3SIZA

Crystal structure of the mutant s127a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMAHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mutant S127A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor BMP
rcsb
molecule keywords Orotidine 5'-phosphate decarboxylase
molecule tags Lyase/lyase inhibitor
source organism Methanothermobacter thermautotrophicus
total genus 84
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sizA00
1QDSA 1NF7A 2WSQA 5SWUA 1M5WA 5DCEA 5E1QA 2BXVA 5CPOA 3MO7A 1JRBA 2FFCA 4YCOA 1WXJA 5KTLA 3TKFA 3GXPA 2ALDA 3LV6A 4UNLA 4FF7A 1QNVA 5G2IA 1G6CA 3HIJA 4DPQA 5K9DA 1K3UA 2C16A 1YTDA 4IOTA 3W88A 4OV4A 2ZZ7A 4K8EA 3G18A 5F4XA 4ZVJA 5BOOA 1TPH1 1KM5A 2DZXA 3EB2A 1LCOA 1OYBA 1HTIA 1HFBA 3LX9A 1EB3A 1WQ5A 3BW4A 3DKLA 2FIQA 3LV5A 4O52A 2AAMA 3STGA 1Q6RA 4XZ9A 3P7YA 1KLYA 4OQVA 5D30A 3FA5A 3W7JA 4RCXA 4LW7A 3ATZA 3RLUA 3B0UX 3W7LA 2V2DA 4IMGA 3CIXA 3W7NA 3W1LA 4CQ8A 2ZRZA 3EX1A 3R2GA 3W23A 3PB0A 4ADUA 2BX7A 2YPIA 4NUWA 1DBTA 1GG1A 4M7SA 2J9ZA 2EAWA 1OFPA 4QSHA 1B4KA 3NGJA 2V8ZA 4TMBA 1QPOA 1OX5A 3LCLA 4MZYA 3L21A 3KRUA 4L4LA 3A5FA 4ICNA 3DFTA 1S3HA 3MI6A 1P0KA 2VEPA 3W7DA 1PS9A 2EF9A 2OZ0A 3B0PA 2GQ9A 2R94A 3PBUA 5I3FA 2YFOA 4QITA 2GJLA 1PE1A 3W1QA 2QCFA 2CZFA 1H7OA 2GQAA 5EKYA 1PV8A 3EWBX 4O1BA 3HMJG 2ZFAA 3W73A 3G1VA 3K30A 3Q37A 3PVFA 5DLCA 4MPQA 3TH6A 4Z0JA 3ZR4A 5KINA 3JS3A 4AAJA 3UPWA 2QKFA 3W7QA 3HG4A 4DEFA 4JTIA 4WY0B 4DQWA 4O14A 3NR0A 3KVJA 2VELA 4L4MA 2Y7EA 1LBFA 2JGQA 4FIQA 1TQXA 1FQ0A 3L9CA 3N73A 5FF0A 5C55A 1WBHA 3BLEA 1VYPX 1KM1A 3TJLA 5K9XA 2UV8G 3H54A 2FPYA 2WNQA 1FWRA 3BARA 3GR8A 4TX9A 3P67A 5LSMA 1NSJA 4PL1A 4ZMGA 1W1ZA 2QJIA 3LRLA 3UPBA 2ZA1A 3N3MA 4JS3A 3UXAA 2CWNA 3GAYA 3HG3A 3EX2A 1PHQA 2OMAA 4O19A 1JCMP 3WJXA 4EWND 2VOMA 3EXTA 4FEZA 4RX0A 1H61A 3UY7A 4LVAA 1FCUA 2X1TA 4LU0A 4NNBA 2NWRA 4UR8A 3W7EA 5KMYA 1TCDA 4N9BA 1JCXA 3OHIA 3NQ6A 1L6SA 1PCWA 2Q8ZA 2C6QA 3OEXA 4LTSA 3N9SA 1XUZA 2WOQA 2VC6A 4IUOA 2HTMA 5HULA 3I65A 3TU9A 3IVTA 3GLCA 4EVZA 2EKCA 4AF0A 1GQNA 1XCFA 2A4AA 2DZTA 5CGQA 2B7OA 2TPSA 5AHEA 4OT7A 2JK2A 3P8IA 3L5AA 3NAVA 4WUIA 5L9FA 3KVKA 4JYFA 3GXNA 4WX2A 3KVLA 5H91A 3OBKA 3THQA 4QNEA 4IWWA 3FYPA 3DFPA 3QRHA 3WJSA 2WV8A 4UTKA 4UXDA 3SSJA 3BG9A 4O54A 1XDMA 2FB3A 3UY8A 4O0KA 3V75A 4GUIA 4TU1A 4CQAA 1GT8A 3I7RA 1F2JA 3BW2A 5D2XA 2FJKA 3DH7A 1XL9A 3F4WA 3L0NA 1DOSA 1YLVA 4CCDA 2Z2UA 4UFLA 3G1DA 3FKRA 3M5XA 3BGGA 3P5ZA 1UBSA 3RK8A 3MBDA 3E02A 5CPNA 1LZOA 4MYAA 4POCA 5HR6A 4I7VA 4RLIA 3CEPA 1UUMA 1D9EA 1NEYA 3DU0A 3VFLA 3LI0A 4UTUA 2BTMA 4O4VA 3E96A 1TPUA 1JR1A 2QCLA 4AHPA 2H90A 1HL2A 5LZLA 1S5WA 1ZAJA 2V81A 3W1MA 3SECA 3NL6A 4FNUA 1XBXA 3KHJA 4S2BA 1I2QA 3M7WA 1GWJA 1SR9A 1FXQA 3QQ1A 3S1WA 4LVFA 5FF2A 1ML1A 4UTMA 5F1VA 1H7PA 2ZRXA 4ZQCA 4O15A 5F4WA 1W54A 2XN0A 1ZJIA 2QCEA 3L2IA 3N34A 4ORIA 1G4SA 1W5PA 1RPXA 1DORA 1OYAA 3SR7A 4O4WA 1OFAA 1TV7A 2HMCA 4GXMA 3WJWA 2CZEA 2QF7A 5LHEA 2YR1A 5AOUA 2ZQ0A 7TIMA 5EY5A 3NYZA 4CQ9A 3OIXA 1VCVA 4WD0A 2QUTA 2X30A 2BZNA 1AW5A 3LXCA 4LRTA 1W56A 4WZHA 4JICA 3W7OA 1AL7A 1W3TA 1D3HA 2C0AA 2W0UA 4NXKA 2VFEA 1OJXA 2GVLA 2BSLA 3QH2A 2C15A 2XN1A 3TSBA 4IMEA 1KFLA 4UUIA 4ADSA 1R2SA 3UYCA 5D05A 3NQ8A 4AHQA 4YWIA 4H3DA 4ONVA 2Z6JA 2OJPA 4ADTA 4BI7A 1YDNA 1TPFA 5K4XA 3S6DA 4FNTA 3LTSA 1WV2A 3OVRA 4XKYB 1TJRA 4GFSA 3W2UA 2A6LA 5CZJA 2JKAA 3NNTA 2YFNA 1RVGA 2B7PA 4NJHA 2G96A 5I3IA 1S5TA 5C5YA 2GVJA 1XKYA 1FDYA 1QAPA 4JEQA 4JX6A 5AC7A 3N19B 2QCNA 4HHPA 1LOLA 4UTHA 4HNNA 5D37A 1T0OA 2DORA 1ZENA 3DFQA 5FESA 3LBMA 4NU7A 3C2EA 4MKNA 3EKZA 1X8FA 3WK0A 1Z41A 1ICSA 2E77A 3NPVA 1K02A 2W6RA 2CLOA 5AC6A 3M43A 2D73A 3S5NA 3IRDA 1TV8A 5T26A 3LCGA 1W5QA 1GVRA 4OV9A 3W1AA 3C2RA 3QYQA 1R30A 1TRDA 4AXKA 4CCEA 1BWKA 4FXSA 3L0KA 4TMCA 3QC3A 3R12A 1YYAA 4EOUA 4UFHA 4M5PA 2VXNA 4GUHA 1JUBA 2Z1BA 3HBLA 2QUUA 5L6UA 4ZQPA 4JTTA 3C8FA 2QUVA 3S0CA 1A50A 1RV8A 1ALDA 1L9WA 3DFSA 2ATMA 4N6FA 5AB3A 1W0MA 5FEXA 1SZEA 3C2VA 2J9YA 4X22A 2CLLA 3WK3A 3LXBA 4QJ1A 1W5OA 2ISWA 2QCGA 1SO3A 1C8VA 2NXGA 3W7GA 4W9TA 4MJZA 4BWLA 1R47A 2CFFA 3MW7A 2A21A 1C9DA 1KFJA 5FF4A 3UWVA 3LCWA 3E9AA 1HO1A 4GC4A 5AHFA 5KITA 1QPNA 2VEKA 4N6EA 4RK8A 3MP5A 4PODA 1TREA 4HSNA 2CLMA 2P1FA 4JTJA 2Y89A 3M5ZA 5HWMA 1GZGA 3TA6A 4LT9A 5LNVA 3ZWTA 4K7YA 3Q94A 3HO8A 3W07A 1JQVA 5I3GA 1SW7A 1TSIA 3C0JA 3N2MA 4JTSA 2V2CA 3PR2A 4Y6GA 4CCCA 1HO4A 1WDWA 3I6RA 3NZ1A 3MP3A 1RQEA 3PSVA 4LC8A 3OG3A 3W9ZA 1AMKA 3DKJA 5BRBA 1RZMA 3ABOA 1KM0A 2P0OA 4NQ1A 1YXYA 1B3OA 1Q3NA 1AW1A 3EWUA 3GKAA 1OFQA 4FNSA 2E09A 2C3ZA 4G1KA 1A5AA 4O10A 1G7UA 1F7BA 3ELFA 3NQDA 3STCA 3ABRA 4QNWA 3NQMA 4Y9AA 1VJIA 2ZRUA 1QO5A 1R2RA 3IIVA 4MYXA 3VE7A 4LC6A 1P0NA 2YSWA 2ZZ4A 1GOXA 2ZZ6A 4R33A 3KOFA 1U5JA 1ME7A 2PC4A 3KX6A 2ABBA 2H8ZA 2NLIA 1LLWA 4MUZA 3GK0A 2C13A 2A7PA 3TUUA 1SSDA 3G1HA 3L5LA 3DFOA 3A21A 1Q45A 3E0IA 3G0XA 1D3GA 2V5LA 3LI1A 4O11A 1X6UA 2DZUA 1OYCA 5I3HA 1GJPA 3VNDA 1XC4A 3MHFA 1K03A 1K7FA 1FWWA 3S5YA 2V2HA 1TJPA 2ZRVA 4EIVA 1WBJA 4JD4A 4BF9A 4N9DA 5I3JA 4DO6A 3LXAA 5BNKA 3B04A 4O1CA 3NPWA 1SQ7A 4XBSA 3QJAA 3GDTA 1IIHA 5HMSA 4IJBA 4FO4A 4NVTA 1O94A 4JTFA 1FCBA 1TV5A 4BWLC 2TRSA 3NQAA 1YXDA 3C52A 1JUKA 1AW2A 4O13A 4M6PA 5BMXA 3IGUA 2RHGA 1T96A 4C1LA 2H3DA 4PH6A 1DQXA 1W5MA 5D2YA 4RJEA 1UASA 5AHNA 1F74A 1LBLA 1KM6A 4LOCA 5EMUA 3M41A 2Y7FA 5DCBA 1GTEA 2A1YA 4Y8FA 1Q6QA 4S2CA 1K7XA 2QAPA 3CTLA 2OCZA 3P82A 1KTNA 5AYXA 1QFEA 3UQNA 1OX4A 4IXXA 3S1VA 1T8XA 1SZNA 3BG5A 5IM51 5G2HA 4FIRA 5G4EA 3SY5A 3G3MA 3W22A 3JR2A 3LHVA 1OG0A 4GUFA 5D03A 5GVJA 2WSYA 3O06A 3UZ5A 5DXYA 3TXVA 2CLEA 1JCYA 2ZYFA 1DV7A 1LRQA 2PRLA 1W31A 4ZQRA 5TIMA 4MLRA 5KZDA 3N9RA 4JGDA 3LHWA 1W5NA 3FLUA 3MBFA 3HG5A 4MY9A 4TR9A 1LDCA 2JBMA 4LS1A 1NFBA 2E5BA 4GE8A 4AHOA 4NNCA 2Y63A 3TE9A 1VYRA 2J9XA 3P84A 3W71A 4MIMA 5AN7A 2G5WA 3ATYA 3LLDA 4R34A 2Z6IA 1SPQA 3NL3A 1XBYA 2CU0A 1X1OA 1M7PA 2VEMA 2A6NA 1VHCA 4JXCA 3L68A 3L67A 3EWYA 5FEWA 4HT3A 4JDBA 5D38A 5DELA 4JR5A 5D2VA 4H4IA 3M44A 4IGHA 3EX6A 1VC4A 1JJKA 1PIIA 4PFMA 1RR2A 4QIUA 1VZWA 1G4TA 3SZ8A 3THAA 1LM1A 3S42A 4DBEA 3T55A 2GQ8A 4NXSA 1WYIA 2OX1A 3QQ0A 4UTLA 5CSSA 2JKEA 2QCHA 3O07A 1FBAA 1OF8A 4HSOA 4IMDA 3TQVA 3HJZA 1X7FA 3NVTA 1Y0EA 5LNWA 3E12A 4AF0B 5F1UA 1QO2A 2A85A 2B7NA 4E2DA 1M6JA 3O63A 3NQVA 3PSWA 1JCNA 3M9YA 1OVDA 3C4UA 1PVNA 1VPXA 2GVGA 1G4EA 1EEPA 3MWAA 3CC1A 2I14A 3HPZA 1I2PA 1KM4A 1UJPA 3M16A 3DHDA 4O1AA 3LCFA 3TFCA 3OVQA 4UTJA 3M0ZA 1VYSX 2FDSA 2YX0A 2J27A 3O6CA 3W75A 3LHZA 1IXQA 3LCHA 3VKJA 1I2RA 3EX4A 3W7PA 3USBA 2J24A 5E0KA 1NVMA 3TJXA 1E51A 1F5ZA 4BI5A 2OT1A 4O18A 3GDKA 4NX5A 3IVSA 4AWTA 6TIMA 1LROA 2WJZA 3FS2A 3C2FA 1V5XA 1IF2A 2R14A 3PUOA 3TSMA 5KSWA 5LKYA 1ZCOA 3W1XA 1TYGA 4OE7A 4OBTA 4A3UA 1H7NA 3QF0A 4E2BA 2CLFA 4RR4A 4R7JA 3KFTA 4JYEA 2VEIA 1EP2A 3FYOA 4X2RA 3TC6A 1J4EA 3NQFA 2B7QA 3U6WA 4JTUA 4N2YA 5G4WA 4JTKA 4K7VA 5DY3A 5LHFA 2I1OA 3FJ6A 3L0GA 2E6AA 1CI1A 4Y96A 5F2LA 4WJEA 1DJNA 3GIYA 5KZMA 2EHHA 4P2VA 3TSDA 3W3OA 2ISVA 1G69A 4O12A 4LS2A 3H55A 1NAL1 1I4NA 2AGKA 3INPA 1H1YA 1T99A 4XUGA 3G1SA 4UTWA 3RFAA 3G0SA 2QCDA 3T7VA 2QAFA 3HPXA 4GUGA 3S1XA 3P80A 1B57A 1QMLA 2A0NA 4ZQMA 4UNKA 3TW6A 3F1QA 1J5TA 2XFWA 5A5WA 1ZNNA 4KWVA 3GNDA 1EWEA 3LLFA 3QEZA 2WKJA 4M6VA 2J88A 4Q4KA 4AB4A 3AJXA 3W7HA 4KWWA 2C18A 5K7JA 1ZAHA 2HS8A 1TRIA 3DAQA 1ICPA 2X2GA 3O15A 3V1PA 3KVMA 2Q8LA 3MHUA 4XBKA 3CM4A 5C6MA 2Y61A 1ADOA 3N2XA 4FNQA 2A7NA 4YLWA 1LRNA 2DZSA 1PL9A 5EBUA 3FFSA 3BV4A 4NJGA 4N9CA 1IXPA 3O16A 3TX9A 2Q3RA 4M19A 1JCJA 4PC8A 1MEIA 5FEPA 2ZCGA 3DZ1A 1P5BA 5K3VA 2ISSA 1MO0A 1YADA 1AG1O 1VR6A 2X1RA 1B9BA 1SW3A 2NXHA 3LTPA 2NWSA 4X3ZA 2NZLA 3U2OA 1H7XA 3NQ7A 3HF3A 4DBDA 3DBPA 3T40A 1Z42A 2TSYA 3EKLA 4QISA 2WNNA 1FX6A 1R2TA 4M6QA 3GDRA 4N02A 5CPMA 1QOQA 1UUOA 3CEUA 1H5YA 2C19A 5U4NA 1FCVA 4NJJA 1ZFJA 3WJYA 4ZQOA 4IQLA 3B0VC 1LORA 3UWQA 3HGOA 3BPWA 1PCKA 4AEOA 1W37A 1N8FA 4IX0A 5AC8A 2V5BA 3SJ3A 1YPFA 4CLMA 3GNNA 3IIZA 1ICQA 4DO4A 3PUDA 1YTKA 3S5ZA 1JUEA 2E5DA 1F05A 5HR7A 1W3NA 3QMRA 3BO9A 3I68A 3ABSA 5TQLA 2HSAA 4X9SA 3LGEA 3LCXA 3HGRA 1SUXA 4UTWC 1Q6OA 4JDYA 5BMWA 3KRSA 3CU2A 4O16A 1KLZA 4K8HA 5J5RA 3SI9A 4YMZA 1G67A 2QDHA 3PF3A 3MP4A 4Q33A 3UWZA 1EP1A 1MEHA 4ZZ9A 3PBWA 3NPUA 2WSRA 4AWSA 1TTPA 3W7IA 1N55A 2DZWA 4UC5A 2YDAA 2YYTA 1VQTA 2BLEA 3N14A 4CNOA 4BK9A 4IPJA 5HUOA 4HNTA 1F76A 2ZA3A 1YDVA 4UMCA 1FWSA 2G95A 3G0UA 6ALDA 3QFEA 3GR7A 4Z08A 1O5XA 2FPTA 3O6YX 5D2TA 1GVOA 2ABAA 2ATSA 4DF1A 3QW3A 5DBTA 3PAJA 2PE4A 2NUWA 1FUYA 3DHFA 3RNDA 1WA3A 5I3KA 4JYDA 1TPEA 2TYSA 3P8JA 3LRKA 5FEZA 4JTLA 3TAKA 4A2SA 4UFKA 1GVSA 5AHLA 3FJLA 4QM1A 3FKKA 3W2KA 3S8HA 1GVQA 2A7RA 2F7FA 3QPYA 3IGSA 4K37A 1HG3A 1KTCA 4WXYA 3UZJA 3ABQA 5F2GA 3T78A 4H6KA 2JKPA 4MOZA 3NA8A 3TC7A 3IVUA 3TIMA 1MSSA 3IIOA 3STEA 3W87A 5CZ0A 3HGJA 1F6KA 1KBJA 4RZ4A 3W7RA 4LY8A 1SO4A 3TAOA 4O50A 1ZY9A 1VCFA 3D0CA 5CZSA 3TQ0A 2FTPA 5DBUA 4ALDA 5DXXA 1FWTA 1LP6A 1GPWA 3IIXA 1U83A 4LNYA 3EX3A 5BW6A 3A24A 4JNMA 3PG8A 5U7SA 3LCIA 4YXGA 1DHPA 3CIWA 1CX9A 1KA9F 3NOEA 2VFDA 3BW3A 4DELA 3EXRA 3O8AA 3DI0A 4JX5A 4A22A 4NJIA 4NX0A 4JTGA 2QCMA 3LERA 1H51A 3G1XA 3O6DA 2QDGA 3GZ3A 3PY2A 1EUAA 2VENA 2NX9A 4IMFA 3W2LA 4WOQA 1BKSA 1NF0A 3ZS4A 1TQJA 3FEMA 3PBYA 4GWEA 4KFOA 2J6XA 4IPIA 4UIOA 2F84A 2E68A 3MYOA 1OX4B 3TK7A 4LV4A 1L6WA 3F4NA 4IMCA 4GUJA 1G4PA 1I2NA 2XN2A 1GYNA 5LNRA 3CT7A 3QSRA 1XM3A 5AYZA 4DF2A 4EF9A 1H63A 3T4CA 1THFD 1VLIA 4LVGA 2PURA 2C14A 4MVAA 1VGAA 4UTIA 4XTIA 3TDFA 4RV8A 5HWNA 3W76A 2RFGA 1XUUA 3MI2A 1OK4A 5EYWA 3GKFA 2H3BA 4JTEA 1QPRA 1YPIA 4WY0F 4XTDA 1AL8A 3NQGA 1LRTA 1XFBA 2NUXA 3NDOA 2OT0A 2X1SA 1AK5A 3MHGA 4O1DA 1H7RA 4IXHA 1SW0A 2YZRA 1KM3A 1XDLA 1VH7A 2CLIA 2EPHA 1TIMA 2ZTKA 2B4GA 3TROA 3MMTA 4JY8A 5HQEA 1LTDA 4LV9A 4YL2A 5KZEA 2RKXA 3NL2A 2NX3A 3F03K 4PCFA 5C54A 3W85A 3EWXA 3R8RA 3LM7A 4UMBA 3W2JA 3GVGA 3LHYA 5K9CA 4TO8A 1LBMA 5J5DA 1KFCA 3L66A 2CLHA 1JCLA 1XBVA 4JIPA 1F73A 4O0ZA 3T44A 4FNPA 2WPBA 1A53A 2ZRYA 4UCGA 3LHTA 1XBZA 1L2UA 3M47A 4PA8A 3STFA 2O7SA 3RF9A 1RD5A 1PHWA 3EWWA 3TCEA 4LUJA 3EWZA 1OABA 2VKZG 2NX1A 2V30A 3NL5A 3NPXA 2E6FA 5IBXA 3PBVA 2PRHA 3NM3A 1JULA 3P61A 3P81A 3W74A 4OHQA 4A21A 5HNRA 3HG2A 5DCDA 3W72A 3TNOA 1K8YA 4N4PA 5CZTA 2Z0IA 5LGZA 3W1PA 3UD6A 4DPPA 1KFBA 3TV8A 2YW3A 3QMSA 4NNAA 1TPDA 3S5OA 1LOQA 3IGXA 3G8RA 3I7SA 3M5VA 1I45A 4BR1A 3P5YA 1P4CA 3TW7A 1OFOA 3W86A 1OFBA 2ZA2A 3M1ZA 3GYEA 1A5BA 5F2MA 4QAIA 4RZ6A 1SFJA 2V9DA 5CKSA 1S5VA 1LOSA 3W1UA 5A8GA 4K39A 4C1KA 4LVDA 4QQ3A 1DQWA 4O28A 4AMAA 1O60A 5HJLA 3OA3A 3W83A 3R13A 4ZQNA 1TMHA 2H6RA 1O4UA 1K8XA 1K7EA 3RLVA 5FF3A 2G97A 1DVJA 3KAOA 4WQ6A 3TXZA 3C61A 4FX6M 3LTYA 4GBUA 4TIMA 2DJXA 2IQTA 1FY6A 5AHIA 4KFPA 4R53A 5DY2A 5CG7A 1Q6LA 5K2ZA 3GDLA 2ZZ3A 1H50A 2RDUA 2GPTA 1ZAIA 3KRZA 2FQIA 2V0TA 1TPC1 4FXRA 1KTBA 4LUIA 2I9EA 3TFXA 4K38A 3P62A 4GJ1A 2R91A 3TR2A 3MUXA 4I7WA 4NJKA 1WOAA 4I9AA 4DXVA 4DF0A 4OGZA 3B8DA 4RXGA 4NZFA 2QCDB 5D33A 3E49A 2Y6ZA 1EA0A 3G3DA 4K6AA 3ZFHA 1ZHAA 3VE9A 3UNDA 2FPVA 5AFDA 2Y85A 1FCQA 5HWJA 1VRDA 5HINA 1C29A 1IGSA 2JGYA 2W79A 1H60A 1V7YA 2QJGA 2VFHA 4U4MA 2C1HA 1FDJA 3GAKA 2GJNA 3RU6A 5H2ZA 2CZ5A 4JN6A 5EL1A 5IBXC 3CLMA 2CLKA 2YXGA 5ABTA 2E6DA 3QW4B 1TPB1 4ZL1A 5AYYA 4WY0A 5CPLA 4MZ8A 3HGSA 4UTTA 1P1XA 2YCEA 2Y7GA 4E38A 4HN4A 3C6CA 4KFNA 4MZ1A 3M6YA 3W2NA 5K4ZA 3CHVA 3AO0A 2X16A 1TPWA 1H7WA 3W1NA 3WK2A 2KZHA 2BWGA 3W84A 1FWNA 4CNNA 5LNSA 3FOKA 1VLWA 3TMLA 3BLIA 5D32A 4AH7A 3A22A 3LHUA 3UXDA 1Z44A 1DL3A 5G5IA 4AWUA 1H62A 4O53A 4LRSA 3GB6A 1GTHA 1SO6A 2V82A 3QPZA 2GUUA 5CSRA 5DN1A 3CPRA 2RDWA 4Z1CA 3HOJA 1OX6A 1F6PA 3IV3A 3C56A 4JIQA 3FIGA 3G1AA 3HB9A 3LDVA 1TTQA 4MFEA 1J2WA 2PCQA 3PWAA 1YDOA 2VFGA 5HUPA 4YCPA 1TPVA 3BVJA 3W7MA 1BWLA 3O1NA 3DI1A 3PC0A 1EWDA 2HS6A 3BLFA 5D09A 2WQPA 1OFEA 3SGUA 4JTHA 1WAUA 4HPXA 1UB3A 1OFDA 2FLIA 2WO5A 3WK1A 3A23A 1TO3A 3B03A 1HUVA 3W70A 1MEWA 2QEZA 3W6YA 3MYPA 3W1TA 3QSTA 1BTMA 4HPJA 3ANYA 3EEGA 1A5SA 4M7TA 4UFJA 1YXCA 4UFMA 1LLZA 3OVPA 2Y70A 1ZALA 5MHBA 1KV5A 1MZHA 3SIZA 1EP3A 2A5HA 1BEUA 2Y62A 2AQWA 4Y90A 2PRMA 3HQ1A 4HKPA 4FB7A 3GX9A 3C3NA 4I7UA 3JRKA 4FX8A 3GDMA 2QJHA 1JVNA 2X1UA 4LWWA 2QCCA 5D2WA 2B0MA 2P10A 1GVFA 4JY9A 2DJLA 3W2MA 1SZGA 1TTIA 1QR7A 4UTTC 3SW6A 3EXSA 2A2IA 2Y88A 3Q2DA 1QCWA 4XWUA 4MY1A 1QPQA 4P61A 1SSGA 1W3IA 1EX5A 1I8JA 4NZJA 3PM6A 3R5EA 3DGRA 2RDTA 1B4EA 3WFAA 4GRSA 1G7VA 3PUEA 4MFDA 3UWUA 2NV2A 1IXOA 5G1TA 4MY8A 4O57A 5TBOA 1KFKA 4JX4A 3BGJA 3G22A 3G1FA 1LYXA 1I2OA 4UMAA 1KBIA 1IXNA 3A5VA 1VCGA 3P74A 1OHLA 3KXQA 4ML9A 3A9IA 4O8RA 3NG3A 4UR7A 3U8GA 4RZ5A 1R46A 3Q58A 4NT0A 1MXSA 2NUYA 3R89A 3ZWSA 4PL2A 1SZFA 2R8WA 2CW6A 4LVBA 3MI3A 3S9YA 1KW1A 1JQXA 5FI8A 1M7OA 2H8XA 3UWYA 2LLEA 3I7QA 3GXTA 1KV8A 3LB0A 3MJYA 5AHMA 1CW2A 1WOBA 4A29A 2DP3A 2VFFA 4MLJA 1XXXA 3NEVA 3NQCA 3W1RA 1JRCA 2ZZ2A 4N4QA 3CWOX 1SU5A 4Z1DA 3HPSA 2ZDRA 4Z1AA 2ZBTA 1GG0A 4XKYA 5D02A 3IEBA 5G2WA 3TMQA 4GNJA 5FF7A 1EPXA 1W8SA 4PTNA 3B06A 1ME8A 1TTJA 5LGXA 3G8EA 3M5YA 5EA9A 2EGZA 5G1YA 4A2RA 1VS1A 4HNVA 2ZZ5A 4XQ6A 4BI6A 5F2IA 1EUNA 1O95A 3L5MA 3WJZA 2E5CA 1EIXA 3LOTA 3DXIA 3G1YA 1FXPA 3SGZA 4J9JA 3RMJA 3YPIA 4PEKA 4OU1A 1KFEA 2Q3OA 3H53A 1WX0A 8TIMA 5E93A 1N7KA 3C2OA 3NQ2A 3TQKA 3DFNA 1QOPA 4Z1BA 3CB8A 3W7KA 1FDZA 2E1DA 3NQEA 1K8ZA 1L6YA 2FB2A 4K36A 1A5CA 3NXFA 5D04C 3NM1A 2Y7DA 1RQBA 4KKXA 1ONRA 1UCWA 2QR6A 3QZEA 1OF6A 3IIPA 5LNUA 4U28A 1RQHA 3VI2A 4N9EA 4BFAA 1SFLA 4HNUA 2TMDA 2YYUA 3L65A 2ZZ1A 1DJQA 3NZRA 4WXZA 1KM2A 4EF8A 4MJMA 3S1UA 1GYLA 1X1ZA 3PB2A 2DZPA 2WNZA 4WOZA 3G24A 4HIBA 1O5KA 1IIGA 4E0CA 4IX2A 5F4SA 4D2JA 1TB3A 5C2XA 4FNRA 2YW4A 4ORMA 3LRMA 2NV1A 2YGYA 4S1FA 4FHAA 3QMTA 4AVFA 2NXIA 1SO5A 3LBCA 3PULA 1Z48A 3CWNA 3UWWA 4RKAA 3NO5A 3P60A 1OFRA 1XI3A 1DKWA 3PS7A 1GEQA 1QWGA 3B05A 4UFIA 2ZRWA 2ZTJA 3QM3A 2GOUA 3W7CA 3VCRA 4B5NA 3BG3A 4DO5A 3O05A 4Q32A 4CNPA 3B4UA 1OK6A 2RH9A 3PG9A 4Z0SA 3DENA 1H1ZA 1VHNA 3SFKA 3CQ0A 5EPDA 1ME9A 1YTEA 4LS0A 2CZDA 2VFIA 4FX7A 4OWGA 3BK0A 4RXFA 2DU2A 2E6YA 4O17A 2O7QA 2DZVA
chains in the Genus database with same CATH superfamily
4CU6A 4ZO9A 2WSQA 4GJIA 2DIJA 4KIRA 2XSBA 1CTNA 1WXJA 3WNNA 5KTLA 1JPHA 3GU2A 3FVMA 1CBGA 4R9OA 4UNLA 4MB3A 2VJXA 5G2IA 1CGTA 4UZUA 1G6CA 2CBIA 3VCCA 4MTVA 1V3JA 3CZJA 4LB3A 4IOTA 3MB9A 4K8EA 3ZSTA 1F6YA 1ISVA 3QR0A 5F4XA 1OADA 2VTFA 1V3MA 1TPH1 1JEZA 1NFGA 4IGMA 1OYBA 3S9IA 1HTIA 4F2BA 4PMQA 2FMNA 3KZSA 3BV7A 4LAOA 4AWEA 5DANA 4O52A 3B8UA 4ATDA 1UBPC 4OQVA 5T8GA 3PWIA 4G1NA 2DDXA 4LW7A 3ATZA 1O5RA 3RLUA 3B0UX 1CT5A 1PSCA 4IMGA 2VVNA 1OQFA 3CIXA 1Q63A 3CZ8A 4MWAE 2R6OA 3EX1A 1V0LA 3QGKC 3W23A 1RALA 3QVQA 4NUWA 1EHNA 1US0A 1XGDA 3WNKA 2GDQA 3DERA 2WM0A 1E72M 2EAWA 1B4KA 4GCAA 4F9DA 3KRUA 3SB0A 3A5FA 2E8YA 3C5QA 3MI6A 1AVAA 2D3NA 3W7DA 2FJUB 4PUWA 1KCKA 1ISZA 1W2PA 4O1BA 5GJNA 3R0KA 3SCTA 3AYTA 1XS2A 3PVFA 2V67A 1L6GA 3U4FA 4CD6A 5M1TA 4JTIA 1W1A1 2IQ0A 3AS0A 1CGYA 1TQXA 3H70A 5C55A 1VYPX 3CAVA 1TWWA 1CB7B 3UCCA 3WDQA 1DYSA 4MHBA 5T9BG 2HCVA 1JZ6A 1XV8A 3N3MA 2BFGA 4GKLA 1K4HA 3MCOA 1PHQA 1XCWA 4O19A 4PRWA 1O1ZA 3OB8A 3UJEA 4RX0A 1B54A 3N4FA 4NHVA 1JYVA 4UR8A 2FYMA 3WL0A 5KMYA 1H2JA 1PCWA 3RILA 4MNLA 3UZXA 1CENA 3ZT7A 4S3EA 2VC9A 4PMJA 2XYLA 4IUOA 5KZ6A 3IVTA 1IZKA 4JFTA 1LG2A 5HMDA 1MWOA 2EKCA 1XCFA 2VEFA 4AYGA 4OT7A 4P7QA 4UQEA 4WUIA 3KVKA 3KVLA 3OQEA 2CBJA 2D69A 3OBKA 5MKGB 4PMDA 3DFPA 3QRHA 2WV8A 3WBYA 4UTKA 1HL9A 1XDMA 2DVXA 4DVOA 1XLHA 1JDCA 4TVCA 2FJKA 3DH7A 3AHYA 1XYMA 4UFLA 1CGWA 3P5ZA 3RK8A 3H7RA 2DSKA 4I7VA 1NEYA 3AISA 2Z26A 3ONBA 3ZJKA 4O4VA 4DJFD 1JR1A 4LYQA 2FVLA 2Z1WA 1GQKA 2H90A 1UKOA 1ZAJA 4S3GA 2V81A 3W1MA 3SECA 4AY7A 4JKLA 5G1MA 3M7WA 3NJ3A 5DMNA 4L7ZA 1M9HA 3W4RA 4BF7A 5F1VA 1H7PA 4ZQCA 5F4WA 2XN0A 2INFA 1AQ0A 2GUYA 1QPKA 5AECA 1OCNA 1X6NA 1DJWA 1EC9A 2ODOA 2NQJA 1ADDA 1L2QA 4H9XA 2BNJA 4F0MA 4A05A 3VX0A 1JPDX 1VD6A 4WD0A 1QJWA 2X30A 4HNOA 3ENLA 4JICA 1AL7A 2PWDA 2CYGA 2QV4A 4RE2A 1Z9AA 4PUEA 1MZRA 2GVLA 4GACA 4PMRA 5CCZA 4IMEA 1KFLA 4E3VA 5FJJA 1BAGA 5D05A 3NQ8A 4C6BA 4YWIA 4QS5A 3VNLA 4A4AA 5I09A 1J96A 1TPFA 4QS6A 1Q4WA 3TQPA 3AU2A 4HNLA 4XKYB 3VTRA 4LUTB 1RVGA 1SJCA 2B7PA 4NJHA 3GBDA 2G96A 1UOKA 4ZO6A 1S5TA 2GVJA 3CXOA 1XKYA 4W89A 1FDYA 4GVGA 4JEQA 5AC7A 2WMKA 2CHOA 4HHPA 2VO5A 1IZCA 4HNNA 2DORA 1X98A 3LBMA 4UBPC 2ZIDA 2O9OA 3C2EA 3EKZA 1M68A 5E9AA 3NPVA 3WZ0E 4KQNA 4NAFA 2CLOA 3S5NA 2I7GA 2NV9A 1TV8A 1JYWA 3W1AA 5LA0A 1S2UA 2EQDA 1BWKA 4FXSA 3WQGA 3L0KA 2XM1A 1NH6A 4LFYA 3QC3A 3R12A 1YYAA 2VZUA 2FTWA 3GH5A 4PCNA 3NO1A 3V16A 1LWHA 2YCLA 3HBLA 3VZXA 3O0KA 5L6UA 2WBKA 3TYDA 3WDIA 1NJJA 4B91A 1QBAA 3AWOA 5GJPA 4W85A 2OEMA 2ATMA 5AB3A 1W0MA 1SZEA 3C2VA 4GQGA 5A6SA 4X22A 3G5EA 4QJ1A 3WK3A 1XH1A 1M7XA 2NXGA 3W7GA 3SAZA 4FALA 3W29A 1NU5A 1R47A 1IEXA 3H2NA 4XIAA 5FF4A 3CUGA 3E9AA 3H23A 1HO1A 1WDSA 1QPNA 3JW7A 3KOZA 2CLPA 2QDEA 1GQLA 1FWDC 4PB4A 3QTPA 3WLHA 2Y89A 2PDWA 3M5ZA 4LT9A 3ZWTA 2NQHA 2ZX5A 5I3GA 2WC7A 4F4RA 3C0JA 3N2MA 2IKGA 4JTSA 2V2CA 1Z3NA 3UXIA 4R7WA 5JH1A 4E5TA 1CXEA 3PSVA 4HPNA 4LC8A 3IJDA 3I10A 1XD0A 3GDBA 1J9YA 1XIIA 1YXYA 3AHVA 4W93A 1B3OA 4G8TA 4OECA 1W1B1 1ADSA 3MKKA 4P7NA 1XIJA 2VRQA 2JEQA 2O0TA 1IE7C 4O10A 1B2YA 1P0EA 2V5DA 4QNWA 1KBLA 3S2JA 1XLDA 3U5UA 2YSWA 4L61A 2ZZ6A 4QDMA 2PC4A 2R82A 3KX6A 4M51A 3N15A 3GK0A 2C13A 3TUUA 3DIPA 3ES7A 3MDUA 3E2QA 3G1HA 3PBGA 3DFOA 4OBRA 4FXFA 1V6UA 4XAPA 2VGGA 1GJPA 1K7FA 5BWFA 1OZQA 1TJPA 4LQ1A 1UUQA 1WBJA 2HZGA 2QGYA 1CGUA 1E70M 3B04A 4J3SA 4JQAA 1DJZA 1GGOA 1SQ7A 4ZODA 4F66A 3KCLA 4IJBA 4JTFA 5ECVA 2WZTA 3VYLA 3SDOA 5FA5A 4BWLC 2TRSA 1YXDA 1Z8AA 1H41A 3TW9A 5I2UA 2D0FA 1REQA 3V4BA 1W5MA 4RJEA 1KR0A 4V33A 3GXMA 3SJNA 4KGJA 5EMUA 2HV5A 2A1YA 4Y8FA 4W7WA 4ATWA 1KTNA 4ML4A 1SYTA 3VOJA 3GH4A 1T8XA 1B30A 3KHDA 1F8MA 3RM4A 5G4EA 4FIRA 3SY5A 1V02A 1YW1A 3SIMA 1OC5A 1OG0A 3BTNA 3E2SA 3H2AA 1WZKA 3O06A 2CITA 3PUGA 3TXVA 2CLEA 2OSYA 4GA8A 1NWSA 4UB9A 4B5SA 2QPSA 5DT7A 1PX8A 3L23A 4PUNA 2I16A 1RPKA 3N11A 1EGMA 5KZDA 3ID7A 4GQ0A 4TR9A 4LS1A 2BY0A 2OKOA 1NFBA 1A5UA 4DAIA 4AHOA 1XDJA 4NNCA 1FRBA 4PEEA 2PDJA 2PZ0A 3TE9A 3R94A 3CL7A 4WGXA 4TX6A 3MUZ1 3QY6A 2XZ7A 4MIMA 2G5WA 3LLDA 1SPQA 2QF8A 3BAKA 4KCWA 3D47A 2XVNA 1FH7A 1J0HA 1X1OA 4JXCA 2W5FA 1KGUA 4GGHA 3L68A 5FEWA 1Y5XA 4HT3A 4JR5A 5D2VA 4IGHA 3TCSA 1JJKA 1PIIA 4QIUA 1VZWA 2G37A 4HP5A 1RCQA 3S42A 4DBEA 2GQ8A 3RGTA 2XINA 3F2BA 1WYIA 4XVDA 3VCNA 3QQ0A 3OZYA 1R85A 1FBAA 3ITXA 3RM8A 3TQVA 3VGDA 3AOFA 1QO2A 2A85A 4E2DA 2TODA 3NQVA 4NP7A 1K9TA 1AJZA 1VPXA 1G4EA 1VENA 3CC1A 2I14A 4D6JA 3MTWA 3R0DA 1UWSA 4C6KA 4P5UA 3TFCA 3OVQA 4KESA 1VYSX 3GU1A 2V69A 2J27A 3O6CA 1EJSC 2DH2A 4QE4A 4U5IA 1C93A 5CPSA 2PTXA 3GRIA 3CO4A 3EGJA 5JUVA 3GDKA 1ONXA 4NX5A 6TIMA 1SJAA 3FS2A 3CBWA 3C2FA 4JFSA 4GG9A 3WUFA 2W9MA 5KSWA 1B90A 1TYGA 4A3UA 1H7NA 3MZNA 2PDBA 4R7JA 3KFTA 3AXKA 1A5OC 3B8WA 3CMGA 5E9XA 4X2RA 4E3TA 3ONCA 3ICJA 1FWEC 2UWFA 4JTKA 2CXEA 1ZLPA 3L0GA 1PX4A 4Y96A 4L56A 4D1JA 1DJNA 5KZMA 2ZE0A 3VIMA 4WCJA 1TA3B 2EHHA 4DN1A 1F8IA 2VDHA 3W3OA 3M0KA 3C0SA 1EOMA 4Q8MA 3N13A 2P8CA 1AQFA 1RCXB 1I4NA 1A5NC 3SQSA 2WLZA 4ZE4A 1T99A 4XUGA 2Y5SA 2PWEA 1ZBCA 3MANA 2GVYA 1QMLA 1LF1A 1C7SA 2A0NA 4ZQMA 3HTWA 2XFWA 1EO5A 1QT1A 1J11A 4M6VA 2J88A 5I06A 1PUDA 1U5HA 3EMQA 1FFQA 1J0KA 2W63A 3I4KA 4AXNA 3MMDA 4ZTXA 2HS8A 2XH7A 1PZ1A 1ICPA 2X2GA 2P0IA 3AXMA 4MB1A 4X0VA 3V1PA 4GXPA 4Y9PA 1EQPA 1EH9A 4DWSC 5C6MA 1K70A 3N2XA 4FNQA 3BOXA 1J0ZA 2DZSA 3SFWA 4PYSA 5ABGA 4J3VA 1HVQA 1XIMA 5A2BA 5I7GA 3THUA 3O16A 6PTDA 3TX9A 4J35A 1MEIA 1B3ZA 2PB1A 2Z27A 1OD0A 1P5BA 1YADA 2AMGA 2E4TA 5BZAA 2EPKX 2NXHA 1E1EA 3LTPA 2NWSA 1WZMA 1I0BA 1V0KA 3ZZ1A 2EPMX 3E0WA 2ZX6A 4NAFB 3MVIA 3T40A 3EKLA 2WNNA 3GDRA 1BGAA 4PR4A 1X1NA 1CLXA 4MGGA 5AYIA 3MS8A 4E8DA 1FCVA 3WJYA 2PWFA 3B0VC 3RUBL 1FFRA 3DC8A 2YCLB 1PCKA 2DUZA 4OZOA 4AEOA 3K13A 2PODA 3IIZA 2ZUNA 5G4HC 1ITXA 3M6DA 4WJXA 2HVMA 3OZMA 3S47A 5HR7A 4YTSA 1W3NA 3K4AA 2FHBA 3QMRA 1KXVA 4ERIA 1UIPA 4HBKA 2NQ5A 4X9SA 3LCXA 4GQBA 3HGRA 4W5UA 3B8SA 4D8LA 1Q6OA 2HEJA 3CU2A 3SI9A 1O12A 5DRCA 1DTUA 3PF3A 2VVSA 4JHMA 3VD4A 4ZZ9A 4HN8A 2A3HA 2WSRA 4RUBA 1TTPA 3R8GA 4DJDD 3EZ4A 1N55A 4XKMA 2YDAA 2YYTA 3N14A 4CNOA 5AVHA 1VB9A 4HNTA 4K3ZA 5IHRA 2ZA3A 4DI9A 9XIMA 3BJSA 2PTZA 4OIFA 1TCMA 1RBLA 3O2LA 1HKVA 4GZEA 4XX6A 4ZOEA 4GZ7A 3IK4A 3URNA 1GKQA 3VU2A 3QV8A 1V0MA 4MNKA 2NUWA 2D0HA 4A3YA 3DHFA 1WA3A 2AOSA 2D2OA 1JFXA 4JYDA 1ESWA 2AKMA 4EP8C 5FEZA 1R7OA 2WWDA 1XJBA 2XVKA 4L9YA 4UFKA 1GVSA 4B5WA 3F4DA 3FJLA 3Q45A 4U33A 3HPAA 4ZB5A 4PB5A 4US6A 1GVQA 4JN8A 4DHGA 2YDQA 3IGSA 4AZGA 4K37A 4REQA 3T78A 1TG7A 3PZQA 3NA8A 2O9TA 2WJFA 3IVUA 4DM2A 3VIFA 2BODX 5CZ0A 3AUOA 4RZ4A 3W7RA 2ESCA 2OKTA 2D3LA 1SO4A 4Q8WA 1QI3A 2D2HA 3TQ0A 2A3EA 1EJVC 4D8AA 4ALDA 5DXXA 1FWTA 3VKKA 4PGLA 1GPWA 3IIXA 4FOKA 5CLTA 4ACZA 4EWJA 3B3DA 3PG8A 4YXGA 3LMZA 1YBQA 5EB8A 1CX9A 1KA9F 1JXJA 4PMUA 4GY7A 4JTGA 1XPGA 4IJCA 4GKTA 4U10A 3FDKA 4M0XA 3G1XA 1G01A 4LJ3A 3WUBA 4XZWA 2QDGA 1REQB 3GZ3A 3IAQA 4IMFA 4DB7A 2F6KA 5D4YA 2C8NA 1BKSA 2MANA 3PBYA 1AQMA 2F84A 2PP1A 5H1WA 4C6EA 1TX2A 5AKQA 1QASA 3CJPA 4J2PA 4C6DA 1L6WA 1G4PA 3MMUA 1HXJA 3T05A 1XM3A 1AZ2A 3N29A 5AYZA 2FH6A 4EF9A 1UZHA 1TUFA 2X09A 1VLIA 2PURA 1JPKA 1VGAA 4UTIA 3TDFA 4CKQA 4RV8A 3KCOA 3MSGA 2XSXA 2RFGA 3SUVA 2PTDA 3S2MA 3RX3A 4MKSA 1QPRA 1AL8A 4ZR8A 3NQGA 4IZGA 2OT0A 2X1SA 1I75A 1H7RA 3WH7A 1KM3A 2CLIA 4L5ZA 5A8OA 4QCEA 1TIMA 5RUBA 4WKHA 1MMFA 3NL2A 4A8IA 1XQLA 2ZWZA 3W2JA 1YRRA 4FXJA 3L66A 3T44A 2I57A 3CIVA 1PPIA 1A53A 2ZRYA 3WQEA 1POKA 2V5JA 1HGYA 2WYSA 4DUXA 3EWWA 3K5XA 4ZA0A 1UR8A 3CUXA 2PWUA 4LUJA 2DSWA 3NPXA 4H6RA 1M41A 5IBXA 4Q4SA 2PRHA 3NM3A 4A21A 3WCZA 2XFFA 3W72A 2PDGA 1MFVA 3ZOAA 3T8LA 1YMYA 1XLFA 3AS2A 1O6IA 3VUPA 2PWVA 3W1PA 4HA3A 4NNAA 4UOJA 3S5OA 1LOQA 1RP8A 3IGXA 3I7SA 3C3UA 1XP3A 3PBMA 3PTMA 4E4UA 2G4FA 2V3GA 5EFFA 4WKFA 1LOSA 5A8PA 1CXHA 4ICCX 5A8GA 4C1KA 1AJ0A 2QUNA 4LVDA 3UP8A 1OGGA 1HJQA 5I0DA 2WZMA 1WKYA 4NRRA 2H6RA 3L4WA 4CQBA 1O4UA 3RLVA 5LA1A 4R88A 3CO8A 2QULA 4NZ5A 1E3XA 4FX6M 4TIMA 1UR9A 1FY6A 3P0XA 2QMJA 3E3HA 5CG7A 2WSPA 4R85A 2FQIA 2V0TA 3SRDA 3ZMRA 4I5UA 1HIZA 1KTBA 1C7TA 4LUIA 1S2AA 4I9JA 5ABEA 3EB3A 2V3FA 1XIDA 4H2HA 1WPCA 3SUSA 2WMFA 1XR2A 4I7WA 5CPQA 4I9AA 3OU8A 2J8GA 2PGWA 5ECUA 3FK4A 4C6NA 2WHKA 3E49A 2I17A 3G3DA 2QHAA 2GGHA 5B7ZA 3UNDA 5HWJA 1VRDA 5HINA 4IIGA 3IS4A 1UR0A 1F3WA 3GFZA 2CLKA 5ABTA 3RLGA 2WMGA 4W7VA 4JL1A 1N8WA 4LBUA 5AYYA 3WLLA 2RUSA 3HGSA 1ZQ5A 2QZRA 1UROA 4U31A 1P1XA 2Z1SA 5HPCA 3C6CA 3DFYA 5K4ZA 2YB1A 1JZ8A 2OFJA 3GHRA 1AD4A 3N9KA 1FWNA 1VLWA 2DPEA 3NGFA 5D32A 3GC5A 2WM1A 1E15A 1ZCCA 3LHUA 5G5IA 1H62A 2VT0A 1NDVA 4E8CA 2PDFA 2G3FA 5DN1A 3CPRA 4Z1CA 3L4XA 4M8UA 3S6TA 1RK5A 3C56A 3HB9A 5HUPA 1G5AA 2ZVRA 3EA3A 3O1NA 3VNZA 5BXRA 2VR5A 2WQPA 3LGDA 1RP9A 3MA8A 1BTCA 2YBUA 1UKSA 3T0TA 1ZP3A 3MYPA 1EBHA 3VC5A 4IH3A 1A47A 1A5SA 4M7TA 4EAYA 3SCPA 1LLZA 1C8YA 2AMXA 4PMNA 3DX5A 2RAGA 3EWCA 4MAZA 2XH2A 4Y90A 3UG3A 4HKPA 3GX9A 1X97A 2OOFA 4OBSA 3GDMA 4GVHA 1M1BA 3ARPA 3SBFA 3KRBA 1JG9A 1LUCA 2DJLA 3W2MA 1C8XA 1SZGA 3SW6A 2A2IA 4Q3MA 1QCWA 4XWUA 3U4AA 1QPQA 3R58A 4FK9A 3EOUA 1Q7QA 2ZUWA 1TVLA 2Y2WA 1G7VA 1P6BA 4AIBA 3NXLA 1WXYA 4MFDA 3LPFA 4QSFA 4FOUA 3SCOA 4GK8A 4MY8A 2VI0A 1KFKA 3BGJA 2DT3A 3G1FA 4UMAA 1KBIA 3A5VA 3CV7A 1EC8A 4M1RA 4ML9A 3A9IA 4CEXC 1JIBA 4NT0A 3GUWA 2NUYA 3TOPA 3ZWSA 2TAAA 1GOKA 4TOQA 3WH8A 2CW6A 3R0UA 1DJGA 2NVCA 1R9ZA 2ISDA 1QW9A 1FKWA 1SZRA 2LLEA 3MSYA 5CAKA 1E73M 3PJUA 3LB0A 3VNKA 5AHMA 4GABA 1XXXA 3L4TA 3WNOA 4N4QA 4Z1DA 2PDCA 3M0XA 4Z1AA 3RHGA 1ZBWA 3AZTA 3RPTA 2AKZA 4ACZB 4GCXA 1YBQB 3B06A 1ME8A 5IXEA 3M5YA 2EGZA 4HJWA 2PDHA 4BI6A 5F2IA 1EUNA 3DEQA 3WH6A 3QTGA 5D9MA 2E5CA 1U5VA 3NEHA 1FXPA 3RMJA 2O9RA 4OU1A 2D2JA 5E93A 3TQKA 3SCVA 3WD4A 3CB8A 3H4GA 4NY2A 4JAWA 1FWFC 2W3ZA 4DYKA 1BXBA 3WD3A 5D04C 4IGSA 3K4DA 4I3GA 3NM1A 4DUVA 1RQBA 4KKXA 3AHTA 3A12A 3QZEA 1A5MC 4U28A 2R9RA 1EGZA 1SFLA 4HNUA 2TMDA 1Q85A 2XIQA 3VXGA 4UR9A 1GYLA 4FR6A 1PXGA 2VZOA 1OEPA 2GGJA 1R3QA 2E9MA 4NL1A 4E0CA 4IX2A 5M2FX 1TB3A 5C2XA 4FNRA 3GHUA 1KFWA 2NXIA 3LBCA 3VX1A 4QCFA 5I00A 4P8VA 4AY1A 4KMQA 1OFRA 2GJXA 2ZTJA 2Z25A 5LIUX 2WBGA 2DUAA 4CN4A 4C90A 3VOFA 4YN5A 3NZPA 2Q8XA 1OK6A 3TVAA 3IUIA 3DENA 1H1ZA 1VHNA 5EPDA 1FH8A 3CQIA 4IP4A 5EMLA 1YTEA 2XFYA 1B3XA 1FWBC 1JNDA 1DIOA 4RXFA 1LQAA 2O7QA 1TREA 1L8NA 4J5NA 1QDSA 2X05A 1E0VA 5SWUA 1M5WA 1EA9C 4Q8PA 5CPOA 1JRBA 1EX1A 2FFCA 4YCOA 4AUBA 1D8WA 3LV6A 5HMFA 3R11A 4IG2A 2YCKX 5M03A 1FWGC 3HIJA 4DPQA 3PPHA 1K3UA 2PZNA 4H1ZA 5I24A 3WQFA 3TNBA 1I1WA 4ZVJA 3Q65A 1SR0A 1KM5A 1BYAA 3EB2A 3WDRA 3I3DA 1Y7VA 1ITUA 3LX9A 2WVUA 1WQ5A 5CEWA 3PZ9A 3AYRA 4J4KA 4F0RA 2FIQA 4MNMA 2IUZA 3BAJA 4B2DA 4J3TA 3UGVA 3FA5A 3UEQA 3W7JA 3PANA 3U2ZA 2D23A 1GOOA 5XIMA 1EEXA 1FVPA 5A95A 3R2GA 3W0KA 1S1PA 2YPIA 3H6OA 5C9ZA 3OP2A 1HF6A 1DBTA 1GG1A 5GJMA 1NOUA 2OO6A 4Y2WA 4QSHA 3NGJA 3SEPA 1XLMA 1R5YA 1A4MA 2BVTA 2J7CA 4GBDA 2DVTA 2FMOA 1E0XA 1XLKA 3DDMA 2ONEA 2PS2A 3WLSA 3ZJ8A 5PTDA 2GQ9A 1BFNA 2CZFA 3ITCA 2WCAA 4PB3A 1PV8A 3TEVA 3W73A 3G1VA 3CQHA 2VDGA 3SURA 3KWXA 4EXBA 3WSUA 3TH6A 5KINA 3JS3A 3UPWA 3A3XA 3HG4A 3BAIA 3NVDA 1GQJA 5HMEA 4O14A 2HPIA 3NR0A 3KVJA 4XZMX 1W3HA 3VKBA 3WLRA 2Y7EA 3WLJA 1TV4A 2JGQA 3L9CA 1PZ0A 1BQGA 1OBAA 2BY1A 3TJLA 3ES8A 4BA0A 4KCTA 2UV8G 1V0NA 1XG3A 3GR8A 3TN4A 4FLRA 1EC7A 4PL1A 4QGCA 3C2YA 3CYJA 3T0AA 2QJIA 3LRLA 2ADAA 3UPBA 3UXAA 4I6VA 4Q4QA 4EWND 3WJXA 2VOMA 4FEZA 3S6OA 1EQCA 1TFVA 3UY7A 1XYCA 1IR2A 2X1TA 4LU0A 4Q8TA 1UIOA 2NWRA 3ZR6A 3CV6A 1L6SA 3RAOA 1O66A 3ITYA 2Q8ZA 4LPCA 1RBAA 2C6QA 3GFYA 3GH7A 3T1GA 3UG4A 3IAPA 1SM9A 3GSMA 4X9YA 1JDFA 2A4AA 2B7OA 2TPSA 1UWAA 1W1IE 2JK2A 3P8IA 3L5AA 2H9AA 5L9FA 1EZ2A 3GXNA 4G7FA 2FDMA 3CL6A 3UETA 4QNEA 1AA1B 4UQCA 2GK1A 3WJSA 3TZNA 2PDNA 3WQ6A 5H8UA 3SSJA 3BG9A 5JMUA 3UY8A 4O0KA 3WENA 1GT8A 2CHNA 1RSCA 1VIZA 1XL9A 3F4WA 1AZ1A 2F6XA 1DOSA 3PZGA 2Z2UA 3HQNA 3DG6A 4HU0A 3FJNA 1UBSA 4UOQA 3MBDA 1SJDA 3E02A 5CPNA 5CGTA 1UUMA 1D9EA 4DJFC 3WLNA 1LUCB 5EMJA 4F0KA 4AHPA 4PFHA 4O8AA 1HL2A 4ZTYA 4NI8A 2Q01A 4FNUA 3CQJA 3KHJA 5JXQA 3NSMA 1HVXA 1OCJA 1GWJA 1FXQA 3QQ1A 4LVFA 5I6SA 4ACYA 3AXXA 4LEQA 3D5HA 1K4GA 5A8NA 4QJ4B 5A6BA 3UR2A 3GC4A 4B3ZA 1RPXA 3LSBA 3CH0A 4MMWA 2HMCA 3SCUA 4C60A 3U7BA 3M4HA 4GXMA 3WJWA 4Z42C 1GK8A 3MT1A 5LHEA 3AIVA 2VX5A 4CD5A 2EKGA 5AYBA 5EY5A 2QMKA 4U3AA 5GNZA 2QUTA 4X0NA 1AW5A 4WZHA 4LRTA 2PBOA 3W7OA 2FZ8A 4RDWA 1Q8AA 1D3HA 4FOJA 2W0UA 2VFEA 1WB0A 2C15A 2XN1A 4UUIA 4ADSA 1CZ1A 1W9XA 1QATA 3N1AA 3HU7A 3TYEA 4H3DA 5JU6A 3L4UA 4A6GA 3RPMA 4GI4A 4GJJA 1PBGA 4BI7A 5K4XA 3A3HA 4FI4A 3LTSA 4GY0A 1WV2A 2PSNA 4RE0A 1CXIA 4GFSA 3APGA 2A6LA 3ALGA 4E2OA 4ZOAA 1RBOB 5I3IA 3RX2A 5C5YA 4XUYA 1QAPA 1HJSA 2QCNA 4KT2A 4GO8A 4JCMA 3MC5A 1LOLA 4UTHA 4DLMA 1E6XM 2OYLA 1VFHA 3DFQA 4M24A 5FESA 4LF1A 2IPFA 4PZVA 3WK0A 1Z41A 1C9WA 2OR2A 2D73A 1C91A 1GVRA 2Y5EA 3C2RA 1TRDA 3MV01 1EF3A 4TMCA 4J40A 2NVDA 4DBUA 2RGMA 4UFHA 5FSEC 1MW3A 2VXNA 3EDJA 3N3TA 2OYKA 1JUBA 1SVDA 3U48A 3S0CA 1J5SA 2J25A 5XINA 1TWIA 1IGWA 4N6FA 2XH0A 1W5OA 1SO3A 1C8VA 4J3UA 5FJOA 4D72A 1EDTA 4BWLA 3RG6A 4B16A 2NQZA 1Q2RA 4UQDA 3TWAA 2GJXB 3LCWA 2FGZA 1HKWA 5KITA 1MUWA 3BAYA 4N6EA 5CJ5A 4HSNA 2CLMA 2VZSA 1B5TA 3GFXA 3H2EA 2XVPA 5LNVA 4GHRA 4K7YA 3Q94A 1TZ9A 3W07A 1JQVA 4RW3A 1SW7A 3GC2A 1TSIA 3AHXA 4CCCA 3V0UA 1WDWA 5D9NA 2AQOA 3IUDA 4UOZA 3DKJA 1RZMA 2OZTA 4NQ1A 3GKAA 2C3ZA 1TR1A 4IG2B 3XISA 3ABRA 4HMDA 1V08A 1QO5A 1R2RA 3VE7A 4BS0A 4LC6A 2ZZ4A 1GOXA 3B4YA 1K9EA 3ZJ7A 2INZA 5CXPA 1ME7A 2ZC8A 2H8ZA 3FV9A 3PJTA 3RPDA 3K1GA 2A7PA 1J18A 4HJFA 4C7DA 3EMZA 2G50A 3L5LA 3E0IA 3G0XA 4PBFA 3LI1A 4DZIA 1Q6EA 1F4HA 2FHFA 2J6VA 4O11A 1X6UA 1DEDA 4LGXA 3RLHA 2DZUA 3QPEA 3VNDA 1K03A 1FWWA 5F7UA 5H6HA 1UR4A 1A3WA 4JD4A 3E0FA 4BF9A 1XRTA 5BNKA 2ZKMX 4DUOA 4XBSA 3QJAA 3A4XA 3N2OA 1VPQA 5B80A 2P8BA 3C52A 1JUKA 4O13A 3BH4A 4C6FA 4AZCA 1Q2SA 1RHCA 2RHGA 1T96A 3NSXA 4C1LA 2H3DA 4ZCWA 1X8CA 5D2YA 3KP1A 5AHNA 1N82A 4TUFA 1LBLA 3AROA 1OT1A 1W9VA 1KM6A 4LOCA 4ZO8A 3W26A 2BHUA 3BLLA 1MNSA 3QY8A 1LQ0A 3P82A 5AYXA 1QFEA 4QE1A 1OX4A 4J3XA 1CXLA 4RDYA 5IM51 2VR2A 1K6AA 3CL8A 1ZJBA 2A3AA 5D03A 2RDXA 2WSYA 4IP5A 5DXYA 5M5DA 1JCYA 2PFHA 2WCGA 3CYVA 4F0LA 3VGGA 1KRAC 3AALA 4HMNA 5FL0A 2GDVA 3ZQ9A 4JGDA 1SGJA 3LHWA 3HG5A 4BCEA 2WW5A 4KETA 4P8XA 4DJED 3N6HA 4ZFCA 4FZIA 3BJFA 3ARTA 2Y63A 1ISWA 3VOGA 5HA7A 2YB4A 3TJ4A 3P84A 3W71A 5AN7A 3HQPA 4XK2A 1OGSA 4E4FA 3E6EA 4C6MA 3NL3A 1FP8A 5DFAA 1XBYA 5I78A 1TE6A 2A6NA 1VHCA 3O7UA 2QJJA 5D38A 3RRXA 2UY4A 4H4IA 3M44A 1KKOA 1QOXA 1VC4A 4PFMA 1L6FA 2NLYA 1LM1A 5B7YA 1XLIA 1KR1A 4UTLA 1XX1A 3OVGA 5I79A 4YTUA 3GS6A 1X7FA 1UW9A 2J7FA 1RJPA 1E6PA 3TTEA 2B7NA 1M6JA 3O63A 3M9YA 3AJ7A 4DWSA 4C65A 2H9AB 1PVNA 1EEPA 3MWAA 1F07A 1R7AA 1UJPA 3M16A 3DHDA 2XM2A 3LM3A 4UTJA 2ZX8A 3IJIA 3WF3A 4IM4A 2GK1B 2QVNA 1N2VA 3AYVA 3W75A 3LHZA 3LCHA 3S2NA 2R24A 4HYRA 3B9NA 4LUYA 3SRHA 3E1F1 3EWDA 3TJXA 2GJPA 1E51A 3NZQA 1VBHA 5A6JA 3IVSA 5ABFA 1LROA 2QPUA 3LD5A 2BXZA 3AIBA 3AUJA 1F4AA 4G6CA 4OBTA 1QHZA 4E2BA 4RR4A 1HW6A 4XAZA 3UJRA 1Q6GA 5JH2A 3KS5A 2DY3A 1E6QM 4N2YA 5DY3A 2I1OA 4XSMA 2E6AA 4LF2A 1UG6A 6ENLA 3V5CA 4P2VA 2IS7A 4LS2A 2WPGA 2HE8A 5C2GA 1NAL1 4Q4MA 5I3DA 4IFRA 2QAFA 2E67A 3HPXA 4GUGA 4HPHA 1TMQA 3P80A 3IJ7A 3W53A 2AGTA 4P7OA 2JALA 3H7UA 3TTSA 3WFLA 2WC4A 5A5WA 1ZNNA 2V68A 4FPSA 3V3WA 4PE8A 4W87A 4Q4KA 4BEQA 4AB4A 1J6OA 7A3HA 4KWWA 3N04A 1XSJA 3KVMA 2DQWA 2Q8LA 3MHUA 3VMPA 4XBKA 2XH4A 1LRNA 5I07A 3E2VA 3GHSA 2GJRA 2W62A 5EBUA 1UC4A 2HRWA 1YNPA 4AC1X 2CC0A 4Z2GA 4Q8OA 1DIEA 1VFUA 1IXPA 4M19A 5CBJA 1AMYA 2J47A 4LYKA 4OOUA 1ZPTA 1CB2A 4LUSA 3TTQA 5K3VA 2EG8A 2WNWA 1BRLA 4X3ZA 3U2OA 3R79A 3HF3A 4DAFA 4B5VA 2BG5A 3DBPA 1Z42A 2TSYA 5FCZA 4QISA 1ECQA 3R10A 5DX7A 3CEUA 2PLCA 4YTTA 4P7RA 4YNGA 5U4NA 4AQLA 1ZFJA 4ZQOA 4RE4A 4QROA 1LORA 2FGLA 3HGOA 1ISXA 1RXOB 1XWYA 2XU2A 1N8FA 3SJ3A 4FP1A 2OGYA 2XPKA 4JZ5A 2CCRA 1EF2A 6CGTA 3S5ZA 4MUPA 1MQPA 1F05A 1OCBA 4OVXA 3BO9A 1SUXA 3QY7A 4UTWC 4JTRA 3WQ4A 1KLZA 5J5RA 2I56A 1G67A 1P43A 1XRVA 2O9PA 4BQ3A 3MP4A 3T0DA 1MEHA 1E9ZB 1S2TA 3PBWA 4PSRA 3TJIA 1KCXA 1VJZA 4DJDC 2J77A 4UC5A 2DZWA 4NZ3A 4UZSA 2BLEA 5C7HA 4BK9A 5C7VA 3EYPA 3U57A 4MNJA 1QI5A 2F38A 1FWSA 4ROPA 4E6MA 4OFCA 3QFEA 4W4QA 3OOQA 4Z08A 2P3EA 2G0WA 3THDA 5A6BD 5I02A 2HXTA 1DXEA 1E6NA 3G6LA 1CECA 2ABAA 2CBVA 3QW3A 3UZYA 5AZ1A 2PE4A 1FUYA 4HZMA 3CZLA 3QGVA 1TMLA 3EDKA 1TPEA 4P8UA 2TYSA 3P8JA 3LRKA 4KGLA 3A9BA 1EJXC 1X96A 3KL3A 3U2CA 3TP4A 3VGEA 2HVOA 2I9UA 1J8VA 3M07A 3FKKA 3S8HA 3N6JA 3BSMA 3U5YA 3VIIA 3QPYA 1DWIM 4ILSA 1HG3A 4KBXA 4WXYA 3IWPA 4EX4A 4KIEA 4MOZA 3RCYA 3TC7A 3IIOA 4QTGA 1P6WA 5BU6A 4YHEA 4LY8A 3PZTA 3TAOA 4O50A 1VCFA 5CZSA 2VZTA 1G1YA 1D7KA 3TTOA 3F2CA 1J2BA 1JFHA 1PIGA 1R3YA 1IEVA 4GX8A 3A24A 4JNMA 4GGBA 3NOEA 3RJXA 5TNVA 3O8AA 4JX5A 4A22A 3QV7A 4NJIA 4NX0A 2XWDA 1AD1A 4AZCB 1H51A 3BC9A 1Q66A 3O6DA 3OBAA 3V5FA 4AIUA 3FW6A 3GNRA 2WK2A 4KEVA 4WOQA 4TX8A 2I5QA 4IIBA 4YTRA 4X2PA 2J6XA 4IPIA 4LAZA 1I60A 4C6OA 3MYOA 1OX4B 1PO9A 3BQ5A 2J7HA 1VAHA 5AY7A 3VD7A 4IMCA 4CVUA 4GUJA 2XN2A 5LNRA 2QYGA 3CT7A 4DF2A 3W28A 1UZDA 3T4CA 4HHHA 1THFD 4WGHA 2VCBA 2C14A 3FJ4A 5HWNA 1XISA 3LLXA 3QKZA 3M46A 3MI2A 2H3BA 1FTXA 4H9MA 2ZVIA 4WY0F 3T42A 3LUTA 3GTHA 1UR2A 1XFBA 3NDOA 1GVIA 3F4CA 2FZMA 1C92A 3MHGA 1I9CB 1SW0A 2YZRA 2VD9A 1WDDA 1VH7A 1XDLA 2EPHA 3S2LA 3TROA 2OLHA 4JY8A 4LV9A 1BSLA 5KZEA 1R38A 3F03K 3U3HA 4ZO7A 2PMQA 3EWXA 3N4AA 1A49A 3N4EA 3GVGA 4WVXA 2QIWA 3COTA 4TO8A 1LBMA 2PGEA 1KFCA 4CU7A 1JCLA 1KWKA 4JIPA 4F2UA 4DO7A 1RJQA 2P3ZA 3IACA 1NDYA 1WZAA 1Z69A 1RD5A 3TCEA 1GNXA 2HISA 1V6WA 1J93A 2NX1A 2V30A 4C5ZA 7ODCA 4IT1A 1JULA 2WZHA 3P81A 3W74A 4UWMA 1UKTA 7TAAA 5IFPA 5HNRA 3HG2A 2ZDSA 2X7VA 2P53A 2XIJA 1QHOA 5A2AA 4MAVA 4DZ5A 4DWSB 4N4PA 4PSPA 5CZTA 5T91A 2Z0IA 1VP5A 4DNHA 4K1GA 3TYAA 2WKGA 3EA1A 1KFBA 1RLDA 3VOHA 3VD3A 4B5XA 1P4CA 3S3GA 3FCPA 4HB7A 4A8RA 1OFBA 4Q7IA 3WX7A 4B9ZA 3CAKA 3M1ZA 1OCQA 3GYEA 1VRXA 4V1YA 3PFMA 5EMMA 2EG7A 5H8MA 5ABFB 2PDUA 1S5NA 1UP3A 1UP2A 2X0YA 4QQ3A 4AMAA 2HBVA 3BE7A 3BDKA 5FIPA 5HJLA 3W83A 1TMHA 2ANUA 1CLVA 3WLTA 2VCAA 1K8XA 1R87A 5FF3A 3RRAA 4F8XA 3C61A 5EGRA 2DJXA 1S46A 5AHIA 4KFPA 1MW0A 2DSVA 2OG9A 2ZZ3A 1H50A 2RDUA 1ZAIA 2YBTA 4GOAA 3FDGA 4GJ1A 1M03A 3TR2A 3UR5A 4AIEA 1WOAA 1E71M 4DXVA 3FXGA 4OGZA 1EA0A 3VE9A 3OJGA 5AFDA 1UWUA 2Q71A 1IGSA 4PRTA 1V7YA 1BVWA 1EHAA 4U4MA 1OINA 2DIKA 6XIMA 3LQLA 2GJNA 4B5TA 4JN6A 5EL1A 3CLMA 3K1DA 5CC3A 1JGMA 4ICMA 4WY0A 1DXIA 4MZ8A 3W24A 3LY0A 1WUEA 3K8KA 2YCEA 4E38A 4KFNA 1SJBA 1XICA 2X16A 4D6CA 5KETA 3W6LA 2KZHA 1DWFM 5AZ0A 1OM0A 4CNNA 1ITCA 3M0LA 2FKPA 3FOKA 3KUMA 3BLIA 1VEMA 2W27A 4GYPC 4TV5A 1FH9A 3A22A 4HA1A 2QGHA 4LUSB 3UXDA 1Z44A 5JIWA 4RNJA 4AWUA 4O53A 1TX0A 2ZE3A 3GB6A 4CUCA 4B3KA 1BRLB 1FHVA 5C70A 2X1IA 4OUEA 1WKDA 2FHCA 3IV3A 3G1AA 3LDVA 1TTQA 1H09A 2DSZA 3A13A 4BZYA 4DBSA 3E0LA 1J2WA 3GTIA 3WEZA 2YA1A 2PCQA 3PWAA 1YDOA 2PWHA 4YCPA 1X7IA 4IIFA 3BVJA 1HJUA 4WDXA 1HJXA 4JHOA 2HS6A 4DWSD 1V77A 5D09A 3VNJA 3BICA 2Z2BA 5D9PA 4JTHA 3WDJA 1JDEA 3IJ9A 2WO5A 4M56A 4Q7NA 3WK1A 3A23A 3H2OA 3B03A 4TVUA 3W6YA 2D22A 5BRQA 3W1TA 1BXNA 3QSTA 1JYNA 1TA3A 1R8LA 1GOWA 3EEGA 4UFMA 1KD0A 3OVPA 1PJ9A 3ORWA 1KV5A 1E5JA 1FHLA 1BEUA 2IXUA 3HQ1A 3CUHA 4FB7A 3WIJA 1DJXA 2A3LA 3C3NA 4UQAA 2OB3A 3GQYA 4QG9A 1D3CA 1HKIA 3WEOA 5DEZA 1RA5A 1JVNA 3HMCA 2X1UA 2FVKA 1OC7A 2B0MA 1X38A 1Q6DA 4JY9A 3WBXA 1TTIA 1QR7A 4UTTC 3EXSA 2JEPA 1XYZA 4XD3A 4N7QA 4P61A 1I8JA 2BOFX 3EB4A 3R5EA 3UCDA 4DM1A 4JIHA 3UWUA 2XTKA 3T0BA 3KBJA 2FZBA 3K8MA 5TBOA 4JX4A 3GIPA 1IXNA 6A3HA 1HT6A 4XZHA 1OHLA 1JPIA 3WMLA 3B0YA 1ZBVA 4FLOA 4UR7A 4GIAA 1KQZA 1MXSA 1GQIA 2PU1A 4PL2A 1RJRA 4Q4RA 1JZ4A 4LVBA 3IK2A 3MI3A 1S3TC 4DI8A 1FKXA 1KW1A 1JQXA 2JFEX 5FI8A 1M7OA 4A8NA 1MFUA 3UWYA 3WBWA 1XW8A 3CZGA 3NIYA 2C1IA 1K9FA 1T40A 3V0TA 4A29A 2YDRA 4OJYA 2VFFA 4R9XA 4DYEA 1J10A 4V28A 3CWOX 3S1GA 3SCRA 2G8ZA 2WVVA 1F9CA 3HPSA 2ZDRA 3ITVA 1UWIA 3SQMA 5D02A 3IEBA 3AXIA 3CT2A 1JZ7A 4S3BA 1EPXA 1FWIC 1W8SA 4PTNA 2FH8A 4WF7A 2XUCA 2W92A 3LPOA 4PUUA 4HNVA 2OPJA 5HOSA 2NVAA 4AW7A 1MRQA 4GIRA 3SGGA 4HU8A 4H2CA 2D2GA 1K9DA 3BLPX 3I4EA 3K8LA 3WLMA 4HD5A 3SADA 1U22A 1E4LA 3NQ2A 2NW0A 3OW1A 4D8ZA 1I1XA 3W7KA 1J0JA 3R25A 4A3RA 4AIOA 1PTDA 2FB2A 4NZ4A 1O5QA 4IPPA 1UKPA 1E56A 2Y7DA 1AH3A 2QR6A 3IIPA 5MF5A 4NRSA 5AC5A 4ZBCA 2ZZ1A 1UD6A 4ECLA 1P0BA 1UMLA 1ZRQA 4H7CA 3I3BA 4EACA 3S1UA 1W17A 3RR1A 1JYXA 2YCIX 3N6QA 4PUKA 5F4SA 3GWQA 2XIOA 1FHDA 3B8VA 4GIEA 3SSZA 4M81A 2VM8A 1SO5A 1WZLA 3UZZA 3PULA 3CWNA 1EYEA 3VMOA 4RKAA 3LGGA 3WQ8A 4GNKB 4PTDA 3VMNA 4R7OA 1X6LA 4UFIA 3WD1A 1GPFA 1R3SA 3QM3A 3DCPA 4JTDA 2GOUA 3V18A 1BG4A 3VCRA 2QPXA 5FOOA 5CBIA 4DO5A 3O05A 4Q32A 3PG9A 2ALRA 1NELA 4Z0SA 3CQ0A 4EPKA 1BLIA 3GVWA 1CEOA 2CZDA 1YQ2A 1US2A 3TC3A 2VFIA 4HCLA 3RCMA 4P8WA 3H2CA 2DSUA 4FX7A 1FWAC 1PWLA 4U5KA 2J66A 3KBSA 4HVXA 2X0SA 5DCEA 2BXVA 1E55A 2YLLA 1LLOA 4GH1A 2VX4A 4XG1A 4JBRA 4YTQA 3GXPA 2F2KA 2PLJA 2GYIA 3KL0A 1C8QA 3HA1A 4KH2A 3BCJA 3THCA 1LL7A 4BKNA 5K9DA 4IJRA 3W25A 3MVTA 3GXDA 1YTDA 3QOMA 3W88A 2ZZ7A 1ZTVA 5E6ZA 1S2CA 3UNTA 2CPUA 5BOOA 3KCJA 3DECA 4PCTA 2DZXA 1LCOA 1HFBA 1EB3A 3BW4A 3DKLA 4KS0A 1R6WA 4U2ZA 3STGA 2F2HA 4E4PA 2C79A 1UH4A 2BDQA 3P7YA 3VNIA 4WHBA 1KLYA 5D30A 1RAKA 1JI1A 1Q8JA 3T81A 2IMRA 3QR1A 3W7LA 3OYXA 5LYRA 2DH3A 3H24A 4L64A 1Z7AA 2ZRZA 3SCWA 2QT3A 1E9LA 2DT1A 2BX7A 1B31A 4H8NA 1Q13A 2NSXA 1K8CA 3TONA 1L0PA 3WF4A 3WF0A 2V8ZA 4TMBA 1QPOA 1OX5A 3LCLA 1VFMA 4MZYA 4Z2KA 3K2GA 3L21A 2QIIA 4L4LA 2PDKA 4ICNA 2DQXA 3DFTA 3CHDA 1P0KA 1U30A 5I3FA 4QITA 1PE1A 3W1QA 2GQAA 2IPWA 2AQVA 2ZFAA 2GUBA 3K30A 3RCNA 1ONWA 1QNRA 3W81A 4Z0JA 3ZR4A 4AAJA 1YE6A 1EXPA 4F0SA 1TIWA 1AUSL 1J6PA 2OEJA 2JF7A 4DEFA 3A4AA 4WY0B 4DJFA 4DQWA 3SN4A 3A4JA 4L4MA 2WHJA 4FIQA 4BJHA 5FF0A 2G3JA 4WDWA 1IR1A 3BLEA 1FWCC 1KM1A 1GHRA 4PTWA 3B40A 5HXMA 3KDNA 5K9XA 3F5JA 5HNTA 2FPYA 2Y8UA 2Z00A 2P50A 4GI6A 3T4WA 5LSMA 1W1ZA 3TN6A 3MCMA 4JN7A 3VFCA 4LXFA 4AU0A 2CWNA 4ES4A 3R4IA 3GAYA 2V3EA 4BQ5A 4ENLA 1H61A 3DFHA 1YPXA 1XYFA 4LVAA 3OG2A 3MSDA 4NNBA 3MV11 1U1JA 3W7EA 4JHZA 1TCDA 4L80A 4N9BA 3OHIA 1RA0A 3H22A 3UA4A 1EZWA 2AL2B 3RU8X 1QTWA 3GTNA 4BHYA 1BPLB 2UBPC 3HV9A 2B81A 2XIIA 1NP2A 3N9SA 3PFRA 2WOQA 4AZ7A 2VC6A 1E0WA 1NDWA 3MO4A 4L9ZA 3DG7A 3TU9A 1K77A 1IEWA 4WDTA 2V6AA 1AQHA 4AF0A 1GQNA 3AZRA 3GHTA 3QLLA 3GYCA 5CGQA 2DZTA 1B1YA 3KDOA 3F5KA 5AHEA 4MDPA 2PA6A 5IFTA 3FA3A 5H91A 1WDPA 1XKJA 3THQA 1T41A 2DZAA 1GCYA 3FYPA 3KOYA 4UXDA 4MWAC 2FB3A 4TU1A 4CQAA 1TVNA 1F2JA 3BW2A 5D2XA 3L0NA 3L2MA 1YLVA 3C86A 4CCDA 3MZ2A 3FKRA 3BGGA 1MVYA 1ZGDA 1LZOA 5HR6A 2RGLA 4GH3A 1B3YA 4RLIA 3CEPA 3KS6A 3DU0A 3VFLA 3LI0A 4UTUA 5CGMA 4FR1A 2EXOA 1VFLA 4NIRA 4S3FA 4FSAA 2QCLA 4INFA 4JL2A 3NL6A 3ZR5A 1XBXA 3QZAA 4ZOBA 4DNMA 4CQDA 2OEKA 1SR9A 3S1WA 4GQQA 1BKHA 4UTMA 4R27A 2ZRXA 3M0IA 4C6JA 5A6KA 1W54A 4KERA 4XISA 1ZJIA 2F8QA 1XH2A 3L2IA 4ORIA 1G4SA 1DORA 1O68A 3SR7A 3JUGA 1M65A 3S4TA 3UT0A 5J04A 3AMLA 2YR1A 5AOUA 3V1HA 1ITQA 1UOZA 2ZQ0A 7TIMA 2PTYA 3PHAA 2MNRA 3NYZA 1CXFA 1VCVA 3OIXA 3P14A 1GW9A 2BZNA 2POTA 3LXCA 1W1VA 3T2QA 4GNVA 3CTTA 1DHKA 4JTAA 1W3TA 4NXKA 1NWUA 3CASA 4F9JA 1OJXA 2BSLA 3QH2A 3VVGA 4ZOCA 3TSBA 3EOLA 3UYCA 1OD8A 3BZJA 2WAGA 2J62A 1TUXA 3CQKA 2VHLA 1PKLA 3RO6A 4ADTA 1JF5A 1V6YA 3VNMA 2WVVB 1A3HA 3S6DA 3CV2A 4FNTA 1JAKA 3CHCA 3OVRA 4TTUA 2IKJA 3W2UA 1B9ZA 5CZJA 2JKAA 3GG7A 4KPLA 2YFNA 1LL4A 1TVPA 1IEIA 2W67A 3SUUA 1GW1A 2YDSA 2FFIA 2E9LA 4ZXLA 4AVNA 2QXWA 4QFUA 5D37A 1T0OA 2Y8KA 4XSLA 1VIWA 2X41A 3R7MA 4JEJA 3URBA 3POHA 3P0WA 3HURA 4NU7A 4MKNA 2CETA 1RVKA 1X8FA 1ICSA 1K02A 8CGTA 2W6RA 4CNSA 5HQLA 3M43A 3IRDA 5T26A 3LCGA 1W5QA 4NYUA 1DIKA 1ZL1A 1CXKA 3QYQA 1R30A 4AXKA 4H00A 3SN1A 4H8VA 5HK4A 4EOUA 3FYYA 4GUHA 2ZXAA 2Z1BA 4WR3A 3TZFA 1QNOA 1B3VA 2QUUA 4JTTA 3DOPA 2QUVA 5C0QA 4RPQA 1TKKA 2Y24A 1RV8A 4MDOA 1ALDA 2VGIA 3LYEA 3DFSA 5LIYX 3URAA 5FEXA 3LXBA 4CNUA 2ISWA 8XIAA 1P0DA 1LL6A 4CNTA 4MJZA 2V5CA 2VUYA 4US5A 2QVHA 2A21A 1C9DA 1KFJA 3K4WA 3UWVA 4K1WA 4YJ5A 4GC4A 5AHFA 4HK6A 2VEKA 4RK8A 3MP5A 4PTVA 1IYXA 4PODA 1KCZA 4JTJA 3D6NA 3GO2A 1GZGA 4HK7A 4QEHA 4IP7A 2WKLA 5IDIA 2PU0A 1QUMA 3L4ZA 3EKGA 3NZ1A 3OTRA 3MP3A 4WRHA 1RQEA 3TYUA 4GVIA 1DJYA 3UF9A 4OUIA 3BGAA 3I6EA 1V4YA 3VOIA 2P0OA 1NQ6A 2E28A 4FNSA 1NM9A 2E09A 3VIKA 1W6TA 1A5AA 1G7UA 3NQDA 3QZ6A 3HQOA 1RH9A 1LT7A 3NQMA 2ZRUA 2OVLA 3IIVA 4MYXA 1LG1A 4JQ1A 3ARYA 3WLIA 4CVWA 2ABBA 4I8DA 2NLIA 1LLWA 4FLQA 2X42A 4BEUA 4Z2HA 3A21A 1Q45A 4EE9A 8RUCA 9CGTA 4OOZA 1NWRA 2OGJA 2Z29A 3EOSA 4HMEA 3SUTA 3VPLA 5BU9A 2YBVA 1A4LA 4NAEA 2PGRA 2V2HA 4JFUA 1KBKA 2ZRVA 4EIVA 5JBEA 1KB3A 2NT1A 4N9DA 3LXAA 2VWTA 4O1CA 1HP5A 3AS3A 5BXPA 4MSSA 2PGFA 1BD0A 3GDTA 3R1ZA 3VIJA 1O94A 1WDRA 4JIIX 2C1GA 1TV5A 2HWGA 4GIYA 4H9VA 4S3JA 3EPNA 3SRFA 2HBXA 2Z1VA 1AW2A 3MWCA 4GO9A 5BMXA 2X0HA 2JIWA 3LNPA 4GMEA 3ITOA 4PH6A 1DQXA 1XYLA 2D24A 1F74A 2YL9A 1WDQA 3ARRA 1V03A 4IQDA 3U7VA 2VUNA 5KEZA 3M41A 1OB0A 2ZUVA 2XIMA 4NG3A 5CJNA 2Y7FA 5DCBA 3QXBA 3UJ2A 4S2CA 5A8MA 4E2VA 1RCOB 1S2WA 2QAPA 3CTLA 4DX3A 1W3KA 2OCZA 1DWGM 1U1HA 1H49A 3S1VA 1FHUA 3BG5A 4PMVA 4S3AA 4UCFA 4QE5A 4PBEA 3G3MA 3WMCA 3W22A 4JCLA 1PIFA 4GUFA 4LSBA 3D3AA 3WNMA 1VBGA 5GVJA 3UZ5A 1P7TB 2MUCA 4HK5A 1GVYA 1DV7A 1LRQA 2PRLA 1V93A 1W31A 3ZLHA 1XPYA 3BAXA 4XD4A 3KLLA 3N9RA 4DJEC 1W5NA 3WMBA 3MBFA 3N2TA 2PC8A 4L6HA 1LDCA 4FA3A 2JBMA 2E5BA 1MNZA 2J75A 3NDZA 2VEGA 1OIFA 1VYRA 3ZLFA 3ZYZA 4P7LA 2J9XA 2BXYA 2OZ8A 1XYBA 1RLCL 4R34A 3LNMA 3MQTA 4RNIA 1YEYA 2CU0A 1Y5WA 4GFIA 3B8TA 1YX1A 2WZIA 3EWYA 3L67A 3N12A 1T6MA 1H0IA 1B3WA 1MW2A 4QJ3B 3EX6A 3AIWA 4GYKA 1UKQA 5CPTA 1G4TA 3THAA 3ERPA 5C9UA 3T55A 4NXSA 2OX1A 5CSSA 3MKCA 2JKEA 2VWSA 2OZ3A 4M6UA 2QCHA 5FACA 4HSOA 1OF8A 1GYMA 1R86A 4GYFA 1Y0EA 3KM8A 3UW6A 3E5BA 4AF0B 2XVGA 5F1UA 1QHPA 4DIAA 3SY8A 1KRCC 1JCNA 3CWHA 1OVDA 4GVFA 2GVGA 4YVVA 4H9TA 3HFTA 4O1AA 3LCFA 4ZB0A 1OZMA 5FAGA 2WXDM 3A47A 3HM7A 5HPOA 1Y8BA 1YKWA 3VKJA 3W38A 3W7PA 3USBA 4UQ9A 5E0KA 7REQB 2ISFA 1E1FA 1F5ZA 4BI5A 5DT5A 1V5XA 2JE8A 1IF2A 3OBEA 2PAJA 1VBJA 3TSMA 3W1XA 2HK0A 2ACSA 3CUJA 4OE7A 3QF0A 3HPFA 3T9PA 4JYEA 1EP2A 3ARXA 2PDMA 2XHYA 3ANUA 3NQFA 5EMKA 2B7QA 2DT2A 5D9OA 5G4WA 3TA9A 4K7VA 5LHFA 1JZ5A 1QU4A 4HYVA 4WJEA 4JQ3A 3FGCA 3MUCA 3HJEA 4EK7A 4MJ2A 4B92A 3GD6A 3TSDA 4DYJA 2ISVA 4O12A 1MRAA 3N18A 4W7UA 4H8HA 1HP4A 3UBPC 3T6CA 1H1YA 1JD9A 4UTWA 3RFAA 4HTYA 3M0VA 3G0SA 2QCDA 1J0IA 3T7VA 3T09A 1XIGA 4H6EA 1B57A 3FAXA 1BGGA 2CNCA 3QFWA 4UNKA 2WCSA 5AC4A 3F1QA 1J5TA 4C1NA 4J27A 3LLFA 3JU2A 4JIEA 4DJDA 4HZ8A 2WKJA 2OQHA 4ZSUA 3R43A 3M0HA 4XD5A 2FVMA 1UPMB 4CD7A 3W7HA 2C18A 3F7JA 4IIDA 1QWKA 3UYIA 2PEVA 8A3HA 3TN3A 3WDPP 1V6VA 3O15A 3AIQA 4H7VA 3CM4A 3MUY1 2Y61A 1IWBA 2A7NA 2CHRA 1G9HA 3VM7A 4J7RA 4EANA 3BV4A 4N9CA 4G56A 4KRUA 4M80A 4I5RA 4NZCA 4IIEA 4PC8A 4C6PA 5LXEA 3WG6A 2ISSA 1AG1O 1VR6A 2Z7KA 2HNHA 2X1RA 1SMDA 1PKNA 1SW3A 4XD6A 2NZLA 3BAWA 3S46A 3UPMA 3NQ7A 5BXSA 1ZJAA 3AAMA 3KBNA