3SIRA

Crystal structure of drice
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
256
structure length
214
Chain Sequence
ALGSVTDRHAAEYNMRHKNRGMALIFNHEHFNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIEYSASQNHSDSDCILVAILSHGEMGYIYAKDTQYKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFQIPCITTMLTRILRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase
publication title Structural mechanisms of DIAP1 auto-inhibition and DIAP1-mediated inhibition of drICE.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 59
structure length 214
sequence length 256
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sirA00
4QU5A 2XYGA 1NMQA 1RHJA 3SIRA 3H1PA 4AWBA 2CNOA 2C2OA 2J31A 4PS1A 2C2ZA 4FEAA 5IASA 2C2KA 4IEFB 4QUJA 4EHHA 4PS0A 4FXOA 4JB8A 4JQZA 4JJEA 3UOAB 3S8EA 4EHAA 2H48A 2C1EA 3DEJA 2C2MA 2Y0BA 2QLFA 2FUNB 3GJTA 1RHUA 2H51A 1SHJA 3H11B 3R6GA 4JR1A 4QUIA 3V55A 4D3XA 5LUAA 3H13A 4N7MA 3R7SA 2XZTA 1SC4A 3P4UA 2HBQA 1RHKA 4N7JA 3PD1A 1I4EB 1CVRA 2H65A 4NBNA 4NOLA 5IAEA 5IABA 2Y1LA 3GJRA 2CJYA 2QLBA 5LU8A 4LSZA 4QUHA 5IAKA 3KJFA 3GJSA 3KJNA 5IAGA 2CDRA 4AW9A 4DCPA 4EHNA 1SC3A 4JJ7A 4JR2A 5JFTA 4JQYA 2HBRA 3PD0A 4D3YA 4EHLA 1JXQA 2K7ZA 4N5DA 4QTXA 1I3OA 3V4OA 2J30A 3OD5A 4IYRA 5IC6A 4PRYA 2XYPA 3NR2A 3R6LA 3R7NA 4DCOA 5I9BA 4QUEA 1NMEA 1RHQA 2CNKA 1NW9B 3S70A 4I1RA 3V6LA 4ZVPA 2HBYA 1I4OA 2H4WA 1RWXA 4ZVRA 4ZVOA 5IBPA 1M72A 2XYHA 4NBLA 3ITNA 3D6HA 5IBCA 4JR0A 5H0IA 4ZVQA 2QLJA 3EDQA 3V3KA 3IBCA 4N6OA 4NOMA 4EHDA 5LU9A 4EJFA 4QULA 1SC1A 4EHFA 4FDLA 1IBCA 5IBRA 4FGUA 4N6NA 3GJQA 4JJ8A 1CP3A 4NOJA 4QUDA 4QU8A 1RHMA 1RWPA 1RHRA 2AR9A 4EHKA 4QUAA 1F9EA 3D6FA 4HQRA 1BMQA 2H5IA 5IC4A 1GFWA 1GQFA 3E4CA 3P45A 3D6MA 2WDPA 1K88A 4N6GA 2XZDA 3SIPA 3V4LA 3DEIA 2NN3C 4AWAA 1QX3A 3H11A 1F1JA 1RWMA 1SHLA 4M9RA 5K20A 3UO8B 5LUBA 3R7BA 4PRZA 1RWVA 1QDUA 3EDRA 3IBFA 3BIJA 3R5JA 5IAJA 4DCJA 3NS7A 4ZVSA 2FQQA 3QNWA 1RE1A 2QL9A 3NKFA 4ZVUA 2DKOA 4QU0A 2H5JA 1PYOA 3R5KA 5I9TA 3PCXA 4D3ZA 2J32A 4NOKA 2FP3A 4QUGA 2CNLA 1NMSA 3DEKA 1KMCA 3V6MA 1ICEA 2QL7A 3RJMA 1K86A 3K7EA 5IANA 2H54A 2H4YA 1PAUA 2CNNA 2J33A 4I1PA 4HVAA 1RWKA 3H0EA 2CJXA 4QTYA 1I51A 1QTNA 3KJQA 2QL5A 4NBKA 4QUBA 5IARA 1RWNA 2P2CA 3DEHA 2HBZA 1RWWA 4ZVTA 4HQ0A 4QU9A 1RWOA
chains in the Genus database with same CATH superfamily
4GX5A 5GONA 4Z3DA 2A7QA 4EO7A 2FUEA 1K27A 1Z2EA 3T8YA 3VHLB 2EYQA 3K16A 5MF6A 1CQWA 4AKIA 3RYCA 1GCUA 4XQGA 3DV0B 4HLDA 3N70A 3WLRA 3ZBUA 3STUA 3WQRA 4I4TB 4EF5A 5T57A 4QLBA 1O6CA 4QBGB 5ICSA 4PU0A 4I4CA 4LX8A 4P22A 4WBNA 3TD6A 3EG5A 4ZODA 4QDJA 3DL2A 1U5BA 2WA1A 4RANA 2WJGA 1BWQA 1GU7A 2ZS9A 2Q3FA 3FSGD 5BSWA 1E0SA 4PZEA 2HK7A 5EINA 3GF4A 2ZUVA 2P9CA 4ZT3A 5CVCA 5BSUA 1KSJA 1E2FA 1WPXA 3P4UA 3L1HA 3KB2A 5SYAA 4MICA 3HSKA 5GVSA 5FWYA 3RC2A 1USWA 5ALUA 4Q1EA 4AN0A 1CUVA 2RHOA 4NPCA 4AJJA 4ZV7A 3IBSA 3T06B 1I01A 4I1UA 3E7DA 4IRXA 3DE2X 3OO0A 1OYOA 3VHXA 2BKEA 3DOFA 2REQB 1WMBA 4PQFA 2IV7A 1AE1A 4DILA 4EL0A 5IYZB 5A3RA 2VK1A 4MWDA 3AFGA 5CDYA 2K7ZA 4V0RA 2OVBA 1ACMA 5C35A 1P0QA 4E31A 1X1SA 1GILA 2CZCA 3FFAA 3MWJA 3TTWA 1VE7A 3ZGNA 4J0FA 1P3Y1 3AOGA 1ISJA 3EZLA 5IN5A 1FCJA 3RIYA 2YV3A 3OFND 1R0RE 2H4WA 2JHPA 3B5IA 2OD9A 3TTSA 1WBJB 4QLAA 4W9NA 2G9QA 4PWYA 5AVOA 1ZBDA 1JUDA 2BCGY 2P11A 1WDKA 4PCLA 5FIUA 3LX6A 2XTZA 3RS7A 3T1QA 1AQUA 1O03A 3NWPA 3LZCA 1ZCZA 3RHFA 5AKXA 3LCVB 5F7JA 1SUIA 3ZU4A 3PDHA 4M1SA 1POWA 3OD1A 1U9ZA 4Y2HA 1KDYA 3FOBA 2RGNC 5FADA 4AN1A 1I7QB 3IVXA 5CLJA 3QVOA 1H6BA 1TVMA 4Q1CA 4IXMA 4BNKA 1YGYA 2D59A 5CT5A 3T9BA 3FCUB 2O6HA 1R9NA 2OO7A 3H6KA 4BUCA 1A9OA 3ZWOA 1IWOA 4XAQA 5GJWC 5A3QA 1BMTA 4RFLA 1QRTA 2G1JA 1SQSA 4UOQA 5GZ6A 4D4LA 2K7FA 1GZ4A 3G0DA 5LP1A 3N2EA 3MTIA 4MWTA 5KWVA 2VJMA 2J46A 3VR0A 2XEXA 3CRVA 2NPIA 1P44A 3VR4A 4QATA 4JJ6A 2VRBA 2AMLA 3LVRE 3CIFA 5CT4A 4I50A 4L7VA 3ELWA 3MWGA 5IWAB 2BAGA 3U9TA 4ZT2A 3C3MA 2C97A 1S4MA 2FMHA 8ADHA 4W8HA 3UJNA 4EGCB 3VU8A 1GO2A 3G5UA 1G59A 3COJA 3F97A 1SVLA 4C07A 1SPBS 2VEDA 2EKBA 4O2AB 5ESDA 1YR3A 1D2MA 1QORA 2R00A 4IIEA 1VXOA 3OX3A 5I7VA 2IK8A 3DB2A 3ITDA 3DEHA 1UM9B 3ZLUA 4G1UC 4M8SA 2H11A 5I9IA 2LCQA 3S99A 3D3WA 1K68A 3ESRA 3PF9A 1SG9A 2A9VA 4ZQFA 1PJLA 4AICA 3FUVA 3SEFA 1YAJA 3ICCA 3NWBA 4TTAA 1E5XA 4FB5A 2XRFA 2VDVE 5ER6A 3MCUA 4M2LA 1EHYA 4CW7A 5A4FS 3UMYA 1XPUA 3I62A 1DP4A 4XWOA 1N25A 2PT6A 2BGJA 3OA2A 2EFDB 3C7TA 4OFXA 3RC7A 1M1YA 4NESA 3WB2A 4Q4HB 4N3GA 2Q9AA 4A5OA 3H9JA 2HFJA 2YWDA 3KIPA 1H2EA 4P36A 4GMDA 2OT3B 4ZCLA 4YHBA 2GM3A 5DGTA 1RKXA 3ZNQA 2JAUA 4BEBA 3ILSA 4MZDA 2BFFB 4AYWA 1NX6A 3GHHA 1YB4A 2IF0A 2ZSBA 5J9FA 1VMKA 2ZIUB 4F2DA 5HZKA 2YMPA 1D3AA 2FW1A 3OPYI 2XUDA 2RIRA 4YJ2F 3TM4A 3AR4A 3HYCA 4DDUA 4E15A 1SXPA 1V1RB 4M83A 2H4JA 2YN2A 5B3JA 1E32A 2PTHA 4IY1A 3R7WA 5IDYA 3TTUA 4LPSA 4C6SA 4DCPA 4HXEB 4GE0A 3S6JA 5JMTA 2UUPA 4NXNB 1DARA 2HC9A 3GRRA 3QTLA 1D2NA 1PBTA 4UZEA 3QXSA 5L4LA 2EZTA 2J0VA 3PC4A 1Q2UA 2XUPA 3GH3A 3D8NA 1XMXA 2WSSA 2Z6VA 3LP6A 2Y9MB 2WYWA 3OICA 4RIIA 4XEHA 2OYCA 2GEFA 5JCOC 3T52A 2AIRA 4CG1A 1DEHA 1G8MA 4EJSA 1BXRB 3S1SA 3LTNC 3C3BA 1A4IA 1PW7A 1J49A 3TW6A 3N8NA 4CG3A 1P75A 2C3OA 4EPVA 5TPWB 2F3RA 3TSCA 5H0IA 3WP1B 1LK0A 1D4ZA 1EM8B 1NSTA 1T8UA 2JAPA 3LBFA 2EWWA 1C7EA 3PUIA 4NZMA 5E9WA 2VQSA 4D26A 3E2MA 3IODA 3V3TA 3WB1A 1K89A 2WWWA 4JU9A 4Z53A 1U1GA 3P19A 4BQQA 1CB7A 4PNHA 3IAXA 1IZZA 5I4KA 3UOGA 5CD1A 4KNYA 1NQWA 4LJ9A 3OZRA 2CF6A 1Y1LA 1D09A 1ST2A 3CC8A 1EIWA 3VYRB 5F51A 2H57A 4CEJA 5FB3A 3L06A 4HYYA 5CEJA 3EH2A 1HMPA 1I33A 1MPXA 3H83A 1B8VA 2GO1A 2INGX 3V1UA 2HSEA 1Z0JA 1FP6A 1DAHA 2PGLA 2R2AA 4NE7A 5LLSA 1KPIA 3D7NA 2JGDA 3HFSA 2H2HA 5IAJA 4B43A 2FQQA 5EJ8A 2WSMA 1ZHHA 4GVLA 3FMPB 4MPDA 3BRQA 4QGSA 2OGTA 4UE3S 5ELLA 3RFCA 4RH0A 1Q1GA 1TJ3A 3OURA 4GQAA 1Y6JA 5CVTA 1BU5A 2DBYA 1Y1TA 5CIQA 2Z2XA 5CU7A 2A9JA 1HF3A 3G2PA 5ANRB 5KU1A 1R3DA 1R4ZA 2RAFA 4NBKA 2QQFA 5TVKA 4JUFA 2HJRA 1LK5A 5A0TA 2A9RA 1KI6B 3OFJA 3TNDA 4ZI7A 1FQJA 5CLQA 3B6ZA 1PNOA 1JB1A 3MYYA 4MPTA 3AU8A 5DV9A 5EHIA 2JFHA 4EUSA 3AVVA 2W8ZA 2WUVA 3GT7A 3H1PA 3MUNA 5J4KA 1CUHA 3IUSA 1EUYA 1SVUA 1DL5A 1LSSA 3K30A 1G8YA 5CNKA 2IDMA 4W4TA 4ZJPA 5EJGA 3DGFC 4D0RA 1VC2A 3L5OA 4ND7A 1QCYA 4N7BA 4AS3A 4RKYA 2NZXA 3GRYA 1A8UA 3O47A 3ZD7A 5FWXB 3U4QA 4K0RA 2ES4A 2JI4A 1YZFA 4JYCA 5JS2A 2HRZA 2JI6A 3TW8B 4BB6A 3UGKA 3B13B 5ITWA 4OL0A 5KEIA 1LNZA 5ABPA 4Y2YA 1Y4AE 1HE2A 2LR0A 2AFHE 2QIPA 2OY0A 3JU3A 3R5SA 1JMKC 4G0YA 5ERGB 5JADA 3JARB 5DMXA 4N5HX 1H6AA 1Z2NX 4XFKA 3WLLA 3SJZA 3Q8MA 3OCYA 4BV3A 1MEEA 2VYCA 1OX4A 3C0KA 4I5GA 1TUBB 3SD7A 1CU1A 3PHCA 3NTRA 5K3OA 1PG0A 1E1CB 4HX5A 4NFHA 2H16A 3T3EA 3GG2A 3KOXA 4B3BA 2A0UA 5CDUA 3SR0A 1XPJA 2DLDA 3J7TA 3L04A 1XU7A 2X9NA 1JFRA 1Q0RA 2QENA 1WKVA 1BE1A 1ZJYA 4NMHA 4R0VA 1H6DA 3BAFA 3ZQJA 1K9SA 4JK3A 3TOZA 2ZWVA 4ZP1A 3CRMA 4W1QA 5FWDA 3ZH9B 4M0DA 2IYXA 1FFAA 4HNVA 5IZ4A 1RIIA 3DH0A 3VOAA 3VOSA 2VTDA 3PUJA 1P6QA 4HX9A 1M1UA 2WQZA 2QK4A 3VNBA 1YR9A 3IKTA 4GLJA 4R2WA 1DUSA 4B2IA 4URVR 5I7WA 2W48A 1ULAA 1PR2A 4M55A 1CUSA 3HXPA 4B8WA 4NZ9A 4MDFA 4HAXA 1R6DA 1K0FA 1VB5A 2EBFX 3A4MA 7YASA 1EWKA 3UMVA 4DIFA 2GCIA 4FONA 1VIAA 2PUHA 3ON5A 4DEXA 4RZ3A 5BSGA 1ACLA 2O5CA 5E4YA 1NRWA 1XTZA 2C92A 2GYWA 1DWOA 2GCGA 3Q3HA 1QJCA 1DJOA 4YIKA 1OH5A 4X63A 4PQYA 5L6MB 1E79D 1U0SY 2XCUA 1FEZA 4JC4A 2XADA 4OXXA 1DBSA 4J9VA 4EPWA 4EEZA 5LQCA 1ZYUA 2ZS7A 3LUKA 2FHPA 3KT3A 1VFNA 1NIJA 4Z0NA 1Z83A 3N7AA 4WPGA 1OGJA 1RR6A 2G06A 1QC5B 2HT1A 4ZMSA 4A10A 5CA0A 1KAGA 4WZAE 4ZKDA 3PP8A 2IDZA 4QTTB 5FBKA 3V97A 1L4EA 2OBLA 4P8RA 5EGNA 3O7WA 1XELA 3OZFA 4U9IS 1IOVA 2XMRA 2WJIA 3E35A 4YB8A 2NO6A 1ISIA 2OKCA 1XRRA 2BR4A 4YXWD 5C7IO 3AF6A 2C4UA 1QTRA 3MD9A 3UJ7A 2C5EA 4TWBA 2FEPA 3RKUA 2YJ6A 1UM8A 4GMHA 1LLDA 3DO8A 2D5BA 3KWMA 1U2GC 3LK6A 1L5KA 2CK3A 3H0EA 3AEXA 1YD7A 3L7BA 4Q1VA 3FNIA 1XZHA 5FR1A 4C5AA 3KJGA 2AFIA 3AI2A 3W5UA 4FNOA 1GZ6A 1S5PA 1CP2A 1WB4A 3ESCA 3GRVA 3IVAA 4GYKA 4QYMA 3RUAA 4RD6A 2QTNA 4WDQA 4Z6KA 3SWWA 4BPBA 3DBHB 1NMYA 3OHPA 2BKAA 1T5LA 2BRUC 4JCCA 5AJYA 2FJPA 1QBGA 3TBFA 4KXQA 3VH2A 1K98A 1YA4A 2FG6C 1FB5A 2OENG 3KTOA 3BXHA 3SF8A 4Z51A 3C8HA 1BRTA 1DG9A 3N74A 4O63O 1GCOA 3PLAE 1BS2A 1CY2A 2ID9A 3EVFA 2JFYA 1UXGA 2CEAA 2B3DA 3D4LA 3Q7RA 4R9RA 1U1DA 2OFFA 2V6GA 4XTCS 3TGPA 1BGWA 5F7OA 1UKAA 4UMFA 1UC4B 1A5AB 1GLNA 1U94A 5B3KA 3GJ0A 3R8FA 2OCAA 2HWUA 1FXWF 3U7RA 4X1YB 1KZYC 3JQ7B 4NOLA 3HB4X 1T2AA 2W2QA 3CRQA 2CXSA 3FZEA 2JJMA 2XB2A 1XPRA 1NAHA 2K87A 3ND6A 1FJGB 1U0TA 3C8DA 1Z33A 2JJ1D 3LAWA 4JLMA 4DC9A 2C59A 2XKBA 5AI4A 1XT6A 1X13A 3HC7A 4PSCA 2HO4A 1ZOOA 4WZAB 5HM8A 4MQ6A 3A3NA 4JXJA 4GOOD 2CLHB 4MUGA 1CRQA 2HLDD 4UUAA 1YWGO 4DLYA 1MEJA 3E9YA 2FSIA 3JPYA 2BFOA 2NO9A 4PGGA 4BBPA 3HB9A 4HMPA 3U0BA 1ODIA 1QXSA 4KAFA 4FSDA 1TEXA 4BL5A 3T9FA 4BZQA 2ZPAA 3WNBA 1DKRA 3ZD9A 1P5JA 5AW7A 2BCEA 5JRZA 1H22A 2FN9A 4ZJYA 1SUFA 4CL2A 3ET4A 3VV2A 4FMCB 5ECGC 3VR2A 3LX8A 3ZKWB 5JASA 1RYEA 5CGQB 2QZJA 1WBDA 3KVRA 4TWIA 4HO1X 1NKVA 1PI3A 2Z2IA 3HSYA 2YMQA 1N5LA 3EB9A 1GTZA 3KQPA 4MMZB 4TS1A 3DE7X 3NQ41 4OHCA 1WBBA 3HDYA 4N6NA 4UDNA 4JLUA 3RUPA 3W7BA 1HOTA 1ZVKA 4YAOA 1TYBE 4PY2A 1IFXA 3KSZO 4BPRA 5F78A 1I6LA 1RWPA 3BZBA 1SR8A 2YVAA 1CK4A 2FPOA 4NBTA 1D6NA 1HORA 3DV0A 4GWKA 4DUGD 2LRHA 3QEJA 2DUMA 4I4TA 4LV8B 2BZGA 4JP1A 1IXRC 3LTEA 1QRSA 3E6AA 5EN4A 1EFRD 4RUKA 4D46A 2IEAA 3P27A 1QB7A 3HLYA 4URUR 4NCHA 5EIXA 1RWMA 1LTKA 2HA5A 3SG0A 1RLIA 3FYDA 5DCUA 3GELA 5HBRA 4DCSA 1CUFA 1KYIA 1E69A 2Q3MA 4CDMA 4JXZA 4D25A 4NMWA 2CKMA 2WHXA 3TSYA 2N1BA 5A7HA 2IUUA 1E9DA 4LVOA 1E2MA 3TIVA 5E6RB 6Q21A 3QUCA 5J2UF 1WPQA 4R6WA 2XQKA 4D3FA 2GZ3A 4QUGA 5FL7D 3MF4A 1VJDA 3NX4A 3PEEA 4R2KA 3P2JA 2UYOA 2NO5A 1OLSA 4BVJA 1UP4A 1KI7A 2DSNA 2VJNA 3LRTA 2DLCX 1XKLA 2FSFA 2OESA 2REQA 4KQMA 4D9NA 2R1ZA 1PT9A 2MR6A 5KVQA 1T4CB 1EUDB 4CLOA 2DBQA 4ENUA 1DRWA 1L5YA 1V25A 1AF7A 1NVFA 1XR3A 2IP2A 3URMA 3GAMA 3B12A 3O9VA 1S1MA 4IG4A 4QU5A 3W5SA 1NUTA 3PX7A 1FUUA 4EW6A 4MH0R 1GCIA 5B6IA 1LDEA 1G6KA 4HYEA 4IHJA 3ZC3A 3FDJA 2MSEB 3IMKA 3KLNA 4ENVA 2PT7A 1W2GA 1KJZA 2QX6A 2ZI7A 5FNZA 3NBMA 4PINA 5DXFA 4XR9A 5IJ9A 1E9EA 1VIVA 2NQ8A 4LCEA 2HUNA 1RHUA 1PRYA 4S2UA 4DIKA 2XKKA 3KQOA 1XVLA 2G72A 4NAUA 4CFYA 1E6UA 3K72B 3SHVA 1VJGA 4AKTA 5K8JB 2V3VA 2SBTA 3V1KA 3MQ2A 3R0XA 3KBOA 1YUNA 4LWZA 1N7IA 4MCAA 4ZMBA 1XDDA 3IHWA 2IZOA 2CVOA 5TMDA 2BY4A 1A5BB 3WLJA 3PBKA 3K8YA 4RBNA 3M5PA 1V37A 3UZUA 4TSRA 4X6XA 4NBUA 4RTSA 4HXFB 2ABWA 2AOUB 4JFAA 4MLDA 4XJVA 4B3GA 3N2ZB 4I5DA 2C4VA 1J5XA 4P84A 3UB2A 4HNQA 3MHTA 3FYSA 2UV8A 2HBRA 2YVKA 3HH8A 3IJEB 4JQYA 3PNVA 2A57A 2VAPA 4ZV9A 5B2EA 3ORFA 1T9CA 2VCYA 4GYYA 1CJKC 1PTJC 2VP2A 4MS3B 4YRJA 3B1ZA 1RD4A 1ARZA 4HTFB 2QM3A 5K0FA 5KINB 4BFCA 4JSRA 4H4DA 1KYQA 1L4NA 3V6LA 5M7EA 2ZB3A 3QM1A 3P9PA 4ZVOA 1C0PA 3RAEC 1KMNA 3O4HA 3PNMA 4O2AA 3TDNA 2H9YA 3PXDA 4A23A 5A4IS 1YJ5A 2R4QA 4C88A 3HBNA 2XZPA 3P8ZA 4Y98A 3REOA 2ZCVA 4BQPA 5JECA 5BR4A 3KCNA 1V43A 1T0BA 2DP4E 2PZMA 2VBFA 3AERB 2X0NA 4JBIA 1SBNE 4UBNA 4IFTA 2YJ3A 4Q3DA 3IAHA 5L3SB 4KR2A 1NQOA 1PP4A 4HN2A 3RARA 1D7AA 4XIJA 3PVZA 3TQTA 4HVLA 1URPA 2YZMA 2AX3A 3DWFA 3DDZX 3L4BA 5IVIA 3TE7A 3VTAA 3L6RA 5CCBA 2JGNA 3QUQA 4B32A 1XJ5A 2DERA 4CKBB 2Y1CA 4WNYA 1ECFA 5COQA 2R85A 3VVBA 1R6BX 3EW7A 3V4SA 4HS9A 4HDKB 4Q4HA 3URKA 2CSUA 2VUSA 2BTOA 3F98A 3GH1A 4BVBA 5L4NA 4S04A 4G4SO 3EEOA 1TM5E 2BEUB 3K6RA 1SHTX 3OPMA 4IJ6A 4U2GA 5FOWA 1RLJA 1SK8A 4WOKA 4UEOA 2ZRKA 1ZHFA 4WBSA 3OE5A 3RU7A 5BURA 3OSUA 1FPQA 1NBEA 2BFFA 1UBLS 5CT6A 2HIMA 1ORHA 1GYRA 1Q0QA 4WOPA 1EE9A 3IEMA 2J6CA 4EPRA 3HWSA 3SR3A 4WJZA 2VQEB 1E9VA 3FNGA 3QUAA 1V1RA 2LIVA 1RI1A 4YRTA 1AGNA 1XZGA 4PAOA 1NNSA 2Q5OA 2QV0A 3WY9A 4G09A 1TYEB 3B9BA 1TIKA 1TYDE 4IUDS 4RTNA 3QNUA 4M0EA 5LBIA 2ZUDA 1WXQA 2P67A 1QHEA 2EATA 4UJ3A 1VA5A 1SVOA 1Z0DA 4YPVA 2HREA 3EFBA 3GNTA 3VVMA 4DTIA 3KQLA 2HRDA 2ISQA 1FZQA 3HXOA 1NJSA 5E9QA 3ROTA 1G2QA 4DLVA 4CEIA 2DH5A 2WU0A 1TCUA 3IMGA 1IDN1 3OEEA 4H7JA 1MMFB 5FBWB 5BNIA 2IZZA 4WNAB 4UFPA 2HADA 4BGDA 3TLBA 4KXNA 2FGKA 4JLSA 1IBLB 4ZKEA 2UZAA 5TPWA 1SBIA 4ESOA 1EM8A 3NWEA 4OQYA 4BRSA 1PNQA 2ZIAA 2QYSA 1A8PA 5KPJA 5GJBA 1KZ9A 4YNBA 1F4LA 2NVWA 1K75A 4FC7A 4DA7A 1CY7A 2EFHB 4YY3B 2HSGA 4N1AA 2DFTA 4G3XA 2AS0A 1OIVA 4BMCA 1G4AE 1P9OA 2W2MA 3K9BA 2Z43A 3CSSA 3DHVA 1EINA 1SM4A 1Y3CE 5AK6A 3Q2KA 5CH8A 1Z47A 4ZDIA 5HR5A 1KOGA 2R60A 4PZYA 1PR5A 3FPSA 3PDCA 5JOQA 1MRSA 4X6LA 1LPMA 2B8NA 1Y37A 4YAKA 4HB3A 4R8KA 4AO6A 4ESVA 3HUFA 2FOLA 5AM0A 1AZLA 4LUCA 1RVDA 1SRRA 2FUCA 4LOJA 4FQ7A 3S40A 3KB6A 2CDRA 5GONF 3P0RA 3WYCA 4XM2A 3O8NA 1TLLA 5ELXA 3BREA 3AY0A 4YS6A 3WICA 4BVGA 1FNBA 1UT6A 2C29D 3C3WA 1DWPA 4FOPA 4ZN6A 4PW0A 1WU7A 1NYQA 1T8RA 2VZEA 2XB8A 1NURA 4FPXA 5JAZA 1A9YA 4MKZA 4WBNF 4DDKA 1T4GA 1KPHA 5ADVA 3RRMA 1FQWA 2QPAA 5ALVA 1ZSNA 2EZ4A 5F52A 1KQGA 4CI9A 3RRFA 1IBSA 1H0SA 1KHTA 1Q1QA 3ITNA 3K4QA 1ADJA 2EKDA 2O07A 3MBKA 4LSMA 2CVHA 5AESA 7ADHA 3PJRA 2IYRA 4P0TA 1W36B 1KI6A 4RK5A 4B8YA 5SY9A 5KDOA 1NG1A 5L7YA 4HDCA 1PZEA 1KTVA 3MTQA 3RFTA 3X1KA 5JS6A 2DTEA 3GA5A 5K51A 4B3RB 3EARA 2I2DA 1QG2A 1FFYA 4U7TB 2FSPA 1VYTA 4BQSA 5IC4A 4CKXA 1GDDA 3QUTA 1XWFA 3MTDA 5EG5A 4G8JA 1N2IA 5FWXA 3FSJX 3OLVA 1XZKA 5JZVA 3T3NA 1REQB 1ZVJA 3PQ2A 4HGPA 1YZKA 4RKWA 3EBOA 3WK6A 3TW8A 4ENPA 3SLKA 2FSVC 3KLMX 2OO5A 1N5RA 3JARA 5BWOA 4EIWA 4CI0B 4XWWA 1A1SA 1NF9A 1B8NA 5DCYA 3ZHBA 2Y6VA 1E7QA 1TUBA 2XAAA 5KTNA 3B6MA 1Z0KA 3UAWA 4MDHA 1UZMA 2WTAA 1KJ9A 4NU5A 1E1CA 2GKGA 3LQ2A 1WB9A 2HT6A 1AA9A 2QU8A 1T29A 4Y2QA 1FSFA 5B4TA 1R0CA 3TGLA 1NF2A 4CHGA 2YJ5A 2GM9A 3AHGA 3HZRA 4KMOA 4CPDA 4I36A 3BMOB 3SHFA 1KY5A 2DE0X 5ICGA 5K01A 2ZREA 4B9EA 3K5PA 4AMBA 2FLWA 1T25A 3FA2A 4L7QA 3JWJA 2E0IA 2VNJA 3PCTA 3IQHX 5F21A 3ZHZA 3MFYA 3RIHA 3TWOA 3PHHA 3VKFA 2CFIA 1YBHA 1TQDA 4WNIA 2VS1A 3OMXA 4L85A 2XYGA 2C7RA 4K0KB 2FDXA 2C2OA 3PNPA 1WL8A 1NI4B 3BWYA 3WBKA 4ZAGA 2ZQ5A 3HA3A 4HBZA 4EG5A 1ZAYA 4ZZ2A 2VF4X 2PUGA 3AB7A 3VKWA 2P6OA 1VJCA 3AUJB 1G17A 2G3YA 3R74A 4F11A 1SCUB 1TT5B 4EYOA 4I50F 2PRYA 221PA 3KZCA 4HATA 3ETCA 3ADBA 2CWWA 3PSHA 2BI8A 1RLOA 3RU3A 1RADA 3L7OA 4KVAA 3AUTA 1X1RA 2AKYA 3EA5A 3B2NA 2FRXA 2IJGX 2YYYA 1T3TA 3RWOA 1C4WA 5I7UA 1CTQA 1Z0FA 2X77A 3CQ9A 4JWKA 3ZI7A 3KT8A 4D57A 2G77B 5AHKA 1PHPA 3V1NA 2ZSJA 4JOQA 2P79A 2PX4A 2JCSA 3UCFA 3RBAA 1UWVA 1W52X 1ZGJA 3GFBA 1O5IA 3R40A 1TCVA 4YAUA 1RPNA 1ZEMA 1TTHA 2QJOA 3NJRA 4L9WA 3GPBA 4MEJA 1JHUA 3PQ6A 4TKLA 3WISA 3ZDCA 2AFHA 2FNAA 2COEA 4B46A 1NR7A 3FAZA 1OU0A 5EUMA 5JCZA 3WAGA 1V39A 2OQRA 5B7QA 2UVQA 4UDYX 3FN4A 2LWIA 1QQ6A 2ILTA 2PV0A 2W4QA 2WVJA 1MF7A 3WC4A 1C1XB 4B35A 2JHGA 3HCFA 3JQGA 3MSXA 3UAZA 4BNUA 5A62A 1C50A 2C2BA 5ADUS 3W5JA 5K2OA 2C61A 1IN1A 3PA8A 3EG9B 1KK1A 5FPYA 2GLTA 3CH4B 3ER6A 4DIOA 4MHTA 3TZ6A 1O87A 1QH9A 1OC4A 3O94A 3UBMA 1JQAA 1MC4A 1DRJA 2QDXA 2ZEJA 3IBTA 2HNKA 1I4LD 4EF6A 1VDZA 5ED4A 1EUQA 1ULBA 1V3UA 4G0WA 5EJ9A 3DVSX 1SCJA 3I9MA 3WP0A 4BECA 5L53A 1JU4A 4ATNA 1RRKA 4G0NA 1EFAA 1FMLA 5LQRA 4RMHA 4AJNA 4KQWA 4YO8A 2H7VA 2N75A 3N2KA 4P92A 5JAIA 2G09A 2PS1A 3IAEA 3WGNA 3HB5X 3BSSA 4Q7EA 2O7VA 2ZSUA 2ANCA 4BZXA 5B55A 4PBSA 2OAGA 5F9MA 2DT8A 2W6CX 3UY4A 1P0FA 1BA3A 2XA9A 1ZQ1A 3PXXA 4N18A 4HXGA 4EVRA 1HL3A 1A69A 2A9FA 3WLMA 5CDFE 3RAFC 2Z6UA 4UOZA 4EJ2A 3KTFA 4HDNB 3EAGA 5FPSA 4EQ6B 3FZQA 1RYDA 1FQKA 3KRTA 5E3IA 1QPZA 3C3EA 2GZRA 4LDPA 2XSZD 2FK8A 4K6OA 5JZSA 1XFDA 1UT5A 1S2LA 4X1YA 1P61B 3JQ7A 4D56A 1RQRA 2RBEA 3G3EA 1FFBA 3EDCA 3FDZB 3A32A 4G0PA 3QEOA 4DMHA 1RKBA 1J90A 2YBDA 2R6GA 1G8AA 2QRZA 3AEQA 3KHUA 1HUQA 3K1TA 3LG2A 3MQFA 3HY6A 4WZAA 1KWKA 2XRYA 4UHBA 3M4ZA 5TE9A 1LJUA 3ZJVA 4Q47A 5HFAA 2WRZA 5NLLA 1PZGA 1IHDA 2I5PO 2QAGA 2V58A 3VR3D 2NLOA 1E2LA 4MQMA 1MVNA 1A96A 2WILA 1GR0A 3I04M 2PU5A 3JCZA 4TVBA 4YP1A 2JRCA 2IXBA 4ZQHA 4ZARA 2AR0A 3LM8A 3L7JA 5AVJA 2CFRA 4TTSA 3S29A 3UQYS 3U7QA 2PO7A 1RMQA 4V0KA 5P21A 5JD6A 2JFOA 2UZ1B 2VDNB 1XDZA 3PDUA 2RB5A 1WMSA 4OQDA 2MSKA 4U6SA 3TIFA 3DKRA 1DC7A 1SZPA 2J3DA 2X14A 1WCYA 1OWMA 1YFKA 4Z8YA 3EPKA 1WKCA 4LRSB 1NXTA 3QU4A 3ZR4B 2PGNA 2FHSA 2DWQA 4O29A 2JG3A 1C30B 4XB1A 1JDBB 4ZRDA 4GEGA 4KUEA 5PGMA 3VU0A 4WN9B 2FEWB 4ZGBA 3U4DA 2D1YA 3OIVA 1CNFA 3FDIA 3DMRA 3WTCA 1JHPA 2WWFA 2XHZA 2OYRA 3HBLA 3D6VA 2IHTA 3QNMA 4YVFA 2WM9B 4DC0A 5CXUA 1VKHA 2AEMA 1X1QA 2AE1A 2HB6A 4DBZA 2PUEA 1L4LA 4NI5A 1H94A 1F8GA 1FYFA 1VOTA 2P9YA 1Z5PA 2PKEA 4NVRA 4QEZA 3SYNA 4CM4B 4YP5A 4ZVKA 3LLSA 2X76A 1NOJA 3H4VA 2I3AA 3ZHUA 1NG9A 2FPIB 1XRLA 3JYQA 1JDJA 4EMUA 2HR1A 1ZL0A 3E84A 4YV1A 3IT0A 5IABA 3A6ZA 3AGQA 3VZRA 4E7OA 1S89A 4OHFA 1ZM2A 1G19A 3WYFA 4ZYZA 1QZTA 1N8KA 4YRPA 1IG3A 1QH1B 2PL1A 1U9IC 2P0AA 3QE0A 1T4CA 4REQB 4WKOA 3ZOZA 1ACJA 1JE1A 3PQ7A 5EUBA 3NTLA 3FLBA 1JYFA 1QLHA 2XB4A 4FYYA 1XMQB 4P4GA 1VSBA 2ZTVA 4HYQA 4JUCA 2B36A 3AFMA 3IVRA 2NZWA 3RSSA 4OVKA 4B45A 2V6JA 5TX7A 4QRHA 2PWYA 3O3NB 3AU9A 5DLPA 1SKMA 2LNDA 3IXMA 3RABA 2BGRA 5EP2A 2BF7A 4BV8A 5A1TA 4GS5A 2G5GX 4XD7D 2DEUA 2ZYUX 4JS0A 1NLFA 5B3AA 4EX6A 1XK6A 1K88A 1U9CA 1HNXB 2ZM5A 4WMLA 4N4AA 1CR4A 2FFRA 1YRLA 3FRJA 3RI3A 5JDCA 1A82A 4TMTA 2ZTHA 2Q46A 1DOHA 1XYYA 3G9QA 1JKIA 2I2WA 1FX1A 2YHAA 3L0ZA 3HLKA 2IYQA 5K3BA 4FZ3A 1Q22A 4DDMA 4JSYA 1TUEA 3GQBB 3HHPA 2EBWA 5JVDA 3GT0A 4A26A 2QJTA 1S3FA 1E9CA 1V96A 4I46A 5K9ZA 3UTCA 4HZIA 1E6LA 2FMUA 4RWZA 3TZKA 4LMRA 5JD4A 4EUHA 5DTQA 3A31A 4HC4A 4JOCA 2I0FA 2PUBA 2AOUA 1XD9A 4RLFA 4US0R 4JT2A 4L08A 3AEUB 4EFKA 2RKOA 3U31A 4EB8A 5SYMA 4D45A 1I3KA 1ITZA 1GQSA 1PT6A 3ADOA 4BO6A 4YCCA 1CQPA 5BR7A 1YQTA 2WF8A 3E2PA 1NU6A 2WUEA 1LDNA 2X1HA 4MS3A 3UAXA 4EG3A 2AG5A 3OPXA 3QPUA 4RHYA 4Y9TA 3SBOA 3T7TA 2PZKA 2CT8A 2O1EA 1R6TA 1XRMA 1T6ZA 2C9ZA 2NT3A 1ZZGA 4UUMA 3WLEA 421PA 3B38A 1JN0A 5LNK6 3BWMA 3FFWA 1IN6A 2R11A 4POOA 5CA0F 1RACA 4HV4A 2VHEA 3DTNA 1UAYA 3AHDA 5AVKA 2FCRA 4R4JA 4NV0A 4QVKA 2HI0A 2UZIR 3H2JA 5FP0A 3AERA 4KGXA 1ZH4A 2Z95A 4TS4A 3W9YA 1PJ3A 4N12A 4HAUA 4PZZA 3X3HA 4ND4A 5L3SA 1SKYB 2PL5A 2QHXA 3CBGA 1WJGA 4M9QA 3OTHA 4MV3A 3DDNA 3H13A 1VKNA 4LV5B 3V55A 2X13A 5FTLA 2JGAA 2GUWA 1KK2A 5D3KA 5IJWA 4M1EA 2BMDA 4DWVA 3RK1A 3TX2A 5BWNA 1EGQA 1XCOA 5K8LA 1ZUNB 4HDKA 3N59A 3CHYA 3DDHA 2I1LA 1DXQA 3AB3A 1MO6A 1TKAA 5HWSA 5HK8A 1T26A 5AK3A 3BH7A 4PC6A 4Y2RA 3ZQ4A 4HAZA 1C9KA 3AM5A 3DBLB 4NARA 3HWWA 3EZYA 3O2QB 4JC8A 3VISA 3NATA 4S1WA 5JXWA 2HCBA 1QRUA 1DX4A 2KWIA 2QBYB 1QKKA 3BIOA 3V4OA 3LXXA 4G8DA 4L72A 1G7CA 3NRJA 3L6UA 3KM0A 3JR3A 3SSOA 3FCSB 2J9FB 4IDFA 4KQ9A 1GG9A 2F3TA 4XJXA 2IXFA 2OFXA 4DV1B 4L0QA 1NVUQ 3BFVA 4I4IA 4R2JA 4TRMA 3E7XA 1XZQA 1DHTA 1W6RA 3AFOA 4QQKA 3VKVA 2PUVA 3V9PA 5ALOA 3I4CA 1SB8A 4B1FA 3IPYA 1BCRB 5JD5A 1HE4A 1U0GA 1XEXB 2VP3A 1IBMB 1MB9A 1E1YA 3C7CB 4MQEB 3ESQA 4E5UA 3K2IA 1B0UA 5TARA 4S1TA 5GM2A 1NUAA 3DYVA 1Z4OA 1JQDA 2I6SA 2ACWA 2O5RA 1KGDA 4L5AA 3W8NA 4D9BA 3SS8A 5T8KC 4OG2A 2Z5FA 4JMPA 1V7PC 1KR2A 1XQVA 2I4LA 2ZETA 1W5SA 3MMSA 3PPVA 5GQSA 1SBQA 1EBUA 3SIPA 3TCNA 1U28A 2QUAA 2XA2A 3FTCA 4Y2XA 4UDOA 4I3GA 2QTWB 1Q7BA 4DPMA 5DHUA 4NU6A 2PKRA 3R5JA 1DU4A 3MCVA 2ZB4A 4M9UA 1ZIYA 3RYFA 1LRLA 2JFNA 2QE7D 4MP6A 1ZM7A 1TRKA 2E4ZA 3O83A 4L8LA 2F9FA 4DBLE 1S2IA 1VYUA 3GXOA 3M4NA 4LAFA 4G0VA 3NZEA 2L82A 4ZCTA 2WK1A 3BRCA 4FDTA 3CWCA 3ZDZB 2AI2A 1K7CA 3OFSA 3RTGA 1FFXB 2EARA 2C07A 5IVKA 3G59A 4L07A 1TGVA 3LQFA 2F8MA 4JD5A 4D98A 4LOKA 5H59A 3ZBPA 3LGSA 2KSQA 4DAEA 3BD9A 1B4DA 3F7MA 5ARDA 4Y6LA 3O0TA 2AQHA 4MQ4A 2C2YA 4Y30A 4I4TF 4OLFA 1DBPA 4IDGA 2C4KA 5CXSA 4PIPA 3E1GA 1WM1A 2HRQA 2JGFA 4ETNA 3FF1A 2ZJ1A 3CX3A 2Z2ZA 5IUJC 2AD5A 3ZLBA 3FYTA 1VHJA 3LRXA 4DE5A 2QVCA 1XCBA 2ZR0A 5LZ9A 1VRCA 1PGQA 3UK7A 4CCWA 1GD1O 5A02A 2HGSA 3TZHA 4DA8A 4L16A 1XKQA 2VJKA 2V7WA 4QG7A 2IHVA 1PQWA 4U2FA 2IH4A 3CUEF 3ZE2B 1TIBA 3ZQUA 2QRQA 2A1UB 2WMOB 4M0UA 1NBIA 1AXEA 4QUIA 1JBEA 2NSDA 3W3AD 1Z8HA 4ZAYA 4YDSA 1MGPA 1OTYA 4OHKA 4LFCB 3SJUA 3WNDA 2ORWA 5A04A 3ZH2A 4X24A 4RX1A 2WIGA 1NMXA 2ZDGA 3PGMA 4S1PA 4LF5B 1IY9A 4RF4A 2QX4A 4GRIA 4J2TA 3Q8LA 3L9XA 1QHXA 1REQA 1UBFA 1ZI9A 1II8B 4E5YA 5F3WB 4MDEA 1JXAA 4LQ4A 1L7AA 1LNQA 5D5QA 4KYUA 4AZVA 4ZEMA 1A8IA 3V4ZA 2WA2A 4EKDA 2Y0PA 3UBTA 1P80A 2GPJA 5JYCA 1UJ5A 1TW3A 3R7SA 3OKPA 1YH3A 3W06A 3ETEA 3NP7A 1NVVR 4RFSB 2I33A 2DZDA 1GAQA 4IHJF 4HAOA 4I6EA 2RHDA 4R05A 3V2HA 4Q3AA 1ZRNA 3F5MA 3WBJA 5LFAA 3DF7A 3CMCO 3C6YA 4WIAA 1JT2A 2P9FA 2WDZA 3FZNA 5GZ1A 3SCZA 5BUSA 2G8LA 3A7EA 2B0CA 1RDFA 1NVVQ 3D6AA 1R64A 4NJOA 4WK0B 5BN5B 1K2WA 4X0EA 3X1MA 5EFOA 1OI7A 3BMOA 1F3LA 2G4VA 4GP7A 2L69A 2NU6B 3K4PA 2O1SA 3KVOA 2WAYA 2PKCA 4OB8A 5JNVA 3UH0A 4LOLA 2Z9BA 3DXFA 3E9NA 2GK6A 3IDFA 1H2YA 4EI7A 1B6GA 3BTUA 4LHVA 3X44A 1MX9A 2O20A 2UYQA 4KMMA 3GBSA 4F3NA 4UHKA 2BFEB 3H7AA 1MV8A 3BRWD 3WTBA 1DAIA 2UVPA 4R8SA 4YACA 1P6UA 1WZCA 4WWHA 3H0KA 5CAEB 4DFDA 3B1KA 4GW3A 1T36A 3TGWA 4C4AA 1SCUA 3BQNB 3S8YA 1L5MA 2CDAA 1DOAA 3VAZA 4R8LA 2VDUE 4RQAA 1CZHA 2IBTA 5HILA 1Y1QA 4PSUA 2JIOA 3FH0A 5E1OA 2R1VB 3QVGB 3W9UA 4X20B 1W0JD 2QG9A 2D1SA 2SCUB 2Y1GA 3K8OE 4CCSA 1WETA 2LKCA 4TT3D 2IPNA 4B6JA 1VL1A 2XQJA 2BM1A 3I9V6 4O2AF 4F93B 2ZT6A 2ADFA 1DUVG 2EJVA 1A72A 2I2BA 2YOFA 3BMXA 7REQA 4FJ1A 4MCIA 2C2WA 2IEGA 2PKQP 3NPMA 4CN9A 1AO3A 4DL9A 1V48A 3Q7EA 2YY6A 3PGLA 4QXMA 3K3PA 3WLTA 4EFLA 1M2OA 4WLUA 3F7NA 1E2QA 3RCBA 1ZM9A 4KHPB 1IUPA 3P71T 1PJQA 2NO1A 3CZPA 4QREA 2ZUFA 1TK2A 1Q50A 4QFMA 3N8KA 2IV3A 4CQMA 1ZXXA 2P6RA 1C1XA 2FKNA 4RO0A 1H2AS 1KPGA 1TTQB 4BNDB 3WZLA 5C32A 3C3PA 2D5IA 1A77A 5BVHA 4F4UA 4I8DA 3I76A 5D6NA 3AJRA 3H9BA 4CJXA 3B3JA 5IG2A 1VGVA 4F04A 5K8UA 1XG5A 1NT2A 3UFXB 2AW3A 3GLHB 5KOIA 4JEHA 1GZSA 4TWAA 1H0HA 4GOMD 2LCFA 4PRKA 3FUWA 4WK6A 4N03A 3UV6A 1JDSA 1Q6YA 2V9PA 1LA2A 1STOA 4IJQA 2R8RA 4H7PA 3RRNA 4BNLA 4Q24A 1MJNA 4F9TA 2HEIA 3SVTA 1UAAA 1T1IA 3W4KA 2QRUA 1R2QA 5DLYA 2WIDA 4W9MC 4AT1A 4CKZA 2C8JA 5LQDA 5F4BA 3ZTWA 3L0YA 4FHZA 4HDNA 1BWSA 2CYAA 5J63A 4EQ6A 3LYAA 1Q1AA 4W8OA 1KA9H 3EISA 4WERA 4DMGA 1T4DA 1H4TA 4MS4A 1J4AA 5DRYA 2XRZA 1G20E 1Y3FE 2EWMA 1IIRA 3UKOA 3V8QA 3ZV4A 5FEUA 3IPCA 1L4MA 1XJWA 2XQVA 3MCWA 3VJMA 2RHCA 4AU1A 3O9ZA 4FZ5A 4LWPA 4GYJA 4QTXA 5JY6A 1UP7A 3O1HB 3FMFA 3OUZA 2N42A 2JJQA 4QBFA 5BPHA 3FDZA 2EP8A 2CFTA 2W8BA 1FYDA 5KYYA 5C3UA 2LE0A 2ZYVX 4I5FA 3CLHA 4QOEA 2P9QA 4D6XA 2CB0A 1O4VA 1KJQA 1MFZA 3UF0A 2IZ5A 3HLTA 3ZCSA 1LI7A 3PFNA 2VYFA 3R3JA 4TLBA 2ZR7A 2QLTA 2AG8A 3HNRA 2YV1A 3HEAA 2J3IA 1X8KA 2PMCA 1MNAA 1W4BA 2WP8J 3KB1A 4J16A 4N54A 3VPAA 2ZCJA 4DADA 1RFLA 1UZLA 4C14A 3E9ZA 4KB5A 4B3TB 1ZWKA 4ZQGA 2J0QA 1WEHA 2BGGA 3RVOA 1L7OA 3LC1O 4UAVA 1Y9ZA 3BJIC 2CHUA 3WG9A 1RC8A 4R01A 5DSTA 2FB9A 3SSAA 2VG8A 2WBLC 1MN6A 2JF0A 1JS1X 1T5BA 1PVVA 3OEWA 1CRWG 1U2DA 4FYVA 4B47A 1C7FA 2AOTB 4K1LA 2FPPB 4M9RA 2CLFB 1Q3KA 1CDDA 3AX6A 4GYWA 2CWDA 2ZBGA 4PLYA 4Y2JA 3UGJA 1C30A 4WN9A 3D0RA 1KWGA 5AOAA 2QM7A 2FSGA 3G5MA 1C1YA 3PXUA 5DHTA 1P3JA 5A9RA 1JG4A 2WU1A 4Z5XA 1NXXA 1HDGO 4U00A 3RBVA 3W5IA 3MK31 4E70A 2BJWA 2Z5GA 3IPLA 4RK7A 3WKDA 5GADl 1FDIA 4D4JA 4YMUA 2B7CA 3ZHCA 1QR2A 3VSBA 3B1YA 3I34X 4UHDA 4DWOA 4YQZA 4AZ0B 1BHJA 1NBMD 2W4MA 1YJ8A 2Q0QA 2FPIA 2GAFA 1Y7IA 2LZ0A 1M74A 3E82A 4JB2A 2PANA 4F3TA 1O96A 1WDMA 3PC8C 1CYDA 3PTLA 3LWBA 4JODA 4WEOA 2ATEA 3N05A 4MA0A 3UWSA 8MHTA 2EJUA 2R6ZA 3JQEA 4PLVA 3VNUA 5KTPA 2BJVA 1QH1A 4IDNA 5CDHA 5FQOA 2XDQB 5CX4A 1IOWA 1SIBE 2QRHA 4REQA 3PXEA 1IXSB 3DTVD 3FRHA 2W2KB 1J8FA 3UKDA 3NYRA 5TMPA 4N0PA 3GLKA 3JW8A 1UOOA 5EIBD 4IIXA 2H8KA 2FUNB 1SA0A 3S1LA 4J6EA 2Y4OA 3EH1A 2VOJA 1V1MB 3JRXA 4DUZB 5HDQA 5SICE 1XL1A 3BDIA 3RK4A 4PAGA 4TWZA 3DT9A 1D4AA 3M1YA 1P4JA 3QMVA 4KZPA 4UZSA 3BWDD 2X0KA 4J43A 3QKSB 4MGZR 3T35A 3TBKA 2H5LA 2R44A 3IP3A 4C20A 3ZUPA 4BAUA 2HY7A 4EITA 4MGKR 3MTAA 6LDHA 4JITA 4I9HA 3WIOA 1KEWA 1BD3A 3NJ4A 4LSZA 1ZISA 2NQ2C 1CRLA 4ND1A 2QW8A 5EMLA 1V5FA 1HRDA 4KXLA 4B17A 3QP9A 3FWNA 2G5PA 1GNRA 1GL9B 1XB2A 1XZ8A 2HHAA 3H9EO 3N9IA 4QA9A 4OXNA 3SQDA 2YV4A 4YO7A 5ICMA 4BFSA 3T3OA 2QZZA 3EGWA 1PX2A 2OLKA 4I2NA 1UJ2A 3HP1A 3O4JA 2PZEA 3OQ1A 1NP3A 4ZGWA 5F2KA 2PKQO 3I8XA 1G9SA 2PMDA 5JO0A 4KO3S 2H08A 4MGIR 4GM4A 3VI3B 2X3UA 3W4IA 1ECPA 3I3OA 1LPAB 2J0UB 1JLRA 3A3OA 4CG0A 1OT5A 5IAOA 1EJ6A 5FA5A 4QASA 1RAFA 4PF1A 5CMLA 3I4LA 2PGXA 2BGUA 2G9VA 2K2QB 5AKHA 4CIAA 2FN4A 1JG3A 4JIGA 3E5MA 1PJBA 3HI4A 4K6CA 3HFRA 5IJ0B 2B4AA 4PGFA 3QIAA 1A9XA 4RPGA 4YWJA 1XD2B 4X95A 4HEA1 2Y99A 1L5NA 2IPAB 4EJ6A 1ZINA 5HFJA 4AG3A 4ETIA 1YNOA 1DKPA 4AP5A 2PE5A 2MU1A 3V34A 3ZWBA 1BVYF 5DHPA 2CMHA 2IS2A 4BQNA 1ESEA 5E4FA 2Y6UA 4AYTA 1RWVA 2G07A 3GRCA 1M6EX 1TIPA 4BNNA 4BVHA 2E1RA 3FLEA 1JWLA 1I0ZA 3O93A 2RGEA 3KUCA 3NDBB 1AG9A 1YA6A 4HFMA 1N34B 1KORA 3IUEA 3CXUA 5TF4A 1CUZA 1HYBA 3PEFA 4DSUA 4R98A 2E3JA 1NAIA 1TZBA 2Q3CA 2VBGA 4LOIA 3ZKAA 2VJOA 1LBSA 1RAEA 1GNVA 2K6GA 3CINA 5T6BA 1FP7A 3M5WA 4UQLA 1W4LA 3LA8A 1AKMA 1IVNA 1N3LA 3RVSA 3GROA 1GYQA 2P2NA 3DBLA 3R5XA 4HPJB 1IXKA 5EXEA 1FU7A 1U04A 4GWLA 5BORA 1RP1A 2QBYA 2AXQA 2KPOA 1JSRA 2Q7XA 1DC5A 4Z3OA 2NNWB 4MZXA 2ACKA 2J9FA 4BTVA 1U4SA 2OK7A 1VPEA 1NVGA 3TK1A 3VVCA 5B1EA 4KO2S 4DIEA 1YRHA 2HNAA 4XM1A 1YE8A 1B2RA 2RMKA 1Z5GA 4HK4A 1PVOA 4FEAA 1N0WA 1HLPA 2QRLA 2SICE 2VWPA 4G0MA 1R74A 1TJ5A 1JMYA 3TKAA 3VOBA 3ORQA 1Q14A 5ITSA 4URZR 1BCRA 5EMMA 4N41A 3DE6X 3IDQA 3WNCA 1XEXA 1U0RA 2V6FA 4PTYA 4G0QA 5IVDA 1L7EA 2BZ0A 2W2LA 4GOLD 3NM5A 4A0GA 4L6CA 2YHIB 3COYA 3EDOA 3PFCA 1KEPA 5BO5A 4AF6A 2IU6A 2AE2A 3C6XA 4Y7DA 5DK4A 5F5LA 2P40A 1XVVA 1PD0A 2P69A 4TTJA 4MROA 1UK8A 5KYKA 2VDMB 3FTFA 2Q3JA 3GZTB 2AZ4A 4DLLA 2MYUA 1YZLA 2P30A 3LKBA 4XCVA 3KZXA 4LF6B 4R68A 1LBHA 2BBTA 2DPXA 4OM8A 5SZJA 4A0SA 1NV8A 1PJTA 3HBMA 5KKAA 1PFWA 2OV1A 4NJMB 1Z26A 3ODPA 5ECYA 2J4DA 3PU6A 4H3HB 3BMQA 5EIBC 2FWPA 1CUEA 4FMCF 5DDIP 3WGOA 4BZPA 1DCTA 4RPIA 4LF7B 3QF7A 3GYBA 2VDQB 3USZA 5LPNA 2YKGA 1T5HX 5EKUA 4D8XA 2PBZA 2W6JD 5JSQA 3A28A 1IN7A 1YL7A 4MS1A 3F78A 5DNVA 4I1PA 3AZOA 1EXWA 3CNBA 4KLNA 3TEJA 2QSJA 3UT5B 1SEPA 3KHSA 4PC1A 2X4LA 1VA4A 3O4FA 2C0PA 3L49A 3T9DA 1B73A 4UTVA 4K9QA 3HCBA 2RB4A 5CVEA 5LDGA 1W2HA 5TR9A 3X1YA 1C0KA 2QUBA 2OWDA 3M6MD 2IEYA 2C3UA 1G2PA 4P82A 3SXJA 2YY5A 4NP6A 3FMIA 1A5ZA 3DKPA 3DOJA 1ADYA 2QNIA 2UZ3A 1IK4A 3K0FB 3KU4A 3OZBA 1JIXA 2Y1WA 2CE7A 5E1MA 1Z4LA 4HNHA 2PU7A 2XUZA 2TSYB 1U31A 5AKZA 5H80A 3S1AB 1N6LA 4J90A 5TS3A 4P2BA 3A4TA 3H75A 4KDEA 1JAXA 2I4MA 3INGA 4NNJA 4RZQA 4DMUB 2QTTA 3C16C 4X8MA 2WDPA 4ND5A 1Z4PX 1OTHA 2COUA 4BBJA 1ECJA 3IILA 1Y4DE 5THQA 2VSQA 2A1UA 5K05A 2H18A 2FRDC 5ICCA 2CV1A 1ESNA 1M5UA 1QX3A 5L3QA 3WLKX 1PNVA 1L3BA 3IB3A 5AKYA 5HRCA 3C6KA 1G5RA 1XA0A 1VJRA 4JCOA 3ZZUA 4A9AA 2WQ7A 1CJVC 1JEAA 1A9RA 2W7TA 3LC0A 5REQB 1KSGA 3T7AA 5LD2C 3E9QA 1W88B 4K9DA 4JBGA 2ZTSA 3WJ7A 1THZA 1II8A 1QX4A 5LDHA 1P17A 1QFYA 3CEJA 4BNVA 4J0GA 1RPTA 4MI3A 5DNWA 4QAJA 3I2GA 2CD9A 4BGUA 3TL6A 4WEQA 2NYAA 4PCUA 4ZOCA 1VCIA 3K1AB 4Y6RA 4JIMA 3EPJA 1RCTE 1L5OA 2TS1A 2BHSA 4RFSA 1PJAA 3FR7A 4LXUA 4DIDA 2Y77A 4UXHA 2BP7B 4IDEA 1Y9JA 5C9ZA 2A7XA 2P2SA 2H1IA 3OETA 5KJFA 1I2BA 4RYLA 3AUAA 2YINC 3A4LA 4JGGA 4R9VA 5BN5A 5KTTA 1QG6A 3ROKA 4ZEVA 5DX0A 1D2CA 1YDFA 4RPJA 3HCDA 3I8SA 5E3JA 1JFFA 4RGBA 2WZCA 2NU6A 3BHIA 1ADCA 3D7SA 1N8TA 4J4BA 5HBGA 3I61A 1U8FO 2C2XA 3CZ9A 4DV0B 1NKSA 1NQ5A 3AUUA 3DE5X 4LHZA 4QGHA 3F67A 5JVDF 5EHGA 2DBZA 3N0XA 3D2CA 3FVQA 4L4SA 1YQ9A 3INNA 1VCOA 4H60A 4EF4A 3H1GA 4F3KA 4P7BA 2HLNA 1R0ZA 1J42A 1XALA 2Q2OA 1Y1KE 3VQTA 3NXSA 3NASA 3DBIA 1ILEA 4F4DA 1J0CA 1GNLA 3PD1A 1I2ZA 4DLUA 4JLBA 4XPIB 5CAEA 1O9BA 4CIWA 1F6BA 4PGHA 5JNLA 4TYNA 3C1AA 1SBYA 3G2MA 4PSAA 3NT2A 4KGDA 4BQRA 1YHYA 4V3BA 3SVLA 1PNRA 1YS9A 1AKUA 4YAFA 2PY6A 4OQXA 4G4JA 3TNYA 3TG8A 2XCRB 5CFZA 5ILQA 3KJNA 2R1VA 4JDPA 4X20A 4N7RA 4P0QB 3HUDA 5FOQA 2EZUA 1HA3A 4B6QA 2EJBA 4BKUA 5JNUA 1KP9A 3H17A 3A3YA 1X7ZB 4EARA 2D7CA 3JQAA 4UE2A 1TYZA 1N4AA 2ZRBA 3ASZA 2EKZA 4ND6A 1R15A 4AJHA 3KVYA 3W5VA 2VCEA 3K5HA 5DNYB 4TTQA 5KU7A 3FPAA 3PDJA 1NBOA 1N2CB 1WQ1R 5ETJA 2HFKA 3UC9A 1P72A 2QRMA 1I9CA 3CJRA 4RHCA 4F3RA 4GG1A 4BNIA 3RDPA 3GRAA 2RKBA 4OI2A 1GY8A 4R9NA 3DC7A 2VTVA 3AESB 3P0HA 3T7IA 2XZOA 4O3FA 5HQ3B 8GPBA 8OHMA 3BWEA 4DQ0A 1RHRA 5IJXA 3ZDFA 1DX6A 3ABRB 3IEPA 1KYWA 4J0HA 3EX7C 3QFFA 4UD2A 3JX9A 3PHBE 4ZZIA 3COWA 1P7ZA 4MMXB 5LQSA 2X9VA 1E2PA 2O7RA 1EP2B 1LVGA 5BR1A 3ZGYA 3BZWA 3FCXA 1YR6A 2HK6A 2OLJA 4CT5A 3INRA 3WWYA 3ZWYA 2AJLI 1QIMA 4AB1A 2P3SA 3TIGA 4AMYA 4ER6A 3KSRA 1WNTA 3UHPA 1N6PA 1FUYB 2C3MA 4X62B 3ONEA 1E64A 1BJRE 5HGXA 4B3CA 1RRMA 3PCRB 1BFUA 3PTZA 2J32A 2PR7A 4NHOA 5BR8B 2J5RA 1BFKA 2P2LA 3E3NA 5KAPA 1XOIA 3ZE9A 1RJGA 4DLAA 5HM6A 3UC5A 1RBYA 4ISBA 2WV7A 4P5DA 4F9EA 1WPRA 5EXTA 3R6DA 2D74A 2HOQA 2HK9A 1UBNA 1YK1A 4NH4A 2FDRA 1G41A 3Q0EA 4Z4GA 1DFIA 1M6VB 4GR5A 4FS8A 3H8SA 2VDWA 3HU2A 5C7YA 4ZFNA 2G1UA 2FOXA 2P9ZA 5YASA 4EAAA 2IYSA 1FYEA 3EVDA 1X8LA 3BAZA 2W22A 4ECAA 3A9VA 3EIEA 1T8PA 1H4SA 2GEJA 4ZGGA 1U7HA 3KOWA 5B7NA 3GDWA 1QFMA 5DBHX 3VTKA 4YQFA 2WR8A 3TRFA 1A9PA 1AC5A 2BEWB 2WZBA 2POQX 1H1TA 1CZLA 1ODLA 2ZRLA 3S2UA 4NMLA 2M6RA 1Y8ZA 4R1UA 1C14A 3L2OB 5TQVA 3EZ2A 1AUOA 1BH6A 4FFMA 4WH0A 3ROEA 2XVAA 2EHJA 3SJ7A 1W1WA 3CZ4A 1WXXA 4DJTA 4X65B 1P2UA 3E9DA 1G2OA 1A1VA 2XT0A 3AIOA 3N8GA 3P9IA 2WD9A 3QLJA 3I4FA 2VHYA 4MV7A 4RJKA 3QELB 1D04A 2OOKA 3MRTA 3NDIA 4KH1A 4XOIA 4NCXA 5IKEA 1L5SA 2BDUA 4MV6A 3UJHA 2X6QA 3HCNA 4QKQA 1IQ0A 1OZGA 1U0JA 4HB2A 3C5WP 3MOGA 1VG8A 2FPPA 1GFSA 2I2XB 3REGA 1Z0SA 2XMCA 3UOWA 3REFA 4GC5A 4CDRA 1L5GB 1B23P 3T5PA 3UT0A 1O0BA 5ED0A 1XHLA 2FU5C 5AW5A 4YV0A 1DDOA 4RH1A 4P38A 3CF0A 5KAMA 1NU8A 2ATVA 2Q41A 5A3SA 5KQRA 3RSZA 2F1IA 4O59O 2OP1A 4BXOB 3WIBA 4IXDA 1EFKA 1IH8A 3R3YA 5C51B 3GFTA 1FFWA 2D3WA 2QT0A 5C5IA 4Z99A 2CNWA 2HA6A 4LDNA 3G6KA 4NBLA 5KZMB 1PGOA 2ERXA 1Z17A 2BW0A 2GTPA 3CRNA 4M7PA 5EIAA 4AF8A 4AZ0A 4ZEXA 3NYIA 1RBMA 4NV3A 5E7QA 2YN4A 3HZOA 2PS3A 4RY8A 1NXSA 3O21A 4LJAA 3SAJA 3MJTA 3UJ3X 2OZPA 4FLFA 4JLOA 3KUDA 3T4EA 1RBQA 2E2WA 4YQYA 4RADA 4OQMA 2GZAA 2GD2A 5AJXA 5J4YA 4V2UA 4H7FA 3IE2A 3L46A 2XDQA 3P2KA 5HJ7A 4LRWA 5LIRA 3FHTA 1XMIA 1JLHA 4R1SA 4H59A 4EFMA 4G0OA 4LC9A 4PGAA 1F0NA 4M9CA 5JNWA 2WWYA 4HGOA 4JP5A 3SKXA 2GRAA 3M4JA 1WA5A 2IUTA 1D0VA 2ZGVA 3QVJA 4FSHA 3TDMA 4B74A 4C4ZA 4RULA 3O91A 5BW8A 4K9KA 1V1MA 1T35A 2WICA 5FJJA 3ICPA 1EFPB 4DR2B 4CKEB 3G5LA 2HJ9A 3VU9B 4JGBA 4RZIA 2P6UA 2GSDA 1MEOA 2WC1A 3EFOB 3QKSA 3EEFA 3GD5A 1M34E 4BRUA 4F1JA 1QF9A 2EOAA 4PQGA 3SC2B 1P7YA 2H2GA 2OXRA 3E5RA 2X7JA 4JLKA 4RIHA 3DKVA 1U3VA 3D0OA 3UG6A 4B40A 5KDLA 2XB6A 1XZAA 2VYVA 3PENA 3PT5A 1NDQA 4HY3A 4U8HA 5FHQA 3S68A 3UJ6A 4C7KA 4WK2B 4Y1EA 5DI3A 2CXTA 2YHBA 3M9LA 4MRPA 2NU9B 4V03A 1AN9A 3BCRA 4W8GA 3T5CA 3BDVA 3G68A 4KN5A 4UARA 4H0CA 3KFXA 3AIIA 4HKTA 2X0FA 3CKMA 2ZYRA 3IA7A 1L4UA 3D59A 5AIBA 5BUZA 2NXJA 4PICA 1BG6A 2P1RA 4KVFA 3KZMA 3OKFA 1SVMA 4QJ3A 5JH7A 4BVLA 4ZT7A 4DIBA 2VWHA 3BIFA 4G23A 4YEDA 1EMDA 4IIFA 4LZAA 4BFZA 2DPMA 3IOBA 3V7FA 3S55A 2EL7A 4B2LA 2P2ZA 3F8TA 1F12A 3W5DA 5ITZB 4DPKA 3E61A 2DVMA 5IJZA 3H87A 1CZRA 3ROXA 5H8WA 3UJAA 2EXXA 3L0SA 1N6KA 3EBPA 4G56A 1W4CA 2LIPA 5FTKA 4YP9A 1ENOA 1DC6A 1G1MA 1XQ9A 2E5FA 3EQ7A 3I1FA 5IJ0A 5G53C 1XDBA 2E6UX 3WLSA 3FSGA 3RJZA 3FKJA 3MCTA 4KV7A 2HQRA 5JCOA 3IAAA 4HJXA 1OZFA 3MTEA 5KVCA 1U7XA 2DY1A 3WA7A 2I7TA 3R9XB 2XQFA 1PJZA 4M36A 1J39A 5LU8A 1EXDA 4A8JB 5FOXA 4KDFA 1U3DA 2MDTA 1UBEA 3AXTA 1R5BA 1RAIA 2NXEA 4FKBA 4HH1A 2DF8A 2PL3A 1CUXA 1FNSA 3K96A 3THXA 5BSFA 1OVMA 2ZSHA 1MTZA 1SOMA 2QUZA 4LXIA 1E20A 2H1WA 3PJDA 3JQ9C 1TQ4A 2H00A 3OD5A 5BYBA 2LGJA 4HB0A 3ZK9A 4PVCA 3J80A 5TSDA 1BAPA 1W9MA 3H9CA 2XOKD 1OOEA 3HN6A 5DVZA 5JAQA 3VO8A 2D5CA 3JZIA 4P80A 4KRXA 5AM3A 1ZIOA 4XVCA 4IRUB 4KDCA 2AC7A 4IX1A 3BRSA 1U9JA 2C8LA 3PNBA 4CT0A 4DV3B 2VNAA 3OCZA 4XQ0A 3ZE8A 2YDYA 1Y8RB 5JQGB 2GZMA 1K66A 2VSFA 3C8MA 1DPGA 1ES9A 1MT3A 5KTOA 4IILA 4EEXA 2V59A 4HX2A 2A5FA 3GN1A 2YXPX 2H1CA 3LHFA 4TLMB 4BLQA 4E33A 5KQSA 2C58A 3DEYX 2I8AA 5E2IA 4FWBA 3QW2A 1SKAA 2GN0A 4TLEA 2BFCB 3OWXA 3IE1A 4CR7A 4IUBS 4DVGA 1PJCA 2C0CA 1MU0A 1D5CA 1E3WA 1EK2A 2Q5CA 5HIIA 5JCPA 1GITA 1AT1A 1NDHA 1LK7A 1SG6A 1DKOA 1GL7A 3OQ6A 2PRIA 1KFKB 4PPNA 4RK6A 4UUBA 4UTXA 5J1SB 2CJPA 4C0XA 3STHA 3DJFA 1B15A 2PKYX 1GA1A 5DSXA 1AIPA 1TJYA 4FMBB 4J8PA 4L3VA 1W75A 5EUQB 5TLSA 3L4JA 4WDRA 1XYVA 2G08A 1P0IA 3F0TA 2KLHA 3HNPA 4WZZA 4QFBA 2WOJA 2QD4A 2QZ9A 4YJHB 2F8TA 2B2CA 2PZLA 1LGYA 2WM8A 1G5TA 4IEEA 2OK8A 4KK3A 4KRYA 1KOFA 3OIGA 3OZSA 3O38A 3NOQA 2A6PA 1A04A 1NW8A 4HP8A 5D2CA 2H29A 5BWCA 3OY2A 1XE3A 1K6IA 1I7SB 4UAUA 3ADCA 3N1UA 4YDHB 5ICFA 5ALPA 4BIIA 5JW6A 3X1ZA 1YS4A 1D1TA 2HSWA 3DR5A 3QPVA 1QFZA 2C5HA 4DLXA 3DVRX 1BXGA 2VQ6A 4YFVA 3DEAA 1YMQA 3W9SA 5KO2A 1SELA 4B7ZA 3OOJA 3N76A 2FWMX 4DMMA 3IAS6 3H4IA 2VJBA 4MI1A 3ZVKA 4OI0A 2C31A 5A6SB 3CF6R 1HTWA 1MAWA 2OXCA 1GGNA 5E0OA 3RVBA 2DCMA 2GJ4A 1TEZA 4X71A 3BA1A 3SEQA 1DGQA 3A2NA 2FSSA 2JFGA 5JZ9A 4KO4S 5MGBA 4XI9A 1NJ8A 3H11B 1XCJA 2B35A 3K0FA 3PZRA 1W5FA 4FHDA 1E6KA 1DQNA 2IY9A 3BGWA 3N7UA 4PFKA 3IDZA 3LY7A 1XVIA 2Q4OA 2WNIA 3OKAA 4PYQA 3MHPA 2O2ZA 1ZY2A 2QVGA 3S1AA 1FDVA 4YRBA 3IEXA 2VSOA 3GJ7A 4C4YA 1ZONA 4ESEA 1T9GS 2VHZA 5JQWA 2BEKA 3GDGA 1UKYA 1YR7A 4DKJA 3I6YA 1KJNA 1S2MA 3GJRA 2YZKA 5KQLA 5EE3A 4XGRA 1PWYE 3Q3IA 1IZ7A 1W5TA 1YDWA 5I01A 1VPVA 2RAVA 3K8QA 4HLUC 1E60A 2GASA 3FWKA 1DLJA 1XV5A 5BQXA 5U4QA 3KE9A 4K26A 1KZHA 5GVRA 4JHXA 4C1NA 5CBPA 1E2UA 4X1IB 1NN3A 5DYIA 1ISRA 4WXYB 1J21A 1M2EA 2EIXA 2XNHA 4PYIA 3AF5A 3VPDA 1RJFA 3NIBA 3CLUD 3A6JA 4IDDA 4NBRA 4HAVA 1CFZA 3UV7A 2CMDA 3RFFA 5BXQC 1IUOA 1EWYA 3AO0B 1NOIA 2UUOA 3HM2A 3KPJA 1QIGA 1YRYE 4XWTA 5D51S 1D9ZA 3HV0A 4K2HA 1SBCA 2BUAA 1D9XA 5FYDA 3EVZA 3IIJA 2AR7A 4PONA 3U60B 3TAUA 1BEZA 2IHJA 2GYYA 1ORIA 1NJGA 4G1EB 3H86A 4EHDA 2YC4C 1I3MA 3KP1A 4PZUA 2WLTA 4G5OA 3ZHSA 3GMIA 5CDTA 2G17A 5TT0A 4A16A 4DY6A 3EY9A 3DAPA 3DV2A 1PUIA 1QGUB 2P75A 1EA7A 1MH1A 2AVDA 2DH6A 3FDXA 1KQPA 4D0SA 1XRSB 3N0VA 4FYPA 1RM3A 1YRQA 2IGTA 2OHHA 4QD3A 4X1OA 3SX0A 3RQIA 4PYLA 2G6BA 3QU2A 3D7MA 4GZMA 1LDMA 3EGXB 1JDTA 4D42A 1B6TA 1OFUX 2RGCA 3B6KA 4LRXA 4MLPA 3NUQA 1A8QA 2PD3A 2HCRA 3UO8B 4KQHA 4IXNA 4AMZA 1TZ2A 1EFHA 1UJ6A 2DUUA 4B7CA 1VCNA 2WNSA 4Z2AA 1ML4A 2ZCUA 2OGSA 3JALA 2F9MA 2XECA 3DL0A 2QN7A 1SIOA 3NIFB 4L95C 2BRUA 3TMKA 4BNMA 2E6KA 2IWHA 5A06A 3FYUB 2OV4A 2EJCA 2Z09A 3AF1A 1KMCA 2P6PA 1IZYA 2XIQA 4BGVA 1MJGA 2YL2A 2ZVDA 4UNPA 4HGNA 4WNCA 5JNSA 1Q3HA 1J97A 2Q5EA 5DW3A 1I51A 2R7LA 3C5CA 4K2AA 4LTNA 2QTCA 4QE3A 1R8YA 1RSZA 3VMMA 4UASA 3D7KA 2Q6VA 4EVIA 1KH3A 3P96A 1X7ZA 3B8EA 4J4HA 3S28A 4Z0HO 1YZHA 3FWPA 4E1AA 1IHPA 3C6QA 5F5XA 4QYIB 2G9NA 3RSQA 1R0YA 3CH7A 3ZCUA 3B52X 3WAJA 1E9RA 1AXGA 4FYWA 1RRVA 1U1IA 1BMFD 2RH5A 1OASA 1NNEA 4MMYB 5EWMB 1XWIA 4FXOA 3VR6H 5J3JA 5BN4A 4DSAA 1ZR4A 3K5WA 1V8BA 3KWLA 2QGZA 4PLGA 1NONA 3KOZA 1O3YA 4CF4A 4HRYA 1CEXA 5HK9A 4DIUA 1N32B 5JYBA 1LPNA 3AESA 1B00A 4FDVA 2BV3A 3EEQA 5HQ3A 4R3WA 4XJTA 4BFWA 4HWTA 4L02A 2XHEA 2CDCA 1M73E 4O1HA 1VL6A 1XXHB 5B1HA 3TVTA 2OGUA 4HGYA 5I7OA 1YVRA 1Y5IA 3IT1A 5JIBA 1ODCA 4RV4A 1E6MA 3BD7A 1D5WA 1GLVA 2PLFA 3CUSA 3F73A 3CU5A 3OJ0A 3EAFA 4BNXA 2DR2A 3R9KA 2A9OA 3FRIA 4Y0AA 2UYYA 1TA0A 1CS0B 2YIVX 4RVHA 1T1EA 5TQ0B 2ONKA 3BORA 1Z16A 2ZVPX 4RY9A 4HNUA 5J4LA 4ZVVA 1UF9A 2JIZD 3RIGA 1Z13A 1OXBB 4EVSA 2CMKA 2VHVA 1R66A 3UXHA 1N33B 3IMFA 3GJ3A 2A5DA 3HM9A 3WX0A 1JQ5A 3N07A 4K8RB 3F2VA 3Q2IA 4B4VA 1O57A 3FCAA 3DDSA 3UK2A 4HUJA 4KE9A 4WE3A 1Q84A 1RWXA 3DHNA 5K0TA 2C3PA 3ZDAA 3ABQB 2FPMA 3IULA 5HZHA 2NZJA 1ZNXA 2RHLA 4A2CA 1F8UA 4LZPA 1QMPA 1NZJA 2X41A 1M6VA 4ENWA 3A58B 2I6UA 1SVIA 4IG9A 4LC0A 4BVFA 4BNGA 4WLNA 3RREA 4YH1A 3EQ2A 2RK6A 3CB2A 1FMFA 5ALZA 5I7FA 3BQMB 4D74A 4F2PA 3E8MA 2X6RA 4YYEA 2OHGA 2PT5A 3HKCB 1S8NA 4I5IA 3M89A 5LCXA 4EABA 2BEWA 3CLUC 3KHKA 1E79A 5JZOA 1OHHD 1GP2A 4N0EA 1XTBA 1SUAA 2OG2A 3EUEA 3LDFA 5DEOA 4BX8A 3P7MA 4X1KB 3KQQA 1YASA 4EZEA 2ODQA 2NN3C 2IWRA 1PS8A 2JJ2D 5AI6A 3IO3A 4G5FA 5HUJA 3I9JA 2J6IA 3KQTA 2RHWA 3D0QA 2P68A 1UKCA 4JVSB 3E05A 1O4WA 2XB9A 3QELA 3O2JA 4IEIA 5CYPA 2Q28A 4MHSA 3V7YA 1RT9A 3VYUB 3T5AA 2L42A 4ZVNA 4LYYA 4NQZA 1M33A 1BE6A 2AEFA 2CFOA 3VO1A 3NI2A 2FX2A 4NOKA 3DO5A 3VI4B 3TRJA 3JAMA 2GAAA 4FT2A 3FOCA 4YXWA 1JI3A 2DHCA 3DPIA 5EP4A 2C83A 5JXGA 2WVAA 1HSZA 2I7CA 3BH6A 3AW9A 2EGUA 1O0CA 1LI5A 3B78A 3FMOB 3QUSA 3K9NA 4C4OA 1Z5ZA 4PYKA 2FN7A 2YHUA 2J1LA 4GO1A 2GZSA 1N5KA 5TQ2B 1AZSC 2IA5A 3BSFA 3II6X 3MGKA 3DOEA 4MR9A 3WXMA 2V6MA 3W04A 1IE3A 3NTOA 1UDCA 1WSAA 4OKNA 1GPJA 1JJAA 4TXLA 4OFWA 3ZWCA 4BXOA 4RSMA 3S2ZA 4FGWA 4MI6A 4TSKA 5CG2A 2X4GA 4RDHA 2Z3WA 2BD0A 2LVBA 3ANYB 2DWOA 2IXAA 4HQOA 4IMRA 5J43A 2ZUSA 2B8JA 1NM5C 5EI5A 4Q05A 4JJGA 2Q3BA 4OGFA 4F92B 2O0KA 1VZ2A 3WVNA 1DMRA 3AQ4A 1Z73A 1AU9A 3EYAA 3T7SA 1E7MA 3N6VA 1SVKA 2GKSA 2O8FA 1GQOA 2DGDA 5J2TB 1PTJA 2YJNA 1UFRA 2ZIXB 3UFBA 1L6RA 1RXYA 1UPFA 2Q2QA 3I5MA 4EGAA 2QORA 3K15A 4V1CI 1TFRA 1Y6FA 2FK7A 4IV8A 1X42A 1LSOA 1VMEA 5AO9A 1W8DA 2X0EA 2PVSA 2QJRA 3HDVA 2P1DA 5CM2Z 1T13A 5LR6A 3QSYA 5FOUA 2XW6A 4LJ8A 4EY6A 5A5DA 3L8EA 1KZ6A 5AKEA 1BVHA 5FUBA 1EFPA 4GUDA 2Z5VA 1Z6YA 2WZQA 2JJ1A 3GEIA 4R7TA 3VU9A 4AY5A 4S0ZA 2PRJA 1YACA 2DCUA 5AIAA 5B1IA 3EFOA 4QWMA 3DT6A 5EPUA 3SBEA 1CHNA 4CV0A 2Q4DA 3RR2A 4NAHA 2Z3VA 5E6UB 2HLDA 4YN3A 2WINI 1R4AA 2JKYA 4OI1A 3SY8A 1ECBA 4M54A 2YV5A 1ECLA 3S70A 4D80A 2W00A 4H0NA 1Z2OX 4BLRA 3HVJA 3DZFA 2HLHA 2NXCA 4F91B 1UBUS 1ST3A 3ESBA 4CM3A 3F8WA 2NU9A 3LHDA 3W6ZA 4FZRA 2HRBA 4BE7B 1ULUA 4EYKA 3U13A 2WKSA 3NNNA 2BMVA 3AVYA 1JTEA 4Q9IA 1DJQA 3LUCA 5IBRA 4NPHA 4BMVA 1E8DA 2O3RA 1WMFA 3HA5A 3RW9A 3BBLA 3BXZA 3UMMA 4UVGA 5E9JA 1T9DA 3ZX4A 2QTMA 3C48A 2JCGA 4F46A 4F2HA 3SHWA 2RGXA 3H5AA 4KZKA 4MB2A 3VYWA 5KOHA 4Q4JB 3T7JA 2Y71A 1ZMXA 4D9MA 1NVBA 4DUGA 4LGCA 5ITZA 3QXCA 4WINA 1AS0A 3VYSB 2FW8A 2EIHA 2JLCA 1NQUA 1EFRA 4KO8A 5JSZB 4ND8A 5CFQA 4UEQA 4ARCA 2QMQA 3ZVNA 3FVTA 5H3LA 4FD3A 2IUFA 3TOSA 4QRDA 5TC4A 1XDSA 2X2EA 1CUJA 1N7HA 2ARKA 5D6OA 3G79A 1V6SA 2ZTUA 3RTAA 2BMAA 5E2AA 3PUZA 2ENUA 2QYOA 1PJ2A 3DQZA 3QJGA 2ZM6B 1GRRA 2OZVA 4ZOLB 4KR7A 4LYJA 5FL7A 2JIQA 1PO7A 1FNDA 2A1TR 5KREA 5LXTA 3KQHA 1UJMA 2ZJZA 4HDRB 1P8JA 5L7TA 1GTRA 1FFHA 4NZYA 3VTFA 4DJ5X 1IHXA 2QT9A 3ZVMA 3LL4A 4RXMA 3TTTA 1BS9A 1L5ZA 2GBLC 1M34A 1T3ZA 2Y1EA 3TZLA 4BU0A 3TLMA 1JTVA 2IP4A 3ZDQA 4AO7A 1DKMA 4FYKA 2X19A 5LB2A 3Q8XB 2RD2A 4W5HA 3FTDA 1Z5NA 2IH2A 1R10A 4OSOA 5BUQA 1UUFA 1ZOSA 2JZOA 4DT1A 4GU5A 4PX5A 2D00A 2I6XA 1K6MA 2K5UA 4WZBE 3HJAA 5LBTA 1JJIA 3KVNA 3TF5A 3EXIB 1DJNA 1J22A 1BNCA 3VV3A 1G7TA 3T15A 2DQSA 2WM3A 4PAMA 4ZQIA 2QTVA 5IN4A 3L7DA 3BE4A 4LVUA 4R1PA 3UOAB 5AVSA 2P8JA 2YMMA 3ZZTA 2O5EA 1Y1PA 4ER5A 4HQLA 4CMEA 5JQGA 4IQ4A 2ZXFA 2HCJB 4X64B 3TNLA 1OC2A 4E21A 3ACBA 4BX3A 4GXQA 2IT1A 4GOXA 1E1KA 1VE3A 4CF5A 3KYBA 1XU4A 3PA6A 4LYEA 4X66B 2NIPA 2YRXA 2Q1UA 3UUWA 3DNPA 4J75A 3UWDA 3AVUA 2XCSB 3PK0A 4P4SA 2ZAYA 5K4AA 1UXOA 2BFCA 3RS0A 3OCUA 3D5QA 1HZJA 4OX9Y 1XTUA 1KIFA 3WIEA 2HKIA 5AOCA 1CC1S 3BJEA 4DAOA 3PC6A 3AP3A 2BHLA 4KAXA 3I6QA 2F1KA 1V95A 4PZ0A 1U8AA 3R0JA 5DFAA 4IDCA 4JZKA 4MYCA 3HWRA 3AOEA 2HXSA 4OSEA 1M83A 4X41A 4UHCA 1ZI8A 1QYDA 3FCYA 2N9UA 4NJEB 1FLDA 1PVDA 1B16A 2B8EA 2BZSA 3CKKA 3GNLA 1BDJA 3MCZA 4JNCA 2AWOA 4AG5A 5JRJA 5ISMA 1JDZA 2GT1A 4FDUA 1JSLA 4YJHA 3NHAA 7GPBA 2PD6A 2Z8XA 4RPLA 2NPOA 3WR5A 2F1RA 3NIDB 1G63A 2E49A 3OHMA 1Y3HA 2J5QA 2Q21A 2YYAA 2FSVA 5DHRA 2WYHA 5EWLB 1O58A 3O26A 3H2BA 3NDJA 4LQCA 1BKYA 3TUIC 4CV1A 1G3IA 1LF0A 1KF0A 3OQBA 3MEQA 3OOHA 2NV0A 4OUKX 5H3HA 1C0IA 1M2VB 1NJ1A 2Q45A 3HJNA 1R0BA 3D6FA 4OBXA 4C7MA 2XCQA 2FW0A 1RKQA 4WZBB 4AVYA 4EK9A 3T9AA 1C4XA 5F1YA 4LTMA 4DQXA 2VHTA 5G0VA 8ATCA 3L8HA 1YJBA 4TUYB 1I0LA 4CLDA 1XZIA 4TKUB 2GILA 4MAFA 3I2IA 3HCAA 4P31A 3ROPA 4LKRA 4MW9A 3H11A 1G9XA 4G67A 1YRAA 1BQEA 1JU9A 5KOJA 1PFUA 2B2NA 2NYRA 4WVLA 2O2JA 1ZC4A 4H17A 4KW7A 1ZJZA 3GWZA 3B85A 3QX9A 4N5MA 4YMWA 3K53A 5DMHA 4ZVSA 4CM7A 1GTJ1 4IVQA 1MB4A 2I4IA 2XMPA 2YYZA 1K6JA 1YJAA 1U65A 4XQCA 4U2BA 4EP1A 1IQUA 4F06A 3Q5GA 1YDGA 1IHOA 3CZAA 1U2PA 5FHRA 1VSUA 1KAHA 5KYUB 1MHPA 1C9EA 4OAOA 1A9ZA 1N6NA 2I54A 3B2EA 4P3OA 4CMKA 3HA2A 1SIUA 2SKEA 4K3UA 4L5JA 1E1QD 3WGHA 4F9FA 1WMAA 2BI7A 3ML1A 3GPIA 3KTAA 1K7EB 2VK4A 1JQKA 2AEEA 3GLFB 1EFTA 2PGDA 2AJCA 1A4RA 1OXUA 2YW2A 2WSYB 2FMXA 4BV9A 1QQAA 4RYDA 1HH4A 2GFQA 1C7QA 1CZUA 3M1LA 4FYIA 4V0NA 4RK0A 3P9NA 3P0EA 4WCFC 4ALNA 2J3JA 3EULA 3TECE 1ZD9A 3L8CA 4W5WA 2OO3A 3SZMA 4E51A 1JV2B 3CG4A 4C30A 3KKEA 3FTEA 4DM4A 1JTFA 3N2IA 1N2SA 3TCKA 4GR4A 1W87A 2Y0BA 4I19A 1SCDA 4Z4HA 1Y1RA 4RMGA 1QGUA 2I1QA 2YQ5A 3AFIA 4EATA 3BHJA 4Y6PA 4YMVA 3MYRA 3THYB 1NOKA 4GVPA 1N6RA 5AJHA 3TLGB 1TMYA 2QLNA 5IXJA 3I1JA 4BNFA 3LGXA 4F84A 1FS5A 1VSTA 3EGXA 1ZW6A 1K8RA 1L5VA 3PWSA 5KVSA 1Z37A 4OJQA 4DBVO 3S81A 2DJ5A 1UIRA 5HSGA 3NWOA 4CLOB 1MQ9A 3CPJB 2QLLA 1OYWA 1ZS9A 3RYHB 4RVCA 2PQ0A 3GJSA 2YWRA 2O59A 1YU6A 2ZSIA 2J07A 3GJ4A 2ZQYA 3Q7PA 1ZD8A 1LU9A 4MAAA 4PZCA 1PV2A 2Q5HA 4PG4A 4OY3A 3WL8A 4JJZA 2ZE7A 2PA0A 4K28A 4KEAA 4OCZA 5JH7F 3ED5A 3U3ZA 4FFNA 5LKAA 1YB6A 4N5DA 2J3EA 1AKYA 2VNIA 2P9JA 3C8ZA 4H15A 1UXHA 2HDNB 2XYPA 1NFRA 4L4UA 3OUTA 4M7OA 4MUIA 4MVYA 4QJBA 3PFIA 4AROA 4D0LB 5ADHA 4D3DA 3DBOB 1XZNA 4LFAB 3K32A 3HEMA 5B7GA 3QPCA 3R0IA 2JI8A 1RQPA 4QXPA 4YRNA 3MIIA 3O8BA 1T2DA 4KNVA 2DBRA 4G9BA 1SU4A 2HMUA 3N3BC 2BGIA 3NP9A 3QEKA 3W3ZB 4ZZ0A 3BSYA 1XQXA 3C4JA 4YECA 5I45A