3SIZA

Crystal structure of the mutant s127a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMAHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mutant S127A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor BMP
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 84
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sizA00
1EUNA 3NQEA 3R13A 4S2BA 3HJZA 3RK8A 5FEZA 1GZGA 3UQNA 3L9CA 5F4WA 3W1QA 4XWUA 2NX3A 2NUYA 3N9RA 4FB7A 5HNRA 4JTJA 5J5RA 1GG1A 1OFBA 4RZ5A 1HL2A 4N6FA 5EA9A 4CNPA 2DJLA 2QUVA 2VFEA 5AN7A 2BWGA 3P8IA 2CLOA 4QAIA 1SSGA 1KFLA 4W9TA 1PCKA 1L9WA 2VC6A 2VEPA 1K8ZA 2E5DA 3TQKA 5F1UA 3UZJA 1QFEA 3DFQA 2NXHA 3U2OA 3O6YX 3OVRA 3LCIA 4JTKA 1SW0A 3B04A 3PAJA 4O1DA 3F4WA 3CIWA 1X8FA 2B7OA 3P62A 4I9AA 1TV5A 4IPIA 5HJLA 2QDHA 4DO5A 5D2XA 4CQAA 1YXYA 4MUZA 2I14A 1C29A 1L6YA 2CLFA 1GJPA 2V5BA 2CWNA 4JIPA 3W1MA 1FCVA 3L68A 5CZ0A 3ZFHA 4ALDA 4MYAA 2GVJA 3N19B 3O63A 3MP4A 3HGOA 1S5TA 3IVSA 4IMDA 3QW3A 1FQ0A 3G8EA 4L4MA 2FQIA 2Y62A 2A5HA 4OQVA 3S5NA 1YLVA 1YXDA 1THFD 2DZXA 3CEPA 1NVMA 4IJBA 4HHPA 4WJEA 1K7XA 2CLEA 2E6DA 4FHAA 4O14A 4EF9A 3DHDA 2FTPA 3BW3A 3PB0A 1IXQA 1WOBA 4RXFA 3UYCA 2ISVA 3C2FA 1YDOA 1KFBA 2NWRA 2NXGA 4Q33A 3SECA 1JVNA 3W1NA 4O11A 5DY2A 4UTJA 5CZJA 3G0UA 4Y9AA 1SQ7A 1W5NA 4AEOA 2PC4A 2VFFA 3UWUA 2C18A 1KM6A 2DZWA 3F1QA 4IXHA 5AYYA 3B0PA 1RVGA 1G4PA 1H7OA 4UTTA 4A2RA 3MP5A 1QR7A 3NZRA 2QCEA 3C52A 4Y6GA 4UFHA 4JTLA 3L5AA 1NF0A 3NM3A 4JTEA 1GYLA 3W2MA 1GVQA 5D2TA 1OABA 1J4EA 4UXDA 4EF8A 1H62A 4O4VA 4YXGA 1OG0A 5D05A 1OFDA 1VRDA 3B4UA 4LTSA 2WNNA 2AGKA 2CU0A 2E77A 3LBCA 3PSVA 5DXYA 3G0SA 1ZHAA 4O0ZA 2WSRA 3QF0A 5D04C 3NPVA 3NR0A 5EKYA 4WD0A 1C9DA 2ALDA 1VGAA 1H7WA 2G97A 3DFOA 3NL2A 1KTBA 5LNRA 2Y7FA 5HWMA 1RQBA 5I3GA 1UUOA 1SFJA 3GX9A 1GOXA 3QZEA 1OFPA 4FNPA 1F76A 3N3MA 1IXNA 4MOZA 4HIBA 3W1UA 4IWWA 3PVFA 5KMYA 3MHUA 4GUHA 4Q32A 1QPOA 1O95A 4AVFA 3NQFA 5I3JA 1XM3A 1L2UA 1UUMA 3SJ3A 4LUIA 4POCA 2RDUA 1L6SA 3LCGA 3TQVA 1XDLA 3NQ6A 1TTJA 5LNSA 3TMQA 3BG9A 4DELA 4Y90A 3RNDA 3UPBA 5AHEA 4DPQA 3PBVA 4LVBA 3W2KA 1KLYA 3W7GA 1GWJA 3USBA 4XTDA 2UV8G 2PRMA 5KTLA 4JTSA 4OU1A 2B0MA 4TMCA 4MZYA 3PUOA 1O60A 4NQ1A 2H8ZA 5C55A 3UWZA 3QJAA 1DJNA 5IBXC 4LV9A 1KM5A 2J9ZA 3FJLA 4IOTA 5LSMA 1IIHA 1SFLA 4WQ6A 3LCXA 2A85A 3TJXA 3NPUA 4JS3A 2D73A 1VHCA 4JICA 2V2DA 2QF7A 1SPQA 2C15A 5EMUA 2C3ZA 2DZSA 5IBXA 3PB2A 3P5ZA 3W84A 3E49A 1FXQA 2QEZA 4JD4A 4LW7A 1RR2A 5D30A 3TJLA 4NXSA 3S6DA 1ZAHA 4PCFA 3DH7A 1XBXA 3B06A 3KFTA 1W54A 3MWAA 2LLEA 3C0JA 2C1HA 3RLUA 3O15A 1RQEA 5K4XA 3S8HA 3SR7A 3WJXA 2GQ8A 4GUGA 1HG3A 4DF2A 2VFGA 4AWUA 3A23A 2EKCA 4TX9A 5LNVA 3GDRA 2H90A 5KZDA 4FX6M 2WSYA 3WK0A 3MHFA 1QMLA 4JGDA 2JBMA 1EUAA 2TMDA 1D9EA 3UXDA 4N4PA 5BMXA 2WNQA 4UFLA 4NNBA 4M6VA 5D32A 4CQ8A 1KA9F 4UR7A 1O4UA 1LRQA 3W1XA 2JKEA 3FA5A 3P74A 1JCNA 3EWZA 3W1LA 1PHWA 1MEHA 1I2RA 4WOZA 3P7YA 3EXSA 1A5BA 3GKFA 4M6QA 1ZENA 1LTDA 1EEPA 5FEXA 2DZUA 3DKJA 5F2GA 1Q45A 3GNNA 5FF0A 3W7DA 1KFEA 2E6YA 3NXFA 3QMSA 1Q6QA 4TU1A 1H63A 4PTNA 1FDZA 4N2YA 1LCOA 1TTPA 1SZNA 2VELA 3TR2A 2YSWA 5AHLA 2OMAA 4MY1A 3QRHA 2ISWA 3UWYA 5AYZA 4Z1AA 4NU7A 5EBUA 1QWGA 5EYWA 3GDLA 2RDTA 3W7EA 1K7FA 3TAKA 4GUFA 3M7WA 2ZRZA 1TQXA 3EB2A 4PFMA 2ZZ1A 2Z1BA 3HG4A 3KRUA 1GVSA 2A1YA 3M6YA 3R5EA 1XBVA 4UFMA 3B0UX 2QCDB 3L0NA 1H7PA 3E9AA 4AXKA 2CLKA 5AC8A 1EIXA 3NQVA 3W7PA 2BTMA 1W8SA 5AC7A 4PODA 3W71A 3W76A 2W6RA 3G1FA 5HMSA 1R2TA 1HUVA 4Y96A 1Q6RA 3B05A 1HO4A 1KLZA 2PE4A 1R2RA 3T44A 2WSQA 3LERA 3LXBA 1Z41A 2QAFA 4NVTA 2ZA3A 2YGYA 4WY0B 4JTUA 4DBDA 2NXIA 4LWWA 4IMEA 1VZWA 2WQPA 3P5YA 1B3OA 1YYAA 3OA3A 3PM6A 3OG3A 4HNTA 4ZQPA 1FCQA 4JIQA 2J6XA 2C0AA 3C2RA 4CNOA 1X1ZA 3DAQA 4HKPA 1CI1A 3DHFA 2JGQA 1ME9A 3BLIA 2ATSA 3NQGA 4MJMA 1ADOA 4O18A 2FPVA 2GQ9A 5I3FA 1TMHA 4BI6A 1KFJA 3EWUA 3LRLA 3SGZA 1DL3A 3MHGA 4GC4A 5D2VA 1ZCOA 3OEXA 1WQ5A 2Y63A 3L65A 5D33A 2R94A 3LCLA 2FIQA 3NOEA 3W1AA 2ZFAA 1TRIA 1TSIA 3HG3A 2E1DA 3B8DA 1VH7A 4RX0A 1JCJA 1GQNA 3CB8A 2Y70A 3CHVA 3QM3A 1OVDA 2NLIA 3KVMA 4JR5A 1V7YA 4N4QA 4QQ3A 3GR8A 4MY8A 2ZRYA 3MYPA 3MP3A 3EX1A 3M5XA 5EY5A 3IIXA 4WX2A 1H7RA 2B7QA 3FS2A 1AL8A 3DKLA 4A22A 3PF3A 1I2QA 4FXRA 3LXAA 3T40A 5CKSA 5FEWA 1GYNA 1SO3A 4HN4A 3HF3A 3I65A 3P67A 3UNDA 5CSSA 5AC6A 3S5YA 3W22A 3LDVA 2QCFA 4GNJA 3P81A 3S0CA 3M5YA 3KAOA 4TO8A 4UTUA 3G18A 1Z48A 1JCLA 1RD5A 3NO5A 3G3MA 1FDYA 2ZQ0A 3CWNA 3DI1A 1A5CA 1FUYA 4JYEA 5D37A 1H61A 4CCCA 4X22A 3WJSA 3W23A 4MY9A 3HGRA 3WJZA 4CCEA 3ELFA 2V9DA 2C13A 1W31A 3TW7A 3HOJA 5FEPA 4FNSA 1DOSA 3THQA 3FKRA 1XDMA 1Q3NA 4NJGA 2JK2A 3EKLA 5J5DA 4XBSA 2YZRA 1GG0A 3QFEA 5I3KA 4C1LA 4LS0A 4ADUA 1IGSA 4QITA 1NAL1 2O7QA 3P8JA 1QO5A 3K30A 1T8XA 3S1XA 3V75A 1VS1A 4LOCA 1SW7A 2ZRWA 4HSNA 4JY8A 4M5PA 1I2OA 2DJXA 1X7FA 5LZLA 4FNRA 4O1AA 1LBLA 5A5WA 4RXGA 3CU2A 1LOLA 3PWAA 2J27A 1VR6A 2Y6ZA 4JTHA 4Z1CA 2QKFA 2ZZ6A 4NZJA 2V82A 3KVKA 2ZA2A 4O13A 3DXIA 1VHNA 3DU0A 3W2NA 2G96A 4A3UA 4ZL1A 2X2GA 5FF7A 5KINA 3GAKA 3M41A 3G1VA 2NUWA 1W3IA 4QISA 1XKYA 3F4NA 1KBIA 3W7QA 2EGZA 5F4XA 3LHZA 4NUWA 2OJPA 3QPZA 2Y89A 3L0KA 5F2MA 2A0NA 1DQWA 1UBSA 4NJHA 3P61A 3AJXA 2Y7DA 1XI3A 4E2BA 1F5ZA 1AMKA 5E0KA 2ZZ5A 3QQ0A 3C4UA 1VCVA 2QCMA 3CM4A 3RF9A 1OHLA 4IGHA 2Q8ZA 3IIPA 3Q37A 1Z42A 3ATYA 3HBLA 4Z08A 4IMCA 2CW6A 3KRSA 2PRHA 3FIGA 3PBUA 1ZFJA 2YW4A 1XUZA 1H5YA 4UTTC 5U4NA 3DI0A 3ZWTA 1H60A 2VENA 3E12A 4RLIA 3UY8A 1OFAA 4E38A 1PE1A 3WK1A 3GKAA 4LVDA 5F1VA 4ONVA 1O94A 4OV4A 3LTYA 3CPRA 1HTIA 2O7SA 3NQ8A 4ORIA 3TFCA 4Z1DA 1H7NA 1T99A 2V2CA 1A50A 5KZEA 4UMAA 4JX4A 4AF0A 3RFAA 3NPXA 4QNEA 3FYOA 3GDMA 4KKXA 4RK8A 3WJYA 4BI5A 4TIMA 4UC5A 3EEGA 3W1RA 2QUTA 2EHHA 1QPNA 2A7RA 1WA3A 4ZMGA 1B4EA 4IX2A 4LT9A 5I3IA 2NUXA 4JYFA 1W5QA 3A21A 4JNMA 3THAA 3TQ0A 2AAMA 2YYUA 3FKKA 4K39A 3ZR4A 2QCHA 4OWGA 4ZQCA 4XBKA 4AHOA 3TAOA 1WYIA 4MLRA 1LORA 1KFCA 5T26A 4FEZA 5E1QA 4LU0A 4O19A 1LDCA 1SZFA 2DP3A 1FWNA 1OK4A 5EPDA 2TSYA 3NM1A 1R47A 4ML9A 3BG3A 4HNVA 5BMWA 3N14A 4WOQA 2QCGA 5HR6A 1FXPA 1P0KA 4CQ9A 1GTEA 1RV8A 4CNNA 4RCXA 3MI6A 4O28A 3UWVA 4QJ1A 1JCMP 3INPA 5HINA 1W37A 2GJLA 1ICPA 1G4SA 3W7CA 3W7OA 2YCEA 4JTGA 4Z0JA 3LRMA 2Z6IA 4IXXA 1JCYA 4LV4A 1O5KA 4LVAA 1ZAIA 3U6WA 5CZSA 3W85A 3VNDA 2X1RA 3C2OA 1A53A 2WNZA 1B57A 3UPWA 3STEA 4X3ZA 4M7SA 3BG5A 3MMTA 1KM4A 5D03A 1FWTA 3HPZA 3KRZA 1TPC1 2YXGA 3QH2A 3IIOA 1IXPA 3LOTA 5DBUA 3Q58A 6TIMA 3TC7A 3SSJA 3VCRA 5D02A 1GT8A 2X16A 3TC6A 3V1PA 3CC1A 2QJGA 4O4WA 1OYBA 3A9IA 3S5OA 8TIMA 2QDGA 4O57A 1I2PA 3GLCA 1SUXA 3GVGA 4L4LA 5K9DA 5KSWA 4O54A 4EIVA 3MO7A 2ABAA 1PL9A 3IIZA 1YADA 2DZTA 3AO0A 3O05A 5K7JA 1U83A 4X9SA 3LHWA 4O12A 5TQLA 3KHJA 1EP3A 4K36A 1XCFA 2CLLA 1MXSA 3BW4A 2NX9A 1VC4A 3NL5A 4Q4KA 3R2GA 3STGA 4GJ1A 3W2JA 1ME8A 1GVRA 1WX0A 3ANYA 3N2XA 1R2SA 3E96A 2GQAA 2RH9A 4O17A 4AHQA 4ORMA 3W7MA 1OFOA 1KV5A 1W5OA 4NX0A 1TB3A 1JULA 3B03A 5HQEA 5MHBA 3LTPA 3W7KA 3GK0A 5DY3A 1EP1A 4DBEA 2V5LA 3W7HA 3PG8A 3NQMA 1TPFA 1YTDA 1DJQA 3FLUA 3O07A 4N6EA 4NNAA 5A8GA 1K7EA 1TPUA 3GB6A 3NG3A 4AAJA 4A2SA 5HUOA 1OYCA 4S1FA 3NQDA 1LLWA 3S1VA 2B7PA 1RQHA 2F7FA 2FB3A 1U5JA 4FNUA 4N9DA 1M7PA 3C8FA 4MLJA 2CLMA 4MYXA 4HPJA 3W88A 4O10A 3U8GA 3P60A 4ADSA 1J2WA 1KV8A 4S2CA 3QEZA 1EX5A 1BEUA 1YPIA 3MBDA 4RZ4A 4DO4A 3BVJA 1MO0A 3HQ1A 5FF4A 3C6CA 1KFKA 4K6AA 1XXXA 3A24A 4H3DA 4CLMA 4AHPA 2VEIA 4UTWC 2VOMA 1H7XA 3N9SA 2X1TA 2H8XA 3O6DA 3IIVA 3Q94A 1OX5A 4AMAA 3QYQA 3W7NA 5K2ZA 1JQXA 4O1CA 2I9EA 4LS1A 1YXCA 3BARA 1K8YA 4MPQA 1SW3A 1IF2A 5AOUA 3W1TA 1QO2A 3JRKA 1ZAJA 3PG9A 5G2HA 4G1KA 4BFAA 2E6AA 1G67A 1OX4B 3RLVA 1UB3A 1X1OA 5D2WA 3S1WA 2R91A 3W7JA 3W70A 2QR6A 3HPXA 3UD6A 1EWDA 1KM3A 2Y88A 4UFIA 4LUJA 5FI8A 3S9YA 4OE7A 4DF1A 2HSAA 2QJIA 2HS8A 3HGJA 3SIZA 4K7VA 2WJZA 1H1YA 4I7WA 3VI2A 1OYAA 2NX1A 3FEMA 1YDVA 2W0UA 1WXJA 1TREA 1YPFA 1JUBA 3VKJA 3DFPA 3GXNA 4GFSA 3F03K 2ZCGA 2ZZ7A 5K9XA 5DELA 4RKAA 3O16A 3QMTA 5DLCA 5L6UA 2OT0A 4M19A 4JYDA 4ZQMA 1NFBA 4FXSA 2CLIA 2RFGA 4UTHA 3QQ1A 4MKNA 3BV4A 4OBTA 5TBOA 2GPTA 3TFXA 2B7NA 3M1ZA 2BSLA 4LC6A 4XKYB 2ZRVA 3GDKA 2A7NA 4ZQRA 2C19A 3KVJA 4UFKA 4UTLA 1VPXA 1ZALA 1VYPX 2E09A 1QCWA 3TIMA 1LLZA 3FYPA 4DO6A 5K9CA 3KVLA 2W79A 3ABRA 5GVJA 3NNTA 4UR8A 5L9FA 3L2IA 3M47A 2X1UA 3HG2A 4XKYA 2QCNA 1LRTA 4K38A 3TUUA 2JKPA 3A5VA 4UMBA 2YDAA 4WXYA 4NNCA 2QUUA 2RKXA 4ICNA 2FDSA 4UMCA 5CPMA 3DFTA 2EPHA 2VFDA 4LNYA 1Z44A 2QAPA 2Y7GA 1DV7A 3P80A 5K4ZA 5C5YA 1TPH1 2YW3A 1OK6A 4LVFA 1LBFA 2P0OA 4UUIA 3TV8A 5C54A 2GVLA 3TMLA 4YCPA 2ZBTA 3VE7A 4HSOA 3NL6A 3STCA 5CPLA 1AW5A 1DKWA 3VFLA 3Q2DA 5AYXA 4O52A 3TA6A 2ATMA 3L5LA 4JEQA 1W3TA 4XZ9A 2IQTA 4IMGA 5SWUA 3M5ZA 2V0TA 1FCUA 3OVPA 3ABOA 5LKYA 4GBUA 3QPYA 2NZLA 1JCXA 1NEYA 2ABBA 4DPPA 4N9EA 1QDSA 1JRCA 3LBMA 4MZ1A 4IPJA 1F2JA 4KFOA 4ZZ9A 3PULA 3PBWA 5CPOA 3BLFA 4NZFA 1XFBA 2YFNA 4A21A 3WK3A 1FBAA 3M9YA 3QSRA 4NT0A 5C6MA 1SZEA 2A2IA 2ISSA 3LLFA 2C6QA 1AG1O 1KW1A 3IVUA 1FWSA 2H6RA 4JX5A 3LI0A 5H91A 2J88A 2J9XA 4JDYA 1DBTA 1V5XA 5G4EA 4CCDA 1H51A 2A6NA 4K8HA 1LBMA 1LZOA 4XUGA 3NDOA 1SR9A 5CPNA 1TYGA 3NEVA 3L66A 4UNKA 4O50A 1W5PA 1IXOA 3BGJA 3L67A 2PCQA 3BO9A 3GNDA 3S5ZA 4FX7A 5CZTA 1R46A 1ALDA 1GVOA 1PV8A 2QCLA 3L0GA 3O06A 4KFPA 3P82A 4AWSA 1KTCA 2OZ0A 5AHIA 1OX4A 3ZWSA 4O53A 3C3NA 1QOQA 4PL1A 1A5AA 1KM2A 3TCEA 5DN1A 4GRSA 2Q3OA 5FESA 2PRLA 3W83A 1IIGA 4IX0A 3G8RA 3LCWA 3E02A 1KM0A 1PIIA 1SU5A 4GE8A 3H54A 1N7KA 4K7YA 1VJIA 1VYSX 3M43A 4LVGA 1EPXA 1L6WA 1PVNA 2TRSA 4C1KA 7TIMA 5AFDA 4JN6A 3UWWA 3TH6A 2X1SA 1XUUA 3QMRA 2Z6JA 5BW6A 2H3BA 3H53A 4XTIA 3TW6A 5KITA 1KBJA 2VFHA 4D2JA 5FF2A 1W1ZA 3EWWA 3A5FA 1DORA 2VEMA 1F73A 4M6PA 3OIXA 2YYTA 3W75A 1OF6A 2OX1A 2CZDA 4RJEA 3ABSA 3W2UA 3G1XA 2ZDRA 1TPVA 3EX3A 5G2IA 3FOKA 3SZ8A 3BGGA 4R34A 4LRSA 5F2IA 1VQTA 2ZA1A 1AK5A 3SY5A 3I7SA 3HMJG 3LV5A 4TMBA 2NV2A 3GYEA 2GJNA 4I7VA 1LOSA 3GIYA 1MSSA 3TXZA 1D3GA 2YFOA 3NL3A 4WY0F 2GVGA 2HS6A 3LHTA 3SGUA 1YDNA 4MZ8A 1I8JA 1JUKA 1TPEA 3P84A 3H55A 2TYSA 4O16A 2FJKA 2XN1A 1DQXA 5DBTA 3SW6A 3G1HA 3C61A 3KXQA 3IVTA 4UIOA 3NQ7A 3PY2A 4WY0A 1AL7A 1ZJIA 1OFRA 3UY7A 4QM1A 1PCWA 3DFSA 4BK9A 4GUIA 4YCOA 1RZMA 1HO1A 3T7VA 2R14A 3PUEA 1VLWA 3EX2A 3WK2A 1YTEA 1G69A 5LNWA 2R8WA 1QAPA 3LLDA 1JUEA 5AHFA 2Q8LA 3I7RA 3MBFA 3YPIA 1HFBA 1OX6A 4N9BA 2QCDA 4GWEA 2ZRUA 4LC8A 4UCGA 6ALDA 4DEFA 1S5VA 3LX9A 3SFKA 1T96A 2A21A 4NJKA 1W5MA 4YMZA 2EF9A 3MW7A 3KX6A 2FPYA 4RV8A 1WBHA 4AB4A 3L21A 4NJJA 4H6KA 4YWIA 1VLIA 4DF0A 3TSMA 4NJIA 1P1XA 3HIJA 5HWNA 3DBPA 4PL2A 1G4EA 3TK7A 3EKZA 3I6RA 3W2LA 1H1ZA 5CG7A 5AHMA 1XBZA 1P4CA 3ABQA 3WFAA 1F7BA 2V8ZA 3ZS4A 5ABTA 3MUXA 4WXZA 2FFCA 2ZYFA 3LHYA 3EWXA 4MJZA 3FJ6A 1W3NA 2QCCA 3W73A 3NGJA 3LB0A 4UTWA 1EWEA 4JTFA 4BWLC 3W1PA 2ZZ4A 3LRKA 2C14A 2B4GA 3NQAA 3HB9A 3GR7A 2YPIA 4FNQA 2VKZG 1TJPA 2VXNA 1TPB1 1N55A 3N73A 3CEUA 1KM1A 3CLMA 4Z1BA 4U28A 1ZY9A 1N8FA 3T4CA 3O6CA 3N34A 4JXCA 4UNLA 4JDBA 1QPQA 4FO4A 3G0XA 2HMCA 2P10A 3NYZA 3CT7A 2A6LA 3BLEA 2V81A 4JX6A 2XN2A 1DHPA 5DCBA 1CW2A 1FY6A 5LHFA 1JJKA 1S3HA 2HTMA 1O5XA 2J9YA 1MEWA 3HG5A 2NWSA 4O0KA 1P5BA 4YLWA 3PUDA 2Z2UA 2J24A 4PA8A 1ML1A 5F4SA 4XQ6A 3CQ0A 3FFSA 1M5WA 2X30A 3NPWA 1S5WA 3NAVA 3LI1A 3LM7A 3LCFA 1XBYA 1I4NA 2WPBA 3M44A 5D38A 3MJYA 1BKSA 2DZVA 1TQJA 4X2RA 1K02A 4Z0SA 1Q6OA 1WV2A 1ONRA 1FWWA 1TIMA 4FX8A 3W7LA 1GTHA 4UTMA 4LRTA 1CX9A 4WUIA 1TV7A 4JY9A 2JGYA 1Q6LA 1F74A 4PH6A 4B5NA 1FDJA 5LGZA 1PHQA 5H2ZA 4R33A 4N9CA 1LM1A 1TRDA 3QC3A 4QNWA 1EP2A 2BXVA 1JR1A 4PEKA 1TV8A 4LS2A 3UXAA 1B9BA 4O8RA 1GEQA 5HULA 5C2XA 2GUUA 1QNVA 3LGEA 2E5BA 1BWKA 3BW2A 5DCEA 4MFEA 1UCWA 3NQCA 4GUJA 3IGXA 3NVTA 4R7JA 5G1YA 1P0NA 1FCBA 5K3VA 2RHGA 1FWRA 3S1UA 1LP6A 2FPTA 1K03A 1XL9A 4H4IA 4OT7A 5HR7A 1ICQA 1PS9A 1SO5A 3C2EA 3D0CA 4ZQOA 4HT3A 1GPWA 4R53A 4JTTA 2CLHA 1G4TA 2I1OA 5G1TA 3A22A 3EXRA 4FIRA 3G1YA 1SZGA 3TSDA 3BPWA 3NZ1A 4LY8A 2YX0A 1MEIA 4GXMA 3IEBA 4IQLA 3RMJA 4DQWA 1TPWA 1TJRA 1TTQA 1LYXA 5LNUA 2A4AA 1LRNA 3E0IA 4KWWA 1W56A 1BTMA 2BX7A 3TDFA 2Q3RA 1OFQA 4OV9A 1G6CA 5EL1A 3EXTA 5E93A 3PC0A 3EWBX 2WO5A 2XN0A 3C56A 4O15A 3JS3A 3G1SA 2ZRXA 2WV8A 4EVZA 3L5MA 2FLIA 1B4KA 2WKJA 3KOFA 3TE9A 3W87A 1AW1A 3W6YA 1TTIA 1F6KA 1X6UA 1OFEA 5DXXA 1G7UA 3WJWA 2RDWA 1EB3A 2H3DA 2OCZA 5I3HA 4P61A 5G2WA 1E51A 4AH7A 1K8XA 3TU9A 3UZ5A 1M7OA 1F6PA 5KZMA 2DU2A 5LGXA 2ZTJA 4E2DA 1QPRA 3G3DA 5BRBA 3EWYA 4M7TA 5HWJA 3HGSA 1VYRA 2EAWA 4ADTA 3LHUA 1W0MA 5G4WA 1G7VA 2E5CA 3B0VC 2BLEA 1EA0A 1YTKA 2ZTKA 5TIMA 3W74A 3LXCA 4Y8FA 4P2VA 2CZEA 4BI7A 2FB2A 3G22A 3NA8A 3MI2A 3LCHA 1F05A 3TSBA 3G1DA 4BF9A 3W3OA 1BWLA 4K8EA 5D09A 3SI9A 4K37A 2BZNA 1ME7A 2VEKA 3PSWA 4KFNA 1UJPA 3CTLA 3G24A 5FF3A 4NXKA 3LTSA 2OT1A 1MZHA 1WAUA 3GXPA 3MI3A 3QSTA 5BOOA 3NQ2A 4UTKA 1TCDA 3ATZA 3VE9A 4FF7A 1K3UA 2GOUA 2CFFA 3LHVA 2C16A 1OF8A 5F2LA 4HNNA 4OHQA 3DZ1A 4BWLA 2CZ5A 3M5VA 1I45A 4PC8A 1ZNNA 2AQWA 1RPXA 3STFA 3TNOA 4MVAA 3UWQA 3GXTA 3O1NA 2JKAA 5AB3A 2TPSA 3R8RA 1XC4A 2YR1A 3HO8A 2F84A 1VCFA 2A7PA 2V2HA 3GZ3A 1SO6A 4UFJA 3CWOX 5IM51 2G95A 3IGSA 1DVJA 4DXVA 3R89A 1WDWA 3TXVA 3JR2A 3S42A 4O1BA 4KWVA 5HUPA 4EOUA 4RR4A 5D2YA 4QSHA 3GAYA 1QOPA 2ZZ3A 4UTIA 1SO4A 2E68A 3W7RA 1Y0EA 5AHNA 4HNUA 3DENA 2E6FA 4ZVJA 2Y85A 1SSDA 2NV1A 4HPXA 1VCGA 1ICSA 1M6JA 5G5IA 2G5WA 3IRDA 3W7IA 4RZ6A 3HPSA 3DFNA 2XFWA 5BNKA 3EX4A 5CGQA 3W9ZA 1D3HA 3W07A 3TKFA 4IUOA 1OJXA 3OVQA 4OGZA 1JRBA 4TR9A 4YL2A 2VFIA 4NX5A 1T0OA 2P1FA 3EX6A 4QIUA 3C2VA 1TPDA 2Y7EA 4EWND 3PBYA 4AWTA 4J9JA 4FNTA 3R12A 5CSRA 1LOQA 3PR2A 1AW2A 2Y61A 4N02A 3N2MA 2DORA 1WOAA 4ZQNA 2Z0IA 4MFDA 3BK0A 3M0ZA 1A5SA 3OBKA 5DCDA 3OHIA 3MYOA 2CZFA 3O8AA 3LV6A 2DZPA 1R30A 3IV3A 3W72A 4BR1A 3I7QA 3I68A 1FX6A 3TROA 4A29A 3GDTA 2PURA 2V30A 3PS7A 3QW4B 5U7SA 1NF7A 4JTIA 2QJHA 1WBJA 1I2NA 2ZZ2A 4AF0B 4IMFA 3T78A 3M16A 4E0CA 3IGUA 3CIXA 3W86A 3T55A 2WOQA 4WZHA 4U4MA 1JQVA 1NSJA 5LHEA 1J5TA 4I7UA 3DGRA 3G1AA 4FIQA 1TO3A 1H50A 3RU6A 4MIMA 1GVFA 1UASA 1KTNA 1C8VA 1LROA 3TX9A 2KZHA
chains in the Genus database with same CATH superfamily
1VBGA 2ZUMA 4LB4A 2VT0A 1TIWA 2ASHA 3L9CA 4D6IA 3UQNA 4LYPA 5F4WA 7A3HA 4KBXA 1R3TA 3CYJA 3C86A 4XWUA 2NUYA 1VIZA 4FB7A 2D3NA 1TKKA 3AC0A 1HKVA 4NL1A 3WDJA 5EMJA 4N6FA 5EA9A 4CNPA 2VFEA 1WUEA 3RRAA 4QAIA 3A13A 1KFLA 3OOQA 1A0EA 2ZWZA 4D6EA 2VEPA 1UZHA 3UZJA 2VX5A 4LF2A 2NSXA 1HVXA 4JTKA 3EGJA 1SW0A 2A3LA 3T08A 3ZVHA 3OQ8A 3PAJA 5AKQA 3UP8A 3F4WA 3GIQA 3NDYA 4OTKA 2CXGA 4IPIA 5HJLA 5G4HC 4A3RA 3HA1A 5TF0A 1REQA 1VJZA 2O9TA 1V0LA 1MQPA 1UC5A 1W1YA 2V5BA 1TR9A 3T2OA 4JIPA 3L68A 2WANA 4KGLA 5CZ0A 1BSLA 1CXEA 4ALDA 1S1RA 2GVJA 3N19B 3HGOA 4U33A 4AXNA 1JG9A 4HHHA 5A6KA 2VHLA 3MANA 4L4MA 4IIFA 4H7CA 2Y62A 2A5HA 3AIRA 3UJ2A 3AYRA 4MNLA 2ZUTA 1ITQA 1GOIA 2WBKA 4TXEA 1PKMA 3QN3A 3D3FA 4S23A 4IJBA 4H83A 1WDPA 1K7XA 4D6GA 4JQ1A 3DYMA 2W5FA 4QG9A 5HQLA 4B4FA 4FPSA 1WOBA 4RXFA 3UYCA 2ISVA 5DT5A 1UD5A 3IJQA 3FN9A 2NXGA 4Q33A 4GD0A 1LG1A 1JVNA 4LXFA 4O11A 3WDHA 1B30A 1SQ7A 3WMCA 5M03A 3F1QA 2OG9A 5I23A 1G4PA 5FJIA 4BY3A 3F2BA 3MP5A 1H09A 3NZRA 5TD4A 3VIPA 2FJUB 1UWUA 4Y6GA 4C6LA 1TVLA 3L5AA 3W2MA 4D6DA 4XZLX 4YNGA 1OABA 1J4EA 1NWRA 4EF8A 1H62A 5BROA 1RJPA 1A80A 3KLKA 1OFDA 3KL5A 3T4WA 3B4YA 3K8LA 3EWDA 4HNOA 3WNLA 4C1NA 1QNRA 2WNNA 3B8SA 1HJQA 4ZO9A 1TWDA 2QQ6A 2E77A 4H00A 2Z26A 3OLIA 1XIHA 3NR0A 5EKYA 4WD0A 1VGAA 4H9XA 1S2AA 1RQBA 1HNYA 4MB1A 4R88A 3EOSA 1X96A 3KM8A 5I77A 4TX6A 3N3MA 2GGIA 5DO8A 4HIBA 5DMLA 3W1UA 3PVFA 3ABZA 5JUVA 1QPOA 3NQFA 5I3JA 1L2UA 4LUIA 4REQB 3IJDA 3H22A 3NQ6A 5LNSA 1FKWA 4DELA 3URAA 3RNDA 3PBVA 1B2YA 3UU0A 4DZHA 1Z8AA 3N9KA 2B0MA 1QK2A 4I5UA 3W28A 4NQ1A 5PTDA 3BDKA 5ECVA 3QJAA 3GTIA 5IBXC 4QAWA 3KS5A 4LV9A 3RU8X 5LSMA 4AG0A 4WQ6A 2A85A 1X8CA 4LUSB 2D73A 1XYZA 4JFUA 4UNIA 4JICA 1SPQA 2QIIA 2FZ8A 4PMXA 4CEUC 2XM2A 3L2MA 3W84A 3VFCA 4KIRA 3VOGA 4LW7A 3A4AA 4XG1A 3TJLA 9XIAA 3S6DA 3ZYZA 1XBXA 2Z28A 3KBNA 3RLUA 5K4XA 1G94A 1P43A 3TVAA 3QGVA 4PB5A 2Z25A 1JZ6A 2GQ8A 1QTWA 1E9ZB 1RHCA 4AY1A 5KEZA 3BAJA 1NFGA 1JD7A 1FHLA 4PTVA 1BPLB 1OEPA 4Q8PA 3QOKA 3VD7A 1W1B1 1UWQA 2H90A 4HA0A 3GUWA 4JZ5A 5FJOA 3R0KA 1QMLA 2PTZA 1NJJA 3UXDA 2J47A 2G3JA 4YYFA 3KOZA 4M6VA 1KA9F 1LG2A 3L2LA 5CC6A 1EGMA 3NEHA 3W1LA 3BAYA 4PTXA 4WOZA 3M07A 3QZ6A 1XRFA 3HZ3A 2J7FA 3FDKA 1TCMA 3UYIA 1A5BA 4Q6JA 4MGGA 1ZENA 1RBLA 3KCLA 3VTRA 2C1IA 2D0GA 1Q5MA 4M1BA 2DZUA 1B1YA 2PU0A 3FGCA 2CC0A 3NXFA 2E40A 3QMSA 1H63A 1IEWA 1TTPA 1R85A 1SZNA 3ONBA 4GVIA 4NZ5A 2OZ8A 1KXVA 1E73M 1S5NA 5FOOA 2XH2A 4Z1AA 3GFZA 5LYRA 3WSUA 1QOXA 2RDTA 4TVUA 5HPCA 4GUFA 3VDAA 2ZRZA 2I5IA 3WUGA 2A1YA 1XBVA 1WNOA 3L0NA 3E9AA 4HA1A 3M0KA 2X1IA 2BTMA 1W8SA 4I90A 3AROA 4AMCA 1XPYA 3WFZA 2C1GA 3HPFA 2P0IA 5HMSA 2HDJA 3AMGA 3QHNA 1KXQA 1FFRA 3WLSA 2FHBA 4CQCA 2W9MA 3LERA 2HROA 3LXBA 1GCYA 3RAOA 3F4CA 2NXIA 4IMEA 2WQPA 4S3CA 2GVEA 3WLNA 3P5YA 2UZ9A 4ZQPA 4JIQA 2DSVA 2J6XA 2C0AA 3WDIA 1X1ZA 4AD1A 1ZP3A 3WQOA 2JGQA 4ZOBA 4YN5A 3F5LA 2F8QA 4O18A 1M68A 2D24A 2GQ9A 2RGLA 5I3FA 1TMHA 3EWUA 4JTQA 3MVTA 4WK9A 4JHMA 1EXPA 3WH9A 3VD4A 4GC4A 3OEXA 5EMKA 1E15A 5D33A 3CTTA 3UNTA 2R94A 3LCLA 2FIQA 1UD3A 5MKGB 1UH2A 1VH7A 1JCJA 2WKGA 2R1KA 2BXYA 1E56A 3CHVA 1A5UA 3QM3A 2H9AA 4A3HA 1V7YA 3W24A 1FWEC 1E9IA 4US5A 3NZQA 3CB3A 3URNA 2WMJA 2FVMA 2D0HA 3OW1A 5T8GA 1GW1A 3ARTA 3UESA 1MUCA 1PDYA 4QGCA 1DJIA 2PDYA 4AYGA 1DWHM 2XFFA 2YA0A 3GD6A 1CLVA 1DEDA 1GYNA 4ERIA 3OA5A 5CSSA 3UZZA 3NSMA 3O0KA 4GNJA 2QCFA 3S0CA 3WENA 1MI3A 1Z48A 1JCLA 4W8AA 3G3MA 1FDYA 4Y9NA 5IDIA 2ZQ0A 1A5CA 4JYEA 5D37A 1H61A 3QY6A 4NAFB 3WJSA 3WBEA 3HGRA 5ABEA 2ZVIA 2V9DA 1W31A 3PJXA 4FNSA 1DOSA 3THQA 1XDMA 1AJZA 5J5DA 1P6CA 4IL0A 3ARPA 2NW0A 2YZRA 1GG0A 3QFEA 3WL0A 4A4AA 5I3KA 4ADUA 1UG6A 4XKMA 1NAL1 4UQ9A 1QO5A 1NIUA 3GZAA 4MWAB 3V75A 4LOCA 4GKTA 3IJLA 4A05A 1JZ4A 2O4QA 4WVXA 3WH8A 4GC3A 5LA2A 3KUMA 3EYPA 4ASTA 4RXGA 1JXKA 2FH8A 3DFHA 3H7VA 3VKBA 4ZFCA 2GSEA 2PP1A 2Y6ZA 2J7EA 1HGYA 4NRRA 4R27A 2ZZ6A 1R3QA 4LALA 4QEHA 1QT1A 3M4HA 4DO7A 3W2NA 2G96A 2IPJA 4ZL1A 2X2GA 2HPIA 4K2SA 1KR1A 3M41A 1W3IA 1FFQA 4X63A 4QISA 1HN1A 3LHZA 7TAAA 2HBXA 4LX4A 4PTDA 2F38A 4GXWA 3AIWA 2A0NA 2Y7DA 1XI3A 4E2BA 5E0KA 3QQ0A 3GE7A 3KBVA 1VCVA 2QCMA 3CM4A 4IGHA 4G2DA 4L1XA 3HFTA 1LJYA 3IIPA 3Q37A 1WP6A 2D23A 3ATYA 3HBLA 4BQ3A 2O55A 3EMZA 3FIGA 2WJFA 2XFRA 4H01A 2VENA 3E12A 2FVKA 1I75A 2V5CA 2PDCA 4LVDA 4ONVA 4K8GA 5LIKX 3CMGA 2G0WA 3QFWA 5M17A 5BYWA 1A50A 3TNBA 5KZEA 1K4HA 3M0HA 3MV01 3NPXA 1DQUA 3WJYA 4BI5A 4PUDA 3ABXA 3EEGA 1QASA 1XX1A 3D5HA 4S39A 2DH3A 5I3IA 5E6YA 4JIIX 3TTSA 2NUXA 2VQTA 1B9ZA 4K39A 4OWGA 4MLRA 2JF7A 3M0MA 1B31A 2WAGA 5CC7A 4G6CA 1XHGA 1R47A 1JYNA 5BMWA 1X6LA 1J6PA 4JHZA 4DJDC 1P0KA 4OZOA 1RV8A 3GTNA 3MKVA 3K5XA 2J8FA 3INPA 4M56A 2OYKA 3WF2A 2OR2A 4J2PA 3W7CA 4ZOAA 4IXXA 1BXCA 2W4XA 4QE4A 1QPKA 4LVAA 4Q4QA 1NH6A 5CZSA 1PYFA 2X1RA 2Y8UA 3C2OA 1FWGC 5FIPA 3DYPA 3UPWA 4X3ZA 3BG5A 5D03A 3HPZA 4HYVA 4GY7A 4JN7A 4PCPA 3Q58A 3CMJA 3K8KA 2MANA 2CEQA 2X16A 3R58A 3V1PA 4M1RA 3NQBA 3QQWA 3USZA 3RHGA 2QJGA 3BTNA 4O4WA 4HQVA 1OYBA 4RNJA 1RVKA 4IIHA 1I2PA 1XLAA 4PMDA 1ECEA 4HU8A 1DHKA 2ABAA 1PL9A 4CQBA 2DZTA 3O05A 2XGZA 5K7JA 3PTKA 2WYSA 1IQ8A 4NY2A 4XZNX 3BW4A 2NX9A 2QUMA 3ES7A 3R2GA 4RZBA 1UWRA 1UPPA 2HV5A 1ME8A 2C0HA 4GI4A 2VM8A 4FK9A 1OFOA 4AISA 3LQLA 3N6JA 2PDFA 1BXNA 1YNPA 1NFPA 1R3WA 2IKGA 1UP3A 2PDJA 1QNQA 2JQXA 1US2A 3W7KA 3MV11 1EP1A 1CGWA 4E8CA 2V5LA 1TPFA 2Y1HA 1DJQA 3DOPA 3O07A 3DHPA 4I5RA 3GSMA 4AAJA 2W61A 4A2SA 4XV0A 4ZODA 2OQHA 4S1FA 1LLWA 2B7PA 2VC7A 4N9DA 2G8ZA 3B0XA 1EOMA 1SMAA 1W8GA 4LYKA 2A3AA 3W88A 1UYQA 3MCNA 5JIPA 1BGAA 1BFNA 1KV8A 4S2CA 4L65A 1EX5A 6A3HA 1MO0A 5FF4A 3EPMA 3WBXA 1CXHA 1VRXA 2VRKA 5AC4A 1ITCA 4FXFA 1F3EA 3OBEA 4UTWC 2VOMA 3AHYA 3N9SA 2X1TA 3EMQA 1Q65A 1KRAC 1TELA 4IFKA 1OX5A 4AMAA 3QYQA 5FKYA 1JPIA 3VU2A 1K8YA 4MPQA 1IF2A 2YKKA 4PUUA 4X9YA 3PG9A 3MKCA 1QXLA 3GHUA 1OX4B 4NP7A 4FI4A 4AZCB 2R91A 2WB5A 3KWXA 4LGXA 2QR6A 3WMLA 3S9YA 4WKFA 4OE7A 1R8LA 2GWGA 2HS8A 4I9TA 3STPA 2WJZA 4ES4A 4ROQA 4I7WA 3VI2A 2VO5A 3Q4DA 1T5AA 1YDVA 2W0UA 1TREA 3H2MA 3N4EA 2ZZ7A 5K9XA 2QV5A 1CGTA 3O16A 1TE1A 4M19A 3RGTA 4JQ2A 1XISA 3B8VA 4FXSA 4UTHA 4PUMA 4XKYB 3GHRA 2PI6A 3AAMA 2A7NA 2PTYA 3GH5A 3KVJA 1ZALA 1VYPX 3CPUA 3RJXA 3TIMA 5HOSA 2PLCA 3S2CA 3DC0A 1W1TA 4AIOA 1XICA 3RX2A 3MZNA 4WXYA 3IANA 2QUUA 3VDGA 2Q6ZA 1XR2A 2FDSA 3E3HA 5CPMA 4HA3A 3EPOA 5XIMA 4MTVA 2C91A 4HYRA 4DBSA 2Y7GA 2ZUUA 5K4ZA 2Z24A 2YW3A 1LBFA 4UTFA 2GVLA 3CO4A 5A6SA 4YCPA 3HMCA 4HSOA 2YXXA 3NL6A 2FMNA 5CPLA 3U57A 1AW5A 1K6AA 4P8XA 5CAKA 1MQQA 1E6NA 1I60A 3R8HA 2XVNA 2ATMA 1C8YA 5FA5A 3BZJA 3V4BA 2OQYA 2V0TA 4GYJA 4GIEA 2GDQA 4GBUA 3QPYA 1NEYA 3THUA 2XFYA 4N9EA 3CLWA 1QI5A 1QDSA 3LBMA 2FVLA 2Z00A 4CD6A 1MXGA 1V0KA 3PBWA 3PULA 3GC4A 3NSXA 1D7FA 2YFNA 4IFKB 3M9YA 3POCA 4Q7NA 1UR9A 3O0FA 4NT0A 5C6MA 2CESA 2W67A 2A2IA 3I3EA 1IZKA 3T1GA 2AQVA 4MWAC 3IVUA 1VEOA 4B90A 2EXOA 4L64A 1K6WA 1LBMA 5ECUA 4JFSA 1ZU8A 3NEVA 4O50A 3QY7A 4C65A 3R6IA 1O1HA 4CD4A 4C6QA 5CJMA 3FNDA 2E8YA 5CZTA 1GZ1A 1R46A 3DFYA 3ARQA 2I57A 2OZ0A 3B9OA 4DJDD 4ZBCA 1E4IA 2WVUA 3EOEA 3ZZ1A 1A5AA 4JNZA 4BZYA 4GRSA 3G8RA 3VNZA 3CT2A 1IYXA 4PBFA 1PIIA 3PTDA 4K7YA 4IL2A 4XD6A 3OZPA 2O9PA 4BEUA 3TH6A 2EPLX 5C7HA 1K70A 2H3BA 5H1WA 3TW6A 5EU9A 5KITA 4EPBC 1W1ZA 3S9ZA 3UGRA 3A5FA 1DORA 2E9LA 2ZXAA 5HMFA 3OIXA 3W75A 1SZRA 1T40A 2CZDA 4RJEA 3W2UA 4RE2A 2EG8A 1JD9A 1K9EA 3QY8A 1ZRQA 4R34A 1L8NA 2PGFA 3ES8A 1AK5A 8XIAA 1XLDA 3SCWA 1W3KA 4OJYA 3VDCA 1TFVA 2INFA 3ECQA 4ZFMA 1LOSA 3APGA 3TXZA 4FS9A 1TPEA 3ZO9A 3H55A 4H04A 1TA3B 3DG3A 3ONCA 1MMFA 1R3RA 3SW6A 1PAMA 3G1HA 3C61A 2XSAA 3VKCA 4LCRA 5EGRA 3PY2A 1ZJIA 4GUIA 3F5JA 5H8PA 1VLWA 5A95A 4DZAA 4N7QA 1QW8A 1ESWA 1NP0A 3WK2A 4LPCA 1G69A 4I9JA 2R8WA 2Q8LA 3LPPA 1A5NC 1HFBA 2QVNA 4I9MA 4N9BA 3SADA 2BVWA 4UCGA 3WNNA 2YDQA 2J7HA 1S5VA 2DGAA 1T96A 4I6KA 2HVOA 4HTBA 4GQQA 5I09A 2EF9A 3HM7A 3MW7A 3VZYA 3ARYA 3IUHA 4L61A 4HP5A 1W1A1 2VZSA 3SCOA 3DBPA 4PL2A 3TC3A 2QMJA 3I6RA 1E1FA 3W2LA 1IT0A 3WD4A 1V6XA 4AY8A 1V77A 4ZEPA 5D9NA 3ZS4A 1L0PA 1VFUA 2WM0A 2YJQA 4WXZA 3SRFA 2OKOA 4Q4RA 3WQPA 2ZYFA 4MJZA 5XINA 3AYVA 5GJMA 3W73A 2R24A 3PWIA 7REQB 4UTWA 1EWEA 2VZVA 1E55A 3E2RA 4BWLC 4R85A 3QGKC 4FR6A 2OTDA 2YPIA 1V3KA 4W86A 3GNOA 1N55A 4PMVA 3B8IA 1U22A 4ZB5A 3OZYA 1O1ZA 2AL2A 4U28A 2HJPA 3N12A 1O5RA 4QCEA 4DRSA 1XLMA 4W8LA 4JDBA 2WZIA 4KW2A 3NYZA 3CT7A 4TQTA 4V2XA 5LHFA 3U2ZA 1KBLA 4DY1A 4ICCX 4M80A 2PDLA 2V3FA 3IPWA 1J96A 2TODA 4B5VA 4BF7A 4PA8A 3N18A 3AU2A 2DUAA 3BC9A 2AGTA 1FRBA 1Q6CA 1Q63A 1XRSA 3BMXA 3GG8A 4PMZA 2PDGA 1W9PA 1I4NA 1XBYA 1TWIA 2J66A 1YEYA 1E4MM 3UBPC 4EP8C 1CYGA 5D38A 3U5YA 1R7OA 2DZVA 1K02A 5JH2A 1QW7A 3H8AA 4P7LA 1E6XM 1ONRA 2ACSA 1CX9A 2HE8A 3UVAA 1IV8A 3LGDA 2JGYA 4B5NA 3A9BA 4AD4A 3FA4A 1BGGA 5GNXA 4XK2A 3T2PA 3DHUA 4OUIA 5EFFA 3QC3A 4O1FA 2R1MA 2J74A 1JR1A 1UOKA 3H2FA 2I5GA 4L7ZA 3P14A 1HVQA 3ZLGA 1GEQA 4PRWA 2GUUA 2Z2BA 3UF9A 3OBAA 2PDHA 3NQCA 3W25A 3BE7A 1IR1A 2X7VA 2W92A 3IGXA 2PWGA 1MVYA 3LM3A 3FK4A 1FWJC 5K3VA 2GDUA 1FWRA 4P8UA 1LP6A 2FPTA 1XL9A 6XIAA 1SO5A 3C2EA 2DT1A 3WF4A 4CGTA 4HT3A 4JKKA 2YCIX 1JDFA 1OSEA 5G1TA 2BP1A 4V1XA 1OBAA 2WHMA 1E6PA 3EB4A 3LA4A 3OP2A 5LNUA 2A4AA 3UFYA 4QX4A 4KWWA 3TDFA 1BTMA 2Q3RA 1OFQA 4L1GA 1GOQA 6CGTA 3AIEA 5I5RA 3VGFA 2JF6A 2WO5A 1V6UA 1MUWA 4E4FA 3CV6A 3RR1A 1OZMA 3JS3A 3G1SA 2VC9A 2AL1A 3B40A 4Q8WA 3KOFA 2WKJA 2P8BA 4QLKA 2L5HA 2CNCA 1TTIA 1F6KA 4H6QA 4AIEA 4DI8A 4GHRA 1OFEA 1G7UA 1IT7A 4J3ZA 1U5VA 4IFRA 1U5HA 1YQ2A 2HXUA 1LLOA 1AQFA 1LF1A 1M7OA 1OGSA 4KWSA 1E72M 3MU7A 1F6PA 5LGXA 2DUZA 1VD6A 2OVLA 5MKGA 3VM7A 3MCMA 5G4WA 1G7VA 1BQGA 2OQLA 4V15A 2ZTKA 3BV7A 3W74A 1UIOA 2VZTA 4BA0A 4GLEA 3QVQA 1BAGA 1EIBA 1OADA 1P0BA 3IJIA 3SO7A 1T8QA 3G1DA 4HGXA 1HZYA 3QOMA 1TWZA 4M82A 1UJPA 1NWTA 4S3EA 3LTSA 2OT1A 1NP2A 1A5KC 3NQ2A 3ATZA 3AZSA 4L1WA 3VE9A 2YCKX 1K3UA 1UD8A 3WLQA 2CFFA 3LHVA 1OF8A 5HJXA 3WIJA 1WAWA 4DZIA 1UKPA 3MJMA 1I45A 3WF0A 3TWAA 3SQLA 3STFA 2BXZA 3UWQA 2CBVA 3IGHX 5AB3A 5AC5A 1XC4A 4KRTA 1XSKA 4Y8EA 2V2HA 2OPJA 3SCPA 3S4TA 1DVJA 1G01A 1F8MA 3SY1A 1A5OC 4Z2GA 6REQB 4S3FA 4Q4PA 4KWVA 1E6RA 4GCAA 1SO4A 2E68A 1HKMA 1SSDA 2V5KA 1VCGA 1ICSA 4Y9OA 3IRDA 4I6VA 4F0RA 3DFNA 5BNKA 3W9ZA 1C3FA 4IUOA 3BAWA 4FZIA 3N04A 4QIUA 3O9NA 2BOFX 3C2VA 3CK5A 4J9JA 1B0IA 3R12A 4D6FA 6ENLA 4N02A 3CAWA 4MFDA 3XISA 2PWDA 3R0UA 4HPGA 5LXEA 3OBKA 2BASA 3S9IA 4ERAA 3LV6A 1CXLA 2DIJA 3FEQA 2PDWA 3IV3A 3W72A 4XAFA 2FHCA 2RGMA 3GDTA 3QW4B 4NILA 4J2MA 1S46A 2QJHA 3J7HA 1MFVA 3SIMA 4GO8A 3CIXA 2Q09A 3JW7A 4YS1A 3W86A 5H8UA 2HXTA 2PB1A 1IEQA 3V0SA 2Y4SA 3G1AA 3EDKA 1TO3A 3H70A 4BQ5A 1Y8BA 3UJRA 5A6AA 1KTNA 3GU1A 1LROA 3TX9A 1F6YA 2KZHA 3MZ2A 2NQZA 2PDBA 1VFFA 5ABGA 1M7JA 3UG5A 3EDJA 3HJZA 2Z7KA 3RK8A 1GZGA 1IWPA 2PDPA 4HMEA 2QJJA 1RJQA 3MWCA 2NX3A 3MMWA 3N11A 3N9RA 2WW5A 2WC3A 1GG1A 1HL2A 4J3WA 2F9RA 1X97A 2QUVA 2E7FA 2BWGA 2BY2A 1DTNA 1L9WA 2VC6A 1GPFA 3S83A 2IW0A 3WQ5A 2NXHA 3VIIA 3LCIA 4DAFA 2C8NA 4I5XA 2CWXA 3SBFA 1X8FA 2B7OA 3H4XA 5I79A 2QDHA 3HQPA 1O6IA 4NI3A 5BWAA 4CQAA 1OCQA 3TWBA 3CHEA 4YTQA 1Q85A 5A8QA 2OB3A 1GYMA 2CLFA 2I17A 5HMEA 1FCVA 3U9IA 3ZFHA 3TJIA 1UR2A 2IKJA 3O63A 1U1JA 1S5TA 5A8PA 3IVSA 2HK1A 2X41A 2FYMA 1A3HA 3VGEA 4UZSA 4O1EA 2FQIA 4ICMA 1E71M 3S5NA 1X98A 3QLDA 2DZXA 3HV8A 1NVMA 4ZENA 3CQJA 4WGXA 4W88A 4WJEA 2CLEA 2E6DA 2XIIA 4FHAA 3DHDA 3BW3A 2RAGA 1IXQA 2J7CA 6XIMA 2POTA 3AYSA 1OC7A 2Y24A 4UBPC 2VURA 4MB4A 1VBHA 5IDZA 1W5NA 3UWUA 2C18A 1KM6A 1M65A 4IXHA 1HJUA 1H7OA 5REQA 4A2RA 5BZAA 1GONA 4Q8UA 1BYBA 3C52A 4UFHA 1RLDA 1KCZA 4PMYA 1GYLA 2R1NA 2OKTA 4PR4A 4UXDA 1R7AA 1OG0A 3DECA 1EQCA 5HJYA 2R1LA 4LTSA 1ELSA 1EO7A 1EJXC 1AVAA 3PSVA 3G0SA 1GVIA 2WSRA 2OO0A 4KEMA 1DXFA 5D04C 1M3UA 4PCTA 1RA5A 3GTHA 2ZXQA 3D3AA 4GJIA 3DFOA 3LUTA 1TMLA 5I24A 1UKOA 4CNSA 5I3GA 3UERA 1UUOA 1OT2A 1KKRA 3PZMA 4FNPA 3UXIA 1F76A 5JVLA 4C6DA 2PDKA 4MOZA 3A4WA 5KMYA 3RDKA 1DWGM 1UUMA 3SJ3A 1VF8A 4POCA 2RDUA 2DPEA 1XDLA 1TTJA 3UPBA 5AHEA 4JFTA 4KETA 1KLYA 3W7GA 4YIWA 1QI4A 4XTDA 5KTLA 1XDJA 2QZRA 3S46A 4MZYA 3H2CA 1EC7A 2V6AA 4CU7A 3TYEA 3PUOA 4WDXA 3UWZA 1E70M 1DJNA 3QZAA 3AMLA 3BQ5A 1SFLA 4HN8A 4J5NA 2E8ZA 3NPUA 4D8AA 3TYUA 4GXPA 2XZ9A 5EMUA 1AQMA 2DZSA 5IBXA 3HURA 2DY3A 1PZ2A 4B3KA 1RR2A 4RNHA 4E5TA 1DJZA 2OWWA 3AJ7A 4IG2A 1ZAHA 3DH7A 3B06A 4AC7C 1W54A 3LU2A 2C1HA 2CZVA 4HHLA 3GYCA 3W6LA 2EPOA 5ENLA 3FJNA 4FLOA 1O68A 1A3XA 2VFGA 4AWUA 4LJ3A 5FJPA 4TX9A 5LNVA 2YB1A 1UA3A 3WK0A 4JGDA 2W91A 1D9EA 2D0FA 3ITTA 5C8BB 3WY1A 1XLKA 4LBRA 4NNBA 4NZCA 5D32A 2PTDA 2VUYA 2WMFA 1YHTA 4US6A 1XG3A 4QFUA 3W1XA 2JKEA 1E4LA 3E5BA 1EGVA 2AAAA 2BNJA 3P7YA 4YWSA 2FZNA 3ZLFA 1UR1A 4DN1A 1JF6A 4PZVA 4IH3A 3DBNA 1EEPA 1WDQA 5FEXA 2FZBA 2ZOXA 1Q45A 3GNNA 1R9ZA 1KFEA 1Q6QA 4ZSTA 4PTNA 1FDZA 4ATDA 1LCOA 4L9YA 3TR2A 3KWSA 1XLIA 3UWYA 1V8EA 5EBUA 4LSBA 3GDLA 1W1IE 2OYMA 1EO5A 2BHYA 2VEFA 5CH9A 3W7EA 1K7FA 1D3CA 4IUGA 3PZOA 3HG4A 5FSDC 1ZGDA 2PAJA 3V3WA 1RPKA 1XLCA 3M6YA 3R5EA 2WVTA 1FHVA 2CLKA 5E9AA 5AC8A 1EIXA 4IFOA 4NF7A 3W7PA 5ABFA 4PODA 1G9HA 4X60A 3FV9A 3BWWA 2ZX7A 3G1FA 1L6FA 4JIRA 4XAGA 1TR1A 3B05A 2ZX8A 1GHSA 1UIPA 3U7BA 1JZ8A 3T44A 2XYLA 2QAFA 3FSTA 2ZA3A 2YGYA 3UJEA 4NSBA 3C5QA 1RALA 1F8IA 4KPLA 1B3OA 1YYAA 3OA3A 3PM6A 3OG3A 3VD3A 4GGHA 4CNOA 3DAQA 3DHFA 2WK2A 3MQTA 1ME9A 3MCOA 3BLIA 2XGBA 1XH2A 1X6NA 2VRQA 4Q4OA 4D6CA 1KFJA 3RUBL 2EKGA 1DL3A 2X40A 3C0SA 1ZCOA 3AIVA 3TJ4A 4QJ3B 3UG8A 4WKAA 3FA3A 2ZFAA 1TRIA 1TSIA 2E28A 1GQNA 2Y70A 4QSFA 2NLIA 1NTHA 3GR8A 2XIMA 2BVYA 3MYPA 4MUPA 4PEEA 4ATLA 5M3WA 1EKOA 1VFSA 6PTDA 1AL8A 1MNSA 3C3UA 4U10A 1I2QA 2GUYA 4FA3A 4FXRA 2ON3A 4GQGA 3U4FA 3TTYA 4NKCA 1W9DM 3T40A 5CAHA 1JNDA 4LAMA 4PBGA 5GJNA 5FEWA 1SO3A 3I65A 3UNDA 3BSMA 3LDVA 3VKDA 4UTUA 3GHTA 4DJFD 4XSLA 3GW3A 3K8MA 3H2EA 1XYCA 1POJA 3TW7A 1MW3A 5FEPA 4H6RA 2VDGA 2NV9A 4UQBA 4C6OA 1Q3NA 4NJGA 2JK2A 1KCLA 1KB3A 2JE8A 3QYSA 4QCFA 3WNPA 4QITA 1ZP4A 2O7QA 2QUNA 1BG4A 4CCZA 3PFMA 1JYWA 3ZVIA 4DM1A 4Y9MA 2ONEA 4C60A 1US3A 1UD6A 2WVSA 2ZRWA 3T6CA 2P8CA 5BXRA 4JY8A 1XRVA 2VC5A 4FNRA 4O1AA 3WD0A 1GQKA 4FR1A 3CU2A 4B3LA 1H11A 1U2YA 2J27A 3VA8A 4JTHA 1X39A 1UWTA 4ZGYA 1P6WA 2V82A 4QEEA 3KVKA 2PEVA 4O13A 1VHNA 2GK1B 3V0UA 1J12A 5FF7A 3OQEA 2EG6A 1NWSA 1GVEA 3G1VA 2NUWA 4N42A 3F4NA 2GJXB 3W7QA 5F4XA 4NUWA 3QPZA 2Y89A 3QR1A 4MSSA 4S3KA 1FVPA 1DQWA 2G50A 3Q67A 3M0LA 2A79A 1VAHA 3BANA 4AZGA 2EO7A 3WUBA 3IK2A 3EWCA 1UPMB 4YPJA 4GI6A 3OGVA 2PF8A 3DN5A 3NZPA 3M46A 4CN6A 4Z08A 3KRSA 3GHSA 2PRHA 1XLEA 1EJTC 5U4NA 4UOJA 1H60A 3XIMA 4RLIA 3NURA 4GIAA 3UY8A 4U5IA 3K2GA 1SFTA 3PTQA 4E38A 3V35A 5F1VA 1O94A 3CPRA 2XVPA 4ZO7A 4ACYA 1UZ1A 2CKSA 3MDUA 1DWFM 1H7NA 1T99A 5H8MA 3P93A 4GY0A 4UMAA 4JX4A 2Y2WA 3RFAA 2P5NA 5EFDA 3CZJA 4TIMA 3W1RA 2XTKA 1JAKA 4PTWA 4QLJA 4ZMGA 1B4EA 1TJ1A 2OZ3A 4JYFA 1W5QA 4JNMA 3THAA 2AAMA 1BQCA 2YYUA 4LFYA 3FKKA 5CBBA 1UH3A 2OO6A 3ZR4A 2QCHA 3PPFA 7CGTA 4ZQCA 2XH0A 5BU9A 4AHOA 2OOGA 2X8RA 4AUBA 1XYAA 2R9RA 2Y5JA 4FEZA 5E1QA 2DQWA 5HNTA 1SZFA 2DP3A 2PODA 1OK4A 3MSYA 2BB0A 5CGMA 3BCDA 4NYYA 3U2CA 1V02A 1QUMA 2QCGA 1WO2A 4DLMA 3MI6A 3ZM8A 4FOJA 3UWVA 3PZVA 1K1DA 4DM2A 5HINA 2JIEA 2BDQA 4J40A 4Q4MA 2BODX 2QPUA 2YCEA 2OEKA 3LRMA 4Z17A 4ZSUA 2OSWA 2CIPA 1O5KA 3W85A 4MNJA 4AWEA 1A53A 2WNZA 1Z7AA 3GIPA 1B57A 3MB9A 4M7SA 2YL9A 1GVYA 3G2GA 3KRZA 4N0RA 4XB3A 6TIMA 2FGBA 3AWOA 3TC7A 1ZB5A 5LIWX 1GT8A 1GOKA 1W32A 1C93A 2FHFA 3BZGA 2OEJA 3SUVA 3S5OA 1R0MA 8TIMA 3TTOA 4O57A 3P3BA 5E0CA 2WQDA 4EXBA 4R9XA 5K9DA 1R86A 3N15A 3LPOA 4PMOA 2IPGA 3IIZA 3AO0A 4J1OA 3PZIA 1NU5A 1P7TB 2XH4A 4O12A 4LCSA 3SN1A 2J25A 3UR2A 5TQLA 3HFYA 1O66A 4HD5A 1VBUA 2CLLA 1AA1B 2ISFA 3NL5A 1BVZA 4Q4KA 4PN2A 3VZZA 4GJ1A 5AVHA 2WCGA 1HX0A 1R2SA 4NI8A 3EOLA 5DRCA 3BGAA 5I07A 3VIKA 3W7MA 3PNZA 5FAJA 1W5OA 3CZKA 4NX0A 1TB3A 4BF5A 3MO4A 3LS9A 4GABA 3SUUA 1J6OA 4DIAA 1UWIA 5DY3A 3NYDA 3LLXA 3V0TA 4DBEA 3PG8A 4WLCA 3VNKA 2XGIA 2CBUA 1YIXA 4LANA 2AOSA 3VC5A 3KBMA 1N8IA 3MUZ1 4NNAA 3SQSA 5A8GA 1LWHA 4A8RA 3ALFA 4C90A 5JBEA 3W6MA 1TPUA 1EL3A 3NG3A 1HXJA 4TTUA 4DUWA 1Q6EA 2QDDA 3S1VA 3AWNA 2F7FA 1E0XA 4XISA 1LT8A 2MUCA 1M7PA 3B9NA 4X0VA 4DYEA 1PIGA 4O10A 3U8GA 3P60A 4ADSA 3QEZA 2HZGA 2WWCA 3BVJA 1ZSXA 1ZS2A 4CU8A 3HQ1A 1DWAM 1KFKA 1XXXA 3MUIA 4CN4A 1FH8A 4AHPA 2IQDA 4PMRA 1H7XA 1ZBWA 2H8XA 2VZUA 4O1CA 1YXCA 1UUQA 1US0A 3UPMA 1U1HA 1KQZA 4AQLA 3N4AA 4RUBA 5AOUA 3RG6A 3NFUA 2VX6A 4XSMA 5G2HA 4NG3A 4BFAA 4F9DA 1OC5A 1G67A 1LUCA 1UB3A 3N2CA 1ZJBA 2OGYA 5D2WA 3S1WA 3RN6A 3W70A 4KS0A 1EWDA 1KM3A 5CJNA 1PX8A 5FI8A 4DJEA 4DF1A 2QJIA 3SIZA 4KMQA 2GZXA 2ODOA 3WNOA 1SVDA 3FEMA 1WXJA 1XLGA 2XWDA 2D20A 2HNEA 3VKJA 3E2SA 1XIEA 5CXPA 2FZDA 3S6OA 3GS6A 2CLIA 2NVCA 1YRRA 5EMLA 4I8DA 5E70A 4JFVA 4OBTA 1OINA 3COTA 1OIMA 5HA7A 2BSLA 1ZJAA 4QLLA 2CLPA 4ZQRA 2Y8VA 4R7WA 4H7ZA 2OXNA 1QCWA 4DO6A 3G5EA 2VX7A 2FGZA 3R10A 2W79A 3L2IA 5HNUA 3M47A 4U2ZA 3HG2A 1MW0A 2QCNA 2JKPA 3RM8A 3IJ9A 1S5MA 3TP4A 3JZUA 2FFIA 2HEJA 4ICNA 4ACZA 3PHAA 1EC9A 1Z44A 1KNWA 4W93A 3P80A 2ZADA 1TPH1 3UA3A 2AL2B 3TV8A 3H4GA 2R1PA 1ISXA 2C71A 3GH7A 4U5KA 2BMBA 3TONA 1RCXB 1JDAA 2NQ5A 1DKWA 1XRTA 4GVFA 1M03A 4Q4SA 2Z27A 3TA6A 4YVPA 4AW7A 4JEQA 4XZ9A 7REQA 4IP5A 3VINA 1HGWA 2I5QA 2IQTA 2V3GA 4IMGA 2VGBA 4LEQA 4JN8A 4GI8A 4M81A 3ABOA 5LKYA 2NZLA 1JCXA 4ECLA 2ABBA 3WD2A 4DPPA 3VVGA 2FZ9A 5FL1A 4ZO8A 4IPJA 4KFOA 1HW6A 1XGDA 5CPOA 2ZVRA 2NQ9A 4A21A 3WH7A 3SFWA 2J8GA 1A49A 3SN0A 4KQNA 1ZBCA 3HTWA 4JX5A 3PBGA 2J88A 2J9XA 1H51A 1XP3A 2NSOA 1E0TA 5AYBA 2G4FA 2PDIA 4P7QA 1JZ2A 1IXOA 4C91A 3BGJA 3L67A 1RSCA 4QDWA 3NTYA 1GOOA 2GLKA 1OD0A 4RE3A 4C6JA 1GVOA 1PV8A 2CBIA 3B0YA 1M1BA 1KTCA 3BH4A 4RW3A 3WUEA 4B91A 4JOMA 1YW1A 5A1AA 1PYMA 1KM2A 3TCEA 5DN1A 3GG7A 5FESA 3WF3A 4TV5A 3N1AA 3AXMA 3E02A 1XSJA 1KM0A 1SYTA 1JF5A 2HISA 3H54A 3GU2A 2X0YA 1DP0A 2BVTA 4Z2IA 1PVNA 2GSJA 4QDPA 1UC4A 3AQUA 5E5CA 4L80A 1P0DA 4DWSA 3H53A 4XTIA 3BLDA 1XKJA 4D2JA 2VEGA 1F73A 4M29A 3MUCA 1WZLA 4CD5A 1OF6A 1S2VA 1XFCA 2OX1A 1QATA 2DSUA 3LNPA 4F0HA 4CVUA 3RXZA 3SZ8A 5A3HA 4LRSA 3OODA 2ZA1A 3AICA 3CUFA 4NZ1A 2NV2A 3WN6A 4YVVA 4AIBA 4HU4A 2NQHA 2AQOA 1MSSA 3E2VA 3NL3A 1MRQA 3SGGA 5D4YA 3PZQA 2VJXA 4BQ4A 3P84A 3QC0A 3CV1A 1VPQA 4US5D 3QKEA 2FJKA 1DQXA 1EDTA 3TYCA 3OYZA 3FVDA 1XYLA 1Y65A 1PO9A 4FOUA 4WY0A 1AL7A 1Y5VA 2BOEX 3DFSA 4BK9A 3T7VA 2R14A 2ZUNA 1Q8AA 5LNWA 1XJBA 2IKIA 4H8NA 3YPIA 3PZUA 1ZJHA 4HMDA 4GWEA 4LC8A 5TAOA 1UQYA 4OIFA 1HF6A 2DV0A 3WD3A 4NJKA 4TUFA 3PZGA 1R5YA 4NAEB 1WBHA 4AB4A 5LA0A 1FP9A 4H6KA 1E40A 5CC5A 1VLIA 4DF0A 4NJIA 3ARVA 3PWGA 3HIJA 3IUIA 4IGMA 1G4EA 3TK7A 1KRCC 4BJHA 1H1ZA 5CG7A 4GH1A 3ARXA 1P4CA 3PTMA 1F7BA 4KGJA 8RUCA 2FFCA 3LHYA 3FJ6A 2QCCA 4JKLA 3OO2A 1KC7A 2CHRA 3LB0A 1XIFA 2B4GA 1S2CA 4FNQA 1TJPA 3H6OA 5HATA 4X2PA 3CEUA 3ZJ6A 3CLMA 4ZA0A 4Z1BA 4H9YA 3T4CA 2HQAA 4S3DA 5CEWA 3GO2A 3U7VA 4UNLA 3WQGA 1QPQA 2P10A 2A6LA 3BLEA 3AZRA 2V81A 1YX1A 4JX6A 3TOPA 5DCBA 3WLKX 1CW2A 3ZT5A 4WKHA 3L4VA 1EYWA 3P6LA 4HTYA 1JJKA 3I6TA 1XF0A 4ERGA 1O5XA 1MZRA 1MEWA 4MDOA 4A3YA 4O0KA 1P5BA 4YLWA 3QTPA 1TWWA 4C6IA 2HWGA 4XQ6A 3I4KA 3FFSA 1M5WA 1S5WA 3NAVA 4MHBA 4H2HA 4WGHA 4LBUA 1UKQA 3MJYA 1BKSA 5D9PA 1TQJA 4O0QA 4X2RA 2WKLA 2PD9A 1FWWA 4FX8A 4TV6A 4EXAA 4I3GA 4LRTA 2DSZA 1QRQA 2J62A 5H2ZA 1Q2SA 4R33A 4FF5A 4XZHA 1TRDA 4QNWA 1IWAA 1XLFA 5EMMA 4LS2A 3LN3A 4URIA 3CXOA 4HJWA 4EXQA 2VWSA 1QNVA 4PSRA 2PBGA 3GC5A 4U3CA 2UBPC 3BW2A 5DCEA 4MFEA 1UCWA 2J8TA 1V3HA 4GUJA 4YHGA 1R3YA 4R7JA 4PUKA 1CWYA 3WQEA 1PJ9A 2Z4GA 3CBWA 4H4IA 5HR7A 3PUGA 4Y2WA 1PS9A 1PB0A 3QR3A 4YTSA 4OBRA 4XZBA 3EXRA 4FIRA 3G1YA 3PANA 1SZGA 2GQ3A 4LY8A 3THDA 3BXWA 4AY7A 1FWCC 1KBKA 1H2JA 4D9PA 2CPUA 1TJRA 1LRNA 2GJRA 1ZTVA 4KT2A 2KX9A 1G6CA 5EL1A 4PMNA 1ADDA 2OODA 3PC0A 3EWBX 3AXXA 5E93A 3M0JA 3TLQA 4LUTB 2WV8A 4E6MA 4KF1A 4EVZA 1AW1A 1RUSA 3R4IA 4IIEA 1GQIA 1L8PA 3RCYA 3A12A 1WUFA 5LA1A 2PTWA 4HK6A 5M1TA 1EB3A 2H3DA 5I3HA 4P61A 1VBJA 3WMSA 1E51A 1K8XA 3AXKA 4FLSA 4GNKB 4AZ7A 2ZTJA 4E2DA 4XBJA 5BRBA 2BGSA 1DYSA 2W62A 3KTCA 3RO8A 1VYRA 4NZ4A 4IICA 7ODCA 1W0MA 2VMFA 2X0HA 3PPCA 1YTKA 2YL5A 4Q8MA 5B80A 3EMCA 4EAYA 3URQA 1GUVA 4XVDA 3A47A 3NA8A 1LWJA 4IP7A 4XVEA 1BYDA 3LCHA 4MJ4A 1F05A 3TSBA 3U4AA 5HANA 2VCBA 2WCSA 1ME7A 1BWVA 3LENA 3PSWA 5FF3A 1KCKA 1NDVA 1JCTA 2YOCA 5CBJA 3THCA 4HHMA 2RJHA 2WZMA 1VFMA 1X7IA 4AD0A 4UTKA 1R38A 4E2VA 2C16A 1NDYA 4HNNA 2H9AB 1QNPA 3U3HA 3E5PA 4PC8A 5J8LA 1RPXA 4GQRA 5FJJA 3QXBA 4MVAA 1BRLB 1PZ0A 1W1VA 4WDTA 3GXTA 4OVXA 3B9AA 4MPKA 1VCFA 3S1GA 1CEOA 4DVOA 1MYRA 2WZHA 3HQNA 3BLPX 3CWOX 2G95A 1GKQA 1RAKA 4DXVA 2QJNA 2FGLA 1CTNA 1DJGA 3ZT7A 1WDWA 1SJCA 3TXVA 3CL7A 2AKZA 3S42A 1Y5XA 3WBYA 1HKJA 4O1BA 2G3NA 4FLRA 4RR4A 2VDIA 2ZZ3A 2VR2A 3CMFA 3SRHA 4ZVJA 2NV1A 3S5SA 4D71A 4HPXA 1M6JA 3AUJA 5G5IA 4HNLA 5JIWA 3AYTA 2XFWA 3EX4A 1D3HA 3ITLA 4XZWA 4OGZA 3UXKA 1RCOB 3VNLA 4YL2A 4NX5A 2DSWA 2P1FA 2I7GA 1QBAA 4NZ3A 3EA2A 3PR2A 1AW2A 4GIYA 4W7UA 3F2CA 3BK0A 1C9WA 1XGZA 1A5SA 1A0CA 1UD4A 4GYPC 3D6NA 3H7RA 4B16A 3OHIA 3OU8A 2E0PA 2DDXA 3N3TA 2DZPA 2G3MA 1R30A 4GNVA 4RNIA 1FX6A 3TROA 1ITUA 1GQJA 1RD6A 2QGHA 4IMAA 5KZ6A 5FJRA 3SCRA 3VDBA 1WBJA 1I2NA 1QJWA 3TYBA 2ZZ2A 4AF0B 3RITA 3D47A 4LUYA 1TE6A 1N82A 3G1RA 4WZHA 1LWIA 1A3WA 1C7SA 3DESA 3VDHA 1IZCA 1JQVA 4DJED 4I7UA 2PC8A 3G77A 4FMVA 1ODZA 4PUEA 4MIMA 1GVFA 3MVIA 4E3TA 4EAMA 1PEZA 4M0XA 3DERA 4FP1A 4QRNA 1EUNA 5ABHA 4RV3A 5EMYA 3WFLA 5C9ZA 3WLTA 5FEZA 4F4RA 2FTWA 3GC2A 3QLLA 3CUHA 4Q6XA 3RX3A 3A6OA 5J5RA 4LEFA 1OFBA 2ANUA 4RZ5A 4B2DA 1DJXA 2DQXA 2NT1A 1BYCA 5AN7A 3P8IA 2CLOA 4Q8TA 2WVVB 1PCKA 3M0XA 3S47A 1QW9A 6REQA 3VIGA 1K8ZA 3DFQA 5T9CE 1KCXA 3VNJA 3B04A 4O1DA 3WUFA 3EDFA 3CIWA 4EK7A 3P62A 4L9ZA 4I9AA 5BXSA 1TV5A 2PWVA 5D2XA 2EBNA 1YXYA 2OWXA 3PPGA 4KWOA 4MUZA 4ZTYA 1QI0A 2YXOA 2X2YA 4C7GA 4KCVA 1GJPA 3K4WA 1BTCA 2CWNA 3W1MA 1AH4A 1NELA 4JPGA 4MYAA 3U48A 4O8AA 2O4MA 2SFPA 3MP4A 1WKYA 2HCVA 3FSUA 4MWAD 1TV3A 3VOFA 4IMDA 4NIRA 4B5XA 1QU4A 5DEZA 1FQ0A 3G8EA 3OLGA 2BOGX 2V69A 4QTGA 4S3GA 3PFRA 4OQVA 3U2EA 2PCEA 1YLVA 4MB3A 3CEPA 1GKPA 1M04A 4WRHA 1B90A 4HHPA 4O14A 4EF9A 2V67A 2FTPA 3LNMA 3BAIA 4REQA 2TAAA 3C2FA 3KTXA 1YDOA 3E74A 2BHZA 4OECA 3GXMA 4C6CA 3CV2A 4GI9A 2ZIDA 5DY2A 4UTJA 1MDLA 3G0UA 5CZJA 3SCUA 1JZ5A 5T9BG 4AEOA 2PC4A 2VFFA 4HZ7A 3ENLA 5H6HA 4LAOA 5AYYA 1RVGA 3W02A 1UD2A 3NGFA 4UTTA 1QR7A 4IPPA 5JMUA 4IPNB 3G6LA 4JTLA 2CCRA 4B5UA 3UCQA 1WB0A 4D1IA 4TTGA 5B7YA 1GVQA 3T0AA 4QJ4B 4O4VA 4YXGA 3WYZA 2X09A 3B4UA 2VZOA 1JGMA 3LBCA 1ZHAA 3BURA 4Q3MA 1KWGA 5E09A 3NPVA 1J11A 2ALDA 4KWUA 2G97A 4C6NA 2Y7FA 5HQMA 5HWMA 3NSNA 3KDNA 4JNYA 3VIHA 3GX9A 2ICSA 1JEZA 1E0VA 4LQ1A 3A64A 1HP5A 2YBVA 1M9HA 2X0SA 1FA2A 3L4XA 2CHOA 5GQBA 3MHUA 4GUHA 1O95A 1Z32X 2BBFA 1JPDX 1J0JA 2DT0A 1F9CA 1L6SA 3TQVA 1Q7QA 4WR3A 2P3ZA 3WLJA 2UV8G 4JTSA 5D9OA 4TMCA 1XGEA 1O60A 2H8ZA 4D72A 5C55A 4MAVA 3CAVA 3KOXA 3WQFA 4JTCA 2UY5A 3AALA 1IIHA 3LCXA 4ZTXA 3TJXA 4JS3A 1G5AA 4GYKA 3RIKA 1VENA 4ML4A 1VHCA 2JFEX 3T2QA 1VFHA 2QF7A 1M7XA 1MQRA 1N2VA 2E3ZA 3VC6A 3PB2A 3RO6A 1FXQA 3N29A 2POZA 2GGGA 4DXKA 5D30A 1CIUA 5I78A 2BGNE 4NXSA 1B5TA 4PCFA 3KFTA 3QTGA 3C0JA 2LLEA 3SRDA 3B8WA 1F07A 2ZE0A 1W9BM 3S2JA 3WJXA 3A4XA 4DJFC 1BF6A 1HG3A 3IAPA 5E0FA 2WVVA 4F2UA 2RUSA 3A23A 8XIMA 4DBUA 2EKCA 3KDOA 1H41A 3VOJA 3GDRA 1BVWA 2OFJA 4UR9A 5KZDA 3ZIZA 2IQ0A 3BJFA 4PFHA 2TMDA 1DWJM 5BMXA 2WNQA 4W89A 3FHQA 1XH0A 4UR7A 4R7OA 1O4UA 1L6GA 4GINA 2PWUA 5FAGA 4AFYA 4QJ5B 1PX4A 2HVNA 3EXSA 2ZX5A 3GKFA 3SCTA 2VNCA 4M6QA 2DVXA 1ENUA 3UEQA 4BS0A 3DKJA 3JU2A 4E4UA 5FF0A 1UMLA 3W7DA 2E6YA 4W5UA 5GPRA 4TU1A 3WEMA 2VELA 2XWEA 2D2JA 2OMAA 4MY1A 4PCSA 1QK0A 4JFWA 2WMIB 4W85A 5AYZA 4NU7A 2IXVA 1QWGA 4H7VA 1W2VA 5EYWA 2VL4A 3UA4A 2F6XA 3TAKA 4Q8QA 1EF3A 3M7WA 3EB2A 4JKMA 4PFMA 2ZZ1A 2Z1BA 3LPFA 2QHAA 4ZOCA 4K1GA 3TZFA 4UFMA 3B0UX 2QCDB 1H7PA 1GHRA 4AXKA 2DVTA 1ZQ5A 1V3IA 3NQVA 5AC7A 2ADAA 1XPGA 3W71A 4LUSA 1JDCA 1C92A 3CJPA 4DJFA 4DUVA 1R2TA 1HUVA 4GZJA 4Y96A 1Q6RA 1Z69A 1Q4WA 1HO4A 1H4PA 1ISYA 4KCWA 3UJSA 1R2RA 2WSQA 1Q13A 1OWQA 3T8QA 4DBDA 1VZWA 2X42A 1GW9A 3CYVA 1D8CA 1CI1A 1TA3A 1PZ3A 3FAWA 3VNYA 3NIYA 1B3WA 4MJMA 3TN6A 1ADOA 2FPVA 3BJTA 4GMEA 4F66A 1EYEA 3IK4A 1W9VA 2Y63A 3L65A 2O56A 4S3BA 3VCNA 2E1DA 3W37A 4WJXA 1FWIC 3CB8A 1PBGA 1OVDA 3KVMA 1ZBKA 5A6BA 4R5EA 2WM1A 1RY0A 4B92A 2BG5A 2W3ZA 3OB8A 4HPHA 4MY8A 1E9LA 2ZRYA 4U3AA 1RCQA 4DNMA 3MP3A 3M5XA 3WLRA 2IUZA 3IIXA 3WX7A 1AH3A 1H7RA 2B7QA 3H2AA 4A22A 4HSHA 3PF3A 3RR4A 2CERA 3S3GA 2ZXBA 5CKSA 2GL5A 2G3IA 3U0HA 4BCEA 3HF3A 1JZ7A 3S5YA 1TZ9A 4L4PA 3M5YA 3OLDA 2QT3A 3L7RA 1RD5A 1LL4A 3NO5A 3CWNA 1PZ1A 1OD8A 3OZMA 4CCCA 2QVHA 4X22A 4JL2A 3WJZA 4C6MA 2C13A 3HOJA 4MJ2A 1XLBA 3KBJA 4IQDA 1CCWB 4MB5A 1ONEA 3FKRA 1J0KA 1TZZA 3GQYA 4C7DA 1XIIA 1CXIA 2WNWA 3AS3A 1E6QM 1QVBA 1H1NA 4LS0A 1UR3M 1TJ2A 3P8JA 4LUTA 4HA4A 4GFIA 1SJDA 1T8XA 3BMWA 4YJ5A 1SW7A 5DFAA 1HJWA 4HZMA 2B81A 1JNEA 5LZLA 4QXIA 4H9ZA 4Z2KA 3PWAA 3V16A 3K4AA 1REQB 1XSIA 4HCHA 2ZE3A 5DMMA 1Q66A 1MXDA 4NZJA 2WC4A 2ZA2A 3ZVHB 3DU0A 4A3UA 3U5UA 1OCBA 5DT7A 5KINA 5DQPA 3GAKA 2OZTA 3MS8A 1EH9A 3QV6A 1XH1A 3WF1A 2CITA 2OJPA 3OHMB 3IJ6A 1J18A 2YIHA 3GUGA 1UBSA 3Q65A 3P61A 2QIWA 1W1PA 1RBOB 1AMKA 1UH4A 4JTAA 2ZZ5A 5C70A 3C4UA 3RF9A 1OHLA 1BKHA 2XIQA 4MKVA 2Q8ZA 2QW5A 1YPXA 5C0QA 4C6BA 3A3WA 4F9JA 4GBDA 4V28A 4IMCA 2CW6A 2CYGA 2Z1XA 3PBUA 1XUZA 1J2BA 1H5YA 3L23A 3DI0A 3TZNA 2VOTA 4LH8A 3IRSA 1OFAA 1PE1A 3WK1A 3GKAA 2YA1A 3GU9A 4ORIA 3TFCA 4Z1DA 4AVNA 4DLFA 2CXEA 4AF0A 2UY4A 2WHKA 3FYOA 3GDMA 3KL3A 4KRUA 2XU2A 1EBGA 1JL8A 4UC5A 2QUTA 1XC6A 2A7RA 1B3XA 2YL8A 4IF2A 4LT9A 4IX2A 2NVAA 4JBRA 3ITXA 4XIMA 2P88A 1R87A 3TAOA 1A47A 1KFCA 5HDRA 3K1DA 4O19A 1CECA 4M8UA 3W27A 5EPDA 2TSYA 1ISZA 1JFXA 4GYFA 4HNVA 1TX2A 3AUOA 1FXPA 4BHYA 3E0LA 3G6MA 1HQTA 4QJ1A 2OLAA 1UZDA 1W37A 2XSXA 5FJUA 4MNKA 2GJLA 1ICPA 4GX8A 1U1UA 2Z6IA 2J77A 3IJ7A 4IIBA 1K4GA 4LV4A 4MMWA 1ZAIA 3VNDA 4ZB0A 5CQ1A 3T05A 1FHDA 4DWSD 3STEA 3MMTA 1KM4A 1FWTA 4C6EA 5I7GA 1TPC1 3QH2A 3IIOA 4ENLA 3ANVA 3FAXA 3SSJA 3VCRA 4HVXA 2QULA 3TEVA 3B9EA 1V7AA 3KW3A 5CC3A 3LGGA 3CC1A 1W91A 3A9IA 2J78A 1WKFA 2QDGA 3VMNA 1FTXA 1SUXA 3GVGA 4L4LA 1B3VA 1U30A 4DBWA 4O54A 4GVHA 5I06A 1EHAA 3MA8A 3CH9A 1CXFA 4JQ4A 2V3EA 4S3AA 3HJEA 3UJFA 3UW6A 3S2NA 3ICJA 2WMKA 4IJCA 4K36A 4ZOEA 1MXSA 1W3JA 1VC4A 3BSHA 2HK0A 4B9YA 4D8LA 4WJ8A 1SGJA 5J04A 1EFZA 1AJ2A 4R9OA 1AMYA 3W2JA 4C5ZA 5EBAA 4QROA 2IMRA 2RH9A 3E2QA 2EG7A 4O17A 4AHQA 3B3DA 3GWQA 1JULA 5HQEA 1E6SM 4QE5A 4YTTA 3GK0A 3GDBA 4M6UA 3W7HA 1D7KA 1WDDA 3GNPA 1E9YB 3GB6A 4IJRA 2EQDA 3NQDA 5DMNA 3FHAA 2ZWYA 3VX1A 2FB3A 4FNUA 4LNCA 3AMKA 1H49A 4AZIA 3C8FA 1UWAA 4G1NA 2CLMA 3AMDA 1Q4NX 3ZLHA 1BEUA 1YPIA 3MBDA 4RZ4A 2PWFA 3NWRA 4GQ0A 3C6CA 2FMOA 3ITYA 2JALA 4K6AA 3BJSA 1BVNP 3GVQA 3UR7A 4H3DA 3UG3A 3VO0A 1OCNA 3KE0A 1T7LA 3Q94A 1H0GA 5K2ZA 2GWNA 3NVDA 5FJTA 3DYOA 1SW3A 3AMCA 1QO2A 4EACA 3N17A 4DHGA 3DIPA 3BOXA 4G1KA 3K13A 3QBUA 5AY7A 1QBBA 1X1OA 4PCNA 3XINA 3HPXA