5CMSA 3V2BA 4J4ZA 3IIFA 3SIHA 4ZX9A 2EEEA 3H8EA 1BPMA 5FSZA 3KR5A 3Q6ZA 3KQXA 2X47A 4ABLA 3H8FA 4JLLA 4JGKA 5DUSA 2LGRA 4R6TA 4ZY1A 2AFCA 4X2TA 5E3BA 3EWPA 4IQYA 4ZI6A 3GQOA 3JZTA 4GVVA 4GUAA 5CB3A 2VRIA 3VFQA 3GPQA 1ZR5A 4ZY2A 5FSVA 3ETIA 3EJFA 4GVWA 3SIGA 3GPOA 4K0CA 3KR4A 3SIJA 1TXZA 4J5SA 1VHUA 2DX6A 3GPGA 3IIDA 2FXKA 1LANA 3EW5A 3PEIA 4UMLA 3T8WA 2BFQA 2J9AA 3KZWA 3EJGA 1BLLE 2ACFA 1YD9A 1LAPA 4KSIA 4TU0A
chains in the Genus database with same CATH superfamily
5HIHA 4ZX8A 5FSYA 1LCPA 1LAMA 3EWQA 3SIIA 5CB5A 5FSUA 3GQEA 3H8GA 3IJ3A 4ABKA 1TY8A 4JVVA 5HOLA 5CBMA 1BPNA 2FG1A 3Q71A 2EWBA 3EWOA 4ZYQA 1HJZA 4J5RA 1GYTA 3EKEA 3JRUA 3KQZA 2JZDA 4J5QA 2BFRA 5AILA 4ETJA 2W2GA 2L8RA 4R76A 2FAVA 1SPVA 4JCAA 4ZY0A 3V45A 3EWRA 5D8NA 1ZR3A 4K3NA 5FSXA 4D86A 4KYBA 4ESSA 1NJRA 4R7MA 4ETKA 2XD7A 5CMSA 3V2BA 4J4ZA 3IIFA 3SIHA 4ZX9A 2EEEA 3H8EA 1BPMA 5FSZA 3KR5A 3Q6ZA 3KQXA 2X47A 4ABLA 2JZEA 3H8FA 4JLLA 4JGKA 5DUSA 2LGRA 4R6TA 4ZY1A 2AFCA 4X2TA 5E3BA 3EWPA 4IQYA 4ZI6A 3GQOA 3JZTA 4GVVA 4GUAA 5CB3A 2VRIA 3VFQA 3GPQA 1ZR5A 4ZY2A 5FSVA 3ETIA 3EJFA 4GVWA 2WCTA 3SIGA 3GPOA 4K0CA 2RNKA 3KR4A 3SIJA 1TXZA 2JZFA 1VHUA 4J5SA 2DX6A 3GPGA 3IIDA 2KQVA 2FXKA 1LANA 3EW5A 3PEIA 4UMLA 3T8WA 2BFQA 2J9AA 3KZWA 3EJGA 1BLLE 2ACFA 1YD9A 1LAPA 4KSIA 4TU0A
chains in the Genus database with same CATH topology
5HIHA 4ZX8A 5FSYA 1LCPA 1LAMA 3EWQA 3SIIA 5CB5A 5FSUA 3GQEA 3H8GA 3IJ3A 4ABKA 1TY8A 4JVVA 5HOLA 5CBMA 1BPNA 2FG1A 3Q71A 2EWBA 3EWOA 4ZYQA 1HJZA 4J5RA 1GYTA 3EKEA 3JRUA 3KQZA 4J5QA 5AILA 2BFRA 4ETJA 2L8RA 4R76A 2FAVA 1SPVA 4JCAA 4ZY0A 3V45A 3EWRA 5D8NA 1ZR3A 4K3NA 5FSXA 4D86A 4KYBA 4ESSA 1NJRA 4R7MA 4ETKA 2XD7A 5CMSA 3V2BA 4J4ZA 3IIFA 3SIHA 4ZX9A 2EEEA 3H8EA 1BPMA 5FSZA 3KR5A 3Q6ZA 3KQXA 2X47A 4ABLA 3H8FA 4JLLA 4JGKA 5DUSA 2LGRA 4R6TA 4ZY1A 2AFCA 4X2TA 5E3BA 3EWPA 4IQYA 4ZI6A 3GQOA 3JZTA 4GVVA 4GUAA 5CB3A 2VRIA 3VFQA 3GPQA 1ZR5A 4ZY2A 5FSVA 3ETIA 3EJFA 4GVWA 3SIGA 3GPOA 4K0CA 3KR4A 3SIJA 1TXZA 4J5SA 1VHUA 2DX6A 3GPGA 3IIDA 2FXKA 1LANA 3EW5A 3PEIA 4UMLA 3T8WA 2BFQA 2J9AA 3KZWA 3EJGA 1BLLE 2ACFA 1YD9A 1LAPA 4KSIA 4TU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HIH A;  4ZX8 A;  5FSY A;  1LCP A;  1LAM A;  3EWQ A;  3SII A;  5CB5 A;  5FSU A;  3GQE A;  3H8G A;  3IJ3 A;  4ABK A;  1TY8 A;  4JVV A;  5HOL A;  5CBM A;  1BPN A;  2FG1 A;  3Q71 A;  2EWB A;  3EWO A;  4ZYQ A;  1HJZ A;  4J5R A;  1GYT A;  3EKE A;  3JRU A;  3KQZ A;  4J5Q A;  5AIL A;  2BFR A;  4ETJ A;  2L8R A;  4R76 A;  2FAV A;  1SPV A;  4JCA A;  4ZY0 A;  3V45 A;  3EWR A;  5D8N A;  1ZR3 A;  4K3N A;  5FSX A;  4D86 A;  4KYB A;  4ESS A;  1NJR A;  4R7M A;  4ETK A;  2XD7 A;  5CMS A;  3V2B A;  4J4Z A;  3IIF A;  3SIH A;  4ZX9 A;  2EEE A;  3H8E A;  1BPM A;  5FSZ A;  3KR5 A;  3Q6Z A;  3KQX A;  2X47 A;  4ABL A;  3H8F A;  4JLL A;  4JGK A;  5DUS A;  2LGR A;  4R6T A;  4ZY1 A;  2AFC A;  4X2T A;  5E3B A;  3EWP A;  4IQY A;  4ZI6 A;  3GQO A;  3JZT A;  4GVV A;  4GUA A;  5CB3 A;  2VRI A;  3VFQ A;  3GPQ A;  1ZR5 A;  4ZY2 A;  5FSV A;  3ETI A;  3EJF A;  4GVW A;  3SIG A;  3GPO A;  4K0C A;  3KR4 A;  3SIJ A;  1TXZ A;  4J5S A;  1VHU A;  2DX6 A;  3GPG A;  3IID A;  2FXK A;  1LAN A;  3EW5 A;  3PEI A;  4UML A;  3T8W A;  2BFQ A;  2J9A A;  3KZW A;  3EJG A;  1BLL E;  2ACF A;  1YD9 A;  1LAP A;  4KSI A;  4TU0 A; 
#chains in the Genus database with same CATH topology
 5HIH A;  4ZX8 A;  5FSY A;  1LCP A;  1LAM A;  3EWQ A;  3SII A;  5CB5 A;  5FSU A;  3GQE A;  3H8G A;  3IJ3 A;  4ABK A;  1TY8 A;  4JVV A;  5HOL A;  5CBM A;  1BPN A;  2FG1 A;  3Q71 A;  2EWB A;  3EWO A;  4ZYQ A;  1HJZ A;  4J5R A;  1GYT A;  3EKE A;  3JRU A;  3KQZ A;  2JZD A;  4J5Q A;  2BFR A;  5AIL A;  4ETJ A;  2W2G A;  2L8R A;  4R76 A;  2FAV A;  1SPV A;  4JCA A;  4ZY0 A;  3V45 A;  3EWR A;  5D8N A;  1ZR3 A;  4K3N A;  5FSX A;  4D86 A;  4KYB A;  4ESS A;  1NJR A;  4R7M A;  4ETK A;  2XD7 A;  5CMS A;  3V2B A;  4J4Z A;  3IIF A;  3SIH A;  4ZX9 A;  2EEE A;  3H8E A;  1BPM A;  5FSZ A;  3KR5 A;  3Q6Z A;  3KQX A;  2X47 A;  4ABL A;  2JZE A;  3H8F A;  4JLL A;  4JGK A;  5DUS A;  2LGR A;  4R6T A;  4ZY1 A;  2AFC A;  4X2T A;  5E3B A;  3EWP A;  4IQY A;  4ZI6 A;  3GQO A;  3JZT A;  4GVV A;  4GUA A;  5CB3 A;  2VRI A;  3VFQ A;  3GPQ A;  1ZR5 A;  4ZY2 A;  5FSV A;  3ETI A;  3EJF A;  4GVW A;  2WCT A;  3SIG A;  3GPO A;  4K0C A;  2RNK A;  3KR4 A;  3SIJ A;  1TXZ A;  2JZF A;  1VHU A;  4J5S A;  2DX6 A;  3GPG A;  3IID A;  2KQV A;  2FXK A;  1LAN A;  3EW5 A;  3PEI A;  4UML A;  3T8W A;  2BFQ A;  2J9A A;  3KZW A;  3EJG A;  1BLL E;  2ACF A;  1YD9 A;  1LAP A;  4KSI A;  4TU0 A; 
#chains in the Genus database with same CATH homology
 5HIH A;  4ZX8 A;  5FSY A;  1LCP A;  1LAM A;  3EWQ A;  3SII A;  5CB5 A;  5FSU A;  3GQE A;  3H8G A;  3IJ3 A;  4ABK A;  1TY8 A;  4JVV A;  5HOL A;  5CBM A;  1BPN A;  2FG1 A;  3Q71 A;  2EWB A;  3EWO A;  4ZYQ A;  1HJZ A;  4J5R A;  1GYT A;  3EKE A;  3JRU A;  3KQZ A;  4J5Q A;  5AIL A;  2BFR A;  4ETJ A;  2L8R A;  4R76 A;  2FAV A;  1SPV A;  4JCA A;  4ZY0 A;  3V45 A;  3EWR A;  5D8N A;  1ZR3 A;  4K3N A;  5FSX A;  4D86 A;  4KYB A;  4ESS A;  1NJR A;  4R7M A;  4ETK A;  2XD7 A;  5CMS A;  3V2B A;  4J4Z A;  3IIF A;  3SIH A;  4ZX9 A;  2EEE A;  3H8E A;  1BPM A;  5FSZ A;  3KR5 A;  3Q6Z A;  3KQX A;  2X47 A;  4ABL A;  3H8F A;  4JLL A;  4JGK A;  5DUS A;  2LGR A;  4R6T A;  4ZY1 A;  2AFC A;  4X2T A;  5E3B A;  3EWP A;  4IQY A;  4ZI6 A;  3GQO A;  3JZT A;  4GVV A;  4GUA A;  5CB3 A;  2VRI A;  3VFQ A;  3GPQ A;  1ZR5 A;  4ZY2 A;  5FSV A;  3ETI A;  3EJF A;  4GVW A;  3SIG A;  3GPO A;  4K0C A;  3KR4 A;  3SIJ A;  1TXZ A;  4J5S A;  1VHU A;  2DX6 A;  3GPG A;  3IID A;  2FXK A;  1LAN A;  3EW5 A;  3PEI A;  4UML A;  3T8W A;  2BFQ A;  2J9A A;  3KZW A;  3EJG A;  1BLL E;  2ACF A;  1YD9 A;  1LAP A;  4KSI A;  4TU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...