3SIJA

The x-ray crystal structure of poly(adp-ribose) glycohydrolase e115a mutant from thermomonospora curvata
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
Knots found
sequence length
274
structure length
265
Chain Sequence
RHSRRAIAAETVEILERGRYTAPSGRVVPIADHVAQAVRGTRLYRPEKLAVLLEGTRIEVTEETTLAAARRLTGAAGDQVACLNFASAEHPGGGFLSGAHAQEAGLARSSGLYASLRAVPQFYAFHHRQRDPLYSDHLIYSPGVPVFRDDAGRLLEEPYRVAFLTSPAPNRRAIGDLRTVEEIGRVLRGRAAKVLAAARHHGHRRLVLGAWGCGVFGNDPAQVAETFAGLLLDGGPFAGRFAHVVFAVWDTAPGAPRHAAFARRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and catalytic mechanism of a poly(ADP-ribose) glycohydrolase.
pubmed doi rcsb
source organism Thermomonospora curvata
molecule tags Hydrolase
molecule keywords poly(ADP-ribose) glycohydrolase
total genus 89
structure length 265
sequence length 274
other databases KnotProt 2.0: K +31
ec nomenclature ec 3.2.1.143: Poly(ADP-ribose) glycohydrolase.
pdb deposition date 2011-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10021 DUF2263 Uncharacterized protein conserved in bacteria (DUF2263)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3sijA00
1LAPA 2FXKA 5FSZA 2EWBA 3V45A 5CBMA 2X47A 1ZR3A 4KSIA 2FAVA 4IQYA 3H8GA 3ETIA 4J5RA 3EWPA 1VHUA 4ETKA 1TXZA 3Q71A 5E3BA 3SIGA 5FSUA 4D86A 3JZTA 5CB3A 4ZY1A 5HOLA 3IIFA 3KR5A 3SIHA 2ACFA 4J5SA 4KYBA 3SIJA 5CB5A 4ABLA 4ESSA 4GUAA 3Q6ZA 2DX6A 4J5QA 1LAMA 2EEEA 1BPNA 3H8EA 2L8RA 4JVVA 4GVWA 4JCAA 1LCPA 5FSYA 4ZX8A 3EWQA 3SIIA 3EW5A 3IJ3A 1BLLE 4ZYQA 1GYTA 4ZI6A 2VRIA 3KQZA 3PEIA 1ZR5A 3EJFA 1SPVA 2BFRA 4JLLA 3V2BA 3EWOA 3IIDA 3JRUA 1NJRA 3EKEA 4UMLA 4K3NA 4JGKA 1BPMA 3GQEA 1TY8A 4ZY0A 4ZX9A 5HIHA 4R76A 5D8NA 4TU0A 5FSXA 4ABKA 2FG1A 2J9AA 3KZWA 4K0CA 3GQOA 4R6TA 5FSVA 4X2TA 4R7MA 1YD9A 3GPOA 3KR4A 1HJZA 4ZY2A 2BFQA 3H8FA 3VFQA 4GVVA 4J4ZA 3EJGA 3GPQA 1LANA 3KQXA 2AFCA 5AILA 5CMSA 4ETJA 3GPGA 2XD7A 5DUSA 3EWRA 3T8WA 2LGRA
chains in the Genus database with same CATH superfamily
2JZFA 1LAPA 2FXKA 2W2GA 5FSZA 2EWBA 3V45A 5CBMA 2X47A 1ZR3A 4KSIA 2FAVA 4IQYA 3H8GA 3ETIA 4J5RA 3EWPA 1VHUA 4ETKA 1TXZA 3Q71A 5E3BA 3SIGA 5FSUA 4D86A 3JZTA 5CB3A 4ZY1A 5HOLA 3IIFA 3KR5A 3SIHA 2ACFA 4J5SA 2JZEA 4KYBA 3SIJA 5CB5A 4ABLA 4ESSA 4GUAA 3Q6ZA 2DX6A 4J5QA 1LAMA 2JZDA 2EEEA 1BPNA 3H8EA 2L8RA 4JVVA 4GVWA 4JCAA 1LCPA 5FSYA 4ZX8A 3EWQA 3SIIA 3EW5A 2WCTA 3IJ3A 1BLLE 4ZYQA 1GYTA 4ZI6A 2VRIA 3KQZA 3PEIA 1ZR5A 3EJFA 1SPVA 2BFRA 4JLLA 3V2BA 3EWOA 3IIDA 3JRUA 1NJRA 3EKEA 4UMLA 4K3NA 4JGKA 1BPMA 3GQEA 1TY8A 4ZY0A 2RNKA 4ZX9A 5HIHA 4R76A 5D8NA 4TU0A 5FSXA 4ABKA 2FG1A 2J9AA 3KZWA 4K0CA 3GQOA 4R6TA 5FSVA 4X2TA 4R7MA 1YD9A 3GPOA 3KR4A 1HJZA 4ZY2A 2BFQA 3H8FA 3VFQA 4GVVA 4J4ZA 3EJGA 3GPQA 1LANA 3KQXA 2AFCA 5AILA 5CMSA 4ETJA 3GPGA 2XD7A 2KQVA 5DUSA 3EWRA 3T8WA 2LGRA
chains in the Genus database with same CATH topology
1LAPA 2FXKA 5FSZA 2EWBA 3V45A 5CBMA 2X47A 1ZR3A 4KSIA 2FAVA 4IQYA 3H8GA 3ETIA 4J5RA 3EWPA 1VHUA 4ETKA 1TXZA 3Q71A 5E3BA 3SIGA 5FSUA 4D86A 3JZTA 5CB3A 4ZY1A 5HOLA 3IIFA 3KR5A 3SIHA 2ACFA 4J5SA 4KYBA 3SIJA 5CB5A 4ABLA 4ESSA 4GUAA 3Q6ZA 2DX6A 4J5QA 1LAMA 2EEEA 1BPNA 3H8EA 2L8RA 4JVVA 4GVWA 4JCAA 1LCPA 5FSYA 4ZX8A 3EWQA 3SIIA 3EW5A 3IJ3A 1BLLE 4ZYQA 1GYTA 4ZI6A 2VRIA 3KQZA 3PEIA 1ZR5A 3EJFA 1SPVA 2BFRA 4JLLA 3V2BA 3EWOA 3IIDA 3JRUA 1NJRA 3EKEA 4UMLA 4K3NA 4JGKA 1BPMA 3GQEA 1TY8A 4ZY0A 4ZX9A 5HIHA 4R76A 5D8NA 4TU0A 5FSXA 4ABKA 2FG1A 2J9AA 3KZWA 4K0CA 3GQOA 4R6TA 5FSVA 4X2TA 4R7MA 1YD9A 3GPOA 3KR4A 1HJZA 4ZY2A 2BFQA 3H8FA 3VFQA 4GVVA 4J4ZA 3EJGA 3GPQA 1LANA 3KQXA 2AFCA 5AILA 5CMSA 4ETJA 3GPGA 2XD7A 5DUSA 3EWRA 3T8WA 2LGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAP A;  2FXK A;  5FSZ A;  2EWB A;  3V45 A;  5CBM A;  2X47 A;  1ZR3 A;  4KSI A;  2FAV A;  4IQY A;  3H8G A;  3ETI A;  4J5R A;  3EWP A;  1VHU A;  4ETK A;  1TXZ A;  3Q71 A;  5E3B A;  3SIG A;  5FSU A;  4D86 A;  3JZT A;  5CB3 A;  4ZY1 A;  5HOL A;  3IIF A;  3KR5 A;  3SIH A;  2ACF A;  4J5S A;  4KYB A;  3SIJ A;  5CB5 A;  4ABL A;  4ESS A;  4GUA A;  3Q6Z A;  2DX6 A;  4J5Q A;  1LAM A;  2EEE A;  1BPN A;  3H8E A;  2L8R A;  4JVV A;  4GVW A;  4JCA A;  1LCP A;  5FSY A;  4ZX8 A;  3EWQ A;  3SII A;  3EW5 A;  3IJ3 A;  1BLL E;  4ZYQ A;  1GYT A;  4ZI6 A;  2VRI A;  3KQZ A;  3PEI A;  1ZR5 A;  3EJF A;  1SPV A;  2BFR A;  4JLL A;  3V2B A;  3EWO A;  3IID A;  3JRU A;  1NJR A;  3EKE A;  4UML A;  4K3N A;  4JGK A;  1BPM A;  3GQE A;  1TY8 A;  4ZY0 A;  4ZX9 A;  5HIH A;  4R76 A;  5D8N A;  4TU0 A;  5FSX A;  4ABK A;  2FG1 A;  2J9A A;  3KZW A;  4K0C A;  3GQO A;  4R6T A;  5FSV A;  4X2T A;  4R7M A;  1YD9 A;  3GPO A;  3KR4 A;  1HJZ A;  4ZY2 A;  2BFQ A;  3H8F A;  3VFQ A;  4GVV A;  4J4Z A;  3EJG A;  3GPQ A;  1LAN A;  3KQX A;  2AFC A;  5AIL A;  5CMS A;  4ETJ A;  3GPG A;  2XD7 A;  5DUS A;  3EWR A;  3T8W A;  2LGR A; 
#chains in the Genus database with same CATH topology
 2JZF A;  1LAP A;  2FXK A;  2W2G A;  5FSZ A;  2EWB A;  3V45 A;  5CBM A;  2X47 A;  1ZR3 A;  4KSI A;  2FAV A;  4IQY A;  3H8G A;  3ETI A;  4J5R A;  3EWP A;  1VHU A;  4ETK A;  1TXZ A;  3Q71 A;  5E3B A;  3SIG A;  5FSU A;  4D86 A;  3JZT A;  5CB3 A;  4ZY1 A;  5HOL A;  3IIF A;  3KR5 A;  3SIH A;  2ACF A;  4J5S A;  2JZE A;  4KYB A;  3SIJ A;  5CB5 A;  4ABL A;  4ESS A;  4GUA A;  3Q6Z A;  2DX6 A;  4J5Q A;  1LAM A;  2JZD A;  2EEE A;  1BPN A;  3H8E A;  2L8R A;  4JVV A;  4GVW A;  4JCA A;  1LCP A;  5FSY A;  4ZX8 A;  3EWQ A;  3SII A;  3EW5 A;  2WCT A;  3IJ3 A;  1BLL E;  4ZYQ A;  1GYT A;  4ZI6 A;  2VRI A;  3KQZ A;  3PEI A;  1ZR5 A;  3EJF A;  1SPV A;  2BFR A;  4JLL A;  3V2B A;  3EWO A;  3IID A;  3JRU A;  1NJR A;  3EKE A;  4UML A;  4K3N A;  4JGK A;  1BPM A;  3GQE A;  1TY8 A;  4ZY0 A;  2RNK A;  4ZX9 A;  5HIH A;  4R76 A;  5D8N A;  4TU0 A;  5FSX A;  4ABK A;  2FG1 A;  2J9A A;  3KZW A;  4K0C A;  3GQO A;  4R6T A;  5FSV A;  4X2T A;  4R7M A;  1YD9 A;  3GPO A;  3KR4 A;  1HJZ A;  4ZY2 A;  2BFQ A;  3H8F A;  3VFQ A;  4GVV A;  4J4Z A;  3EJG A;  3GPQ A;  1LAN A;  3KQX A;  2AFC A;  5AIL A;  5CMS A;  4ETJ A;  3GPG A;  2XD7 A;  2KQV A;  5DUS A;  3EWR A;  3T8W A;  2LGR A; 
#chains in the Genus database with same CATH homology
 1LAP A;  2FXK A;  5FSZ A;  2EWB A;  3V45 A;  5CBM A;  2X47 A;  1ZR3 A;  4KSI A;  2FAV A;  4IQY A;  3H8G A;  3ETI A;  4J5R A;  3EWP A;  1VHU A;  4ETK A;  1TXZ A;  3Q71 A;  5E3B A;  3SIG A;  5FSU A;  4D86 A;  3JZT A;  5CB3 A;  4ZY1 A;  5HOL A;  3IIF A;  3KR5 A;  3SIH A;  2ACF A;  4J5S A;  4KYB A;  3SIJ A;  5CB5 A;  4ABL A;  4ESS A;  4GUA A;  3Q6Z A;  2DX6 A;  4J5Q A;  1LAM A;  2EEE A;  1BPN A;  3H8E A;  2L8R A;  4JVV A;  4GVW A;  4JCA A;  1LCP A;  5FSY A;  4ZX8 A;  3EWQ A;  3SII A;  3EW5 A;  3IJ3 A;  1BLL E;  4ZYQ A;  1GYT A;  4ZI6 A;  2VRI A;  3KQZ A;  3PEI A;  1ZR5 A;  3EJF A;  1SPV A;  2BFR A;  4JLL A;  3V2B A;  3EWO A;  3IID A;  3JRU A;  1NJR A;  3EKE A;  4UML A;  4K3N A;  4JGK A;  1BPM A;  3GQE A;  1TY8 A;  4ZY0 A;  4ZX9 A;  5HIH A;  4R76 A;  5D8N A;  4TU0 A;  5FSX A;  4ABK A;  2FG1 A;  2J9A A;  3KZW A;  4K0C A;  3GQO A;  4R6T A;  5FSV A;  4X2T A;  4R7M A;  1YD9 A;  3GPO A;  3KR4 A;  1HJZ A;  4ZY2 A;  2BFQ A;  3H8F A;  3VFQ A;  4GVV A;  4J4Z A;  3EJG A;  3GPQ A;  1LAN A;  3KQX A;  2AFC A;  5AIL A;  5CMS A;  4ETJ A;  3GPG A;  2XD7 A;  5DUS A;  3EWR A;  3T8W A;  2LGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...