3SIZA

Crystal structure of the mutant s127a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMAHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of the mutant S127A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor BMP
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
total genus 84
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sizA00
4NX0A 3QPYA 1SO6A 2DZPA 3G3MA 2ZZ4A 2O7QA 1FWRA 3QC3A 3W83A 3MI6A 2C14A 2VOMA 3EWBX 2ISVA 2YXGA 3GNNA 2VKZG 2FQIA 1I2PA 1TPEA 3PC0A 4DPQA 3CWNA 3THAA 2FIQA 1YXDA 4JTFA 3TCEA 1LYXA 4Q4KA 4HSNA 3QJAA 2FLIA 2E6YA 5C2XA 4JTEA 2VFFA 3CB8A 1IXQA 1XDMA 3S5ZA 1DJQA 2P0OA 4AWTA 1RD5A 4K7YA 1PL9A 3F4WA 3BVJA 1QAPA 3PF3A 3KOFA 4Z08A 3SECA 3T7VA 4O53A 3NQCA 4XTIA 4DEFA 1RQBA 2QR6A 3NR0A 4N2YA 2QAFA 3B0VC 2NXHA 3TMLA 3ABSA 3W7QA 4ALDA 3LERA 3M41A 3FIGA 4WY0B 2WSRA 4M19A 4AH7A 1QO5A 3NAVA 3OG3A 1HFBA 2JKAA 4OE7A 1YYAA 5C54A 4MFDA 2ZZ7A 5ABTA 4FNTA 4KFNA 3W3OA 4K8EA 2ATSA 1TTJA 4FNPA 2JKPA 3R89A 3W7CA 4Q32A 1W3IA 4MFEA 2J6XA 1I4NA 1KFKA 4D2JA 1KFJA 5I3GA 5EBUA 4AWSA 2NWSA 1FUYA 1IGSA 5K4ZA 5CPMA 3LHUA 2VXNA 5D05A 2PC4A 1EEPA 5F2MA 3LHVA 5K2ZA 3QF0A 2PCQA 2A4AA 5L9FA 4NU7A 1DBTA 4FX6M 4FXSA 2GOUA 4TMBA 2J27A 1YPFA 4CCCA 1FWWA 2ZZ2A 3L66A 3PBUA 5D2TA 4ZQMA 3ELFA 3UWVA 3PBVA 2ZRYA 3QMSA 1TJPA 5EL1A 1T99A 3G18A 2X1TA 3NL2A 1ML1A 2XN1A 3SSJA 3W2JA 3NL3A 1TPWA 3MI3A 1VC4A 4JTTA 3FLUA 1EP1A 5E0KA 1VCFA 3SI9A 5D38A 1DQWA 1FWSA 4EVZA 3LTYA 4E2BA 2E6FA 2A7RA 1VHNA 3P8JA 1V5XA 3G1FA 3W7DA 3UD6A 1EB3A 2V2DA 4O52A 4EF8A 3R12A 4O0ZA 1B9BA 3UWWA 3OBKA 2Y7DA 5EPDA 1VHCA 3MI2A 4LT9A 5DBUA 2A85A 1BWKA 1KM6A 1N7KA 4LUJA 3LRMA 3C61A 3I7QA 4NJIA 4ONVA 1BWLA 2CLLA 3QM3A 3V75A 1FXQA 3QW3A 1ALDA 1PHWA 2GQ8A 3N9SA 4O17A 3MHGA 3MWAA 3W7KA 1WBJA 4UNLA 3NQVA 4GNJA 1EP2A 3TSDA 4ML9A 2V0TA 4MJMA 3RLVA 5LHEA 3PULA 4IMCA 4UCGA 3E49A 4DELA 3GDMA 4YCPA 1ZALA 2DJXA 2B7NA 1OX4A 5BMWA 3S8HA 2Y89A 3LTPA 1XM3A 3W1AA 1P0KA 3GIYA 3EX2A 2EHHA 3NPUA 2FDSA 3LXBA 3LTSA 3W23A 1GVSA 4AWUA 3EX3A 4UFMA 4MIMA 1CX9A 1LLZA 2WJZA 3ZWTA 4N9EA 4IQLA 1R2SA 2NUYA 3O6DA 4MZYA 3CM4A 5HUPA 3LBCA 3C3NA 1VYPX 2X16A 2ALDA 1QFEA 3OEXA 2QCLA 3PM6A 4TR9A 5IBXC 1G7VA 5HWMA 4O0KA 1KM1A 4CQ9A 4UFKA 4IMFA 1W8SA 2ZA1A 3W72A 1XFBA 1K03A 1UBSA 3QH2A 2O7SA 5LNSA 4FNRA 2Z1BA 3U8GA 3S42A 3EXSA 4HSOA 1VQTA 2ZTKA 3WK2A 2HTMA 4UTWC 4QJ1A 2ZQ0A 1I2RA 1IXNA 1KFCA 3QFEA 2F84A 1KW1A 2CZFA 3DKJA 3L0GA 3TFCA 2HMCA 1F05A 1K7FA 2ZA2A 1H51A 3B8DA 3DGRA 1LOLA 3ATZA 4JY9A 4M5PA 4BK9A 1TREA 3DFTA 3G8EA 3HPSA 4EIVA 4O54A 4NJKA 3LHWA 4FX7A 2QDGA 1OFBA 4NQ1A 1ICPA 4ZZ9A 4MYXA 1RV8A 4ZQPA 3L9CA 4LRTA 3WK1A 1G4PA 1I8JA 5EY5A 4UMCA 3WJXA 1FCUA 3MJYA 1UB3A 4JYEA 1YXYA 2V8ZA 3NOEA 1JR1A 3NGJA 4GUGA 2B7OA 1SFJA 2YDAA 4ORMA 3M47A 1M5WA 1I2QA 2BZNA 5T26A 5CPNA 2C1HA 3UZ5A 2I9EA 2HSAA 3O1NA 1KM2A 2QJHA 4M6QA 3LGEA 2V82A 3G1DA 5DY2A 4PFMA 4JN6A 4MPQA 4XKYB 4A2RA 4RZ4A 2C15A 3P74A 5DCBA 4A21A 4AHPA 3W07A 4AF0B 3I7SA 1Z48A 3QMRA 3G0XA 3C2RA 4K37A 3W74A 1KM3A 1KFEA 1HO4A 1XDLA 3E96A 3KRUA 4ZMGA 2DZUA 1FX6A 3BPWA 4KWVA 1P1XA 2NUWA 1WAUA 4RXGA 3NQ6A 2E6DA 3Q58A 4L4MA 1VCVA 2WOQA 4DPPA 1Q6QA 3DFQA 3PAJA 2YCEA 3N34A 5KINA 3QRHA 3UYCA 3UWUA 3KVJA 3P61A 3PUEA 2V30A 3E02A 5KZMA 1MZHA 4MUZA 1S3HA 1ZFJA 2OT1A 3ABQA 2Y7FA 5KSWA 2E1DA 4LS2A 3GK0A 1WX0A 4WOQA 5IM51 3O63A 3EKLA 1EIXA 3GYEA 4FO4A 3W84A 1RQHA 4GE8A 4RZ5A 3BO9A 3IIVA 3TE9A 2CZEA 4O14A 3W2KA 2NX3A 4WY0F 1FCVA 1J2WA 5LNVA 1AW1A 4R33A 5BOOA 1H7XA 2FB2A 5LNUA 3QZEA 1FWNA 1M6JA 1W5OA 2A6NA 2FTPA 3NM3A 4N02A 4UXDA 3NPWA 2Z2UA 3GKFA 4IXXA 1KA9F 1MEHA 3QW4B 1EA0A 3M5XA 3S5NA 4UFJA 3G3DA 2WPBA 2LLEA 2PURA 3RLUA 3FOKA 3W1PA 4BI6A 3C2FA 1EX5A 2OZ0A 3CEPA 3JR2A 3M7WA 2A7PA 4JEQA 3TAOA 3JRKA 2GVLA 2YZRA 3INPA 3LXCA 3PBYA 1E51A 3HG5A 5G1TA 1OYCA 2G96A 2YYTA 1OVDA 4LVBA 3M1ZA 2DZVA 1B4EA 4N9CA 2VFIA 1K7EA 2OMAA 5AOUA 1ZAIA 2QCHA 1TCDA 2EF9A 3P80A 3FJLA 1HO1A 3GDLA 3HF3A 2ZDRA 1XXXA 3LI0A 3UPWA 1PHQA 3W9ZA 3WFAA 4ZQRA 3MP4A 5F2IA 5FF4A 4BR1A 3L5AA 3A21A 3LHTA 3DENA 1GWJA 2VC6A 3ABOA 4E38A 3G1VA 3P81A 2YSWA 2RKXA 1W3NA 4O1DA 4L4LA 3HG4A 3YPIA 2P10A 2H3DA 4I9AA 2YPIA 2BWGA 4FIRA 4JTGA 1I45A 1VRDA 2DP3A 1Q6LA 3O6CA 3G0UA 1W5QA 3W7JA 2QUTA 3QMTA 4I7UA 1LRTA 3UY8A 1OK6A 4MY1A 3T78A 3S1XA 1OFQA 4M7TA 1TV8A 4EOUA 4LNYA 4AAJA 4ZQCA 3OA3A 3TXZA 4N4PA 1YTKA 1K7XA 1DORA 2C13A 1JVNA 1K8ZA 2VENA 3G1XA 5AYZA 3PSVA 3C0JA 3MW7A 3P82A 3HJZA 4IMDA 2EGZA 4AXKA 6TIMA 1LM1A 2G95A 2CZDA 1EUAA 3KRSA 4TX9A 4DF1A 2C6QA 2PRLA 2XFWA 3NZ1A 4Z1CA 4XWUA 1M7PA 2AAMA 4UTTC 4OGZA 3TK7A 3PB2A 4WZHA 1DJNA 2GQ9A 1YTEA 3USBA 3FKKA 1AW2A 3Q37A 4O1AA 1SZFA 4EWND 1G69A 2JBMA 3P5ZA 5D30A 1ICQA 1GTHA 1MSSA 5K7JA 1OHLA 3SW6A 3NNTA 1XUUA 4UFHA 4JX4A 3UXDA 4JR5A 4UTHA 3NL6A 4GWEA 4OQVA 4GBUA 4C1KA 3KXQA 1XBZA 3DFOA 2C19A 1VLIA 2QEZA 5MHBA 3A5FA 1N8FA 4TU1A 3TKFA 3HO8A 2VFDA 1SW0A 2OJPA 4FEZA 1Z44A 4YCOA 3DFNA 4HHPA 1JRCA 3ZR4A 3UXAA 3GR8A 1H7WA 2X30A 4AB4A 5AHIA 1SSGA 1VCGA 4JYFA 1SO4A 3GNDA 1ME8A 2NUXA 3TU9A 2PRMA 3B05A 3MYOA 4HKPA 4CNPA 1YPIA 2Y7GA 1N55A 3G0SA 4IPJA 1QPNA 1DQXA 1TPVA 3R13A 1GZGA 2A7NA 3U2OA 1Q3NA 1VZWA 4LC6A 3HB9A 3L68A 2YFNA 3RFAA 4BFAA 3F03K 1LBLA 1LP6A 3RF9A 5LZLA 5BRBA 4OU1A 5F4WA 2OCZA 4PH6A 3C8FA 3FS2A 3BG9A 3TQKA 2C18A 4GUFA 3TQ0A 2BXVA 3DXIA 2NZLA 5LNRA 1VGAA 3DFSA 1QDSA 3SFKA 1QWGA 1OABA 2VEPA 5AC7A 2CZ5A 1GPWA 5K3VA 4TIMA 5D2XA 2AQWA 1SR9A 1FCBA 3UZJA 3TW7A 3O6YX 3GDKA 4LVFA 1TRIA 1KV8A 1H7OA 3LB0A 2YFOA 3W2NA 2A5HA 3LRKA 4WY0A 5KTLA 2RDTA 5AB3A 2F7FA 1TPC1 3W7NA 2Z6JA 4K38A 2TMDA 3C4UA 4AVFA 4OBTA 4KFOA 2A1YA 5TIMA 1TPUA 3A23A 2H3BA 1DV7A 3RNDA 5FEZA 1UUOA 4UTJA 5HUOA 3EX1A 4LS0A 5D04C 5HMSA 4IWWA 5DLCA 3UY7A 4MLJA 1EPXA 3CEUA 3HIJA 4P2VA 1H5YA 3EWWA 5AHEA 5J5DA 1U83A 4ADTA 4X3ZA 5HINA 4PTNA 1H50A 2V5LA 3SIZA 3KRZA 3IRDA 1WBHA 1GEQA 1F6KA 2A0NA 3W1MA 1WDWA 4JTLA 3BARA 3TUUA 3TFXA 3W2UA 2X1SA 2CLIA 3LCHA 4PCFA 4GJ1A 4PC8A 4IX2A 1LRNA 3DKLA 2RDUA 4O11A 3LXAA 4RV8A 4LV9A 2RHGA 3PBWA 3TX9A 1ICSA 4KKXA 1H63A 4S1FA 3I7RA 3B03A 1H1YA 3TJLA 3NZRA 3IGUA 1MEIA 1ZAJA 3NYZA 3P60A 4R7JA 2H8XA 4JDYA 4IUOA 5AYYA 3U6WA 1B57A 3G8RA 4X2RA 3TDFA 2ZZ3A 4Z0SA 2NX9A 2E77A 1T0OA 3LCIA 1TPFA 1LDCA 1A5AA 3ABRA 4NXKA 4U28A 1XC4A 3SGZA 3LX9A 1TQJA 3L5LA 1KTCA 3L65A 4HNTA 3LHZA 2ZZ6A 3P7YA 4QNWA 2DZWA 3HQ1A 1R46A 1YDVA 4CNOA 1OFOA 2Y85A 4WJEA 2R94A 1QOPA 3L67A 3THQA 4N9BA 5GVJA 1DL3A 1QCWA 4NZFA 4LVGA 5I3JA 4RJEA 1O5XA 1GYLA 3QEZA 4PA8A 4NNAA 2I14A 3K30A 2E68A 1VLWA 1KLYA 1R2RA 4WXZA 3A5VA 4YL2A 4XBSA 1U5JA 1W5PA 4KWWA 3S1WA 3MUXA 2ZRXA 2ABAA 4O4WA 1JRBA 5CGQA 1G6CA 1YLVA 5G1YA 4QISA 1I2NA 4Z0JA 4P61A 1H7PA 3W76A 4O50A 2TPSA 4JTIA 3W88A 1GG1A 2QCEA 1VPXA 1WYIA 1ME7A 3W7EA 4UUIA 2X1RA 2QCMA 2W0UA 4WOZA 1AW5A 1T8XA 5K9CA 1NAL1 3W73A 1TTIA 5G2HA 1A5BA 3FYPA 3NPVA 3FA5A 3KFTA 3PUOA 4JICA 4Y6GA 3AO0A 3LCFA 1PCKA 1TTPA 3S6DA 4QIUA 2DU2A 4EF9A 5C6MA 3CU2A 4NVTA 5IBXA 1LOQA 4LTSA 4WQ6A 5FF0A 1C9DA 1RR2A 2CFFA 3LV6A 1NF0A 2Q3RA 4Z1DA 1K02A 1JJKA 4OHQA 3GB6A 4LW7A 3LBMA 3R5EA 4FXRA 5I3FA 2R14A 3HPZA 5HNRA 3TXVA 3GZ3A 5FEXA 4UTWA 4PEKA 4POCA 1TB3A 4UC5A 3W22A 1O94A 4Q33A 2Z6IA 3E0IA 4FNSA 1XKYA 2NX1A 2V2CA 2UV8G 1G7UA 3GDTA 3KAOA 2WQPA 1X8FA 4M6VA 2Y6ZA 3VCRA 5CZTA 3M5YA 1RZMA 1Q6RA 2VFGA 3N19B 3R8RA 2J9XA 1X6UA 2TYSA 4BI7A 4GUIA 5LHFA 3O06A 4BWLC 4AEOA 3W7IA 4FB7A 4O19A 2NXGA 3IGSA 1KV5A 1SO5A 2A6LA 4JTJA 1Q45A 4CQAA 3LCXA 1Z41A 2JK2A 3W71A 1G4EA 1RVGA 2FPVA 3BW2A 1EWDA 1LORA 4HIBA 4JD4A 4OWGA 4HPXA 1OX6A 1FXPA 2QCFA 5BNKA 1F73A 4DO4A 5AHNA 3STEA 1ZNNA 1WOBA 1HUVA 5AYXA 1IXOA 2Y88A 4IJBA 1FWTA 3HMJG 1KM5A 1OK4A 1TV7A 3L2IA 5J5RA 3UWYA 3BLEA 1P0NA 3T44A 3B0UX 4XKYA 5KITA 4IGHA 1DHPA 4CLMA 1AL7A 5HR6A 4AF0A 3TROA 1IXPA 4DO5A 2GPTA 1M7OA 4MLRA 1VYSX 3CPRA 2WNNA 5TBOA 1BTMA 5C55A 4OV4A 3GAYA 5SWUA 3GX9A 2BTMA 3EX4A 3W70A 5D33A 1Y0EA 5HWNA 3UWQA 1K3UA 4RCXA 4LVAA 4UMBA 1PVNA 1DKWA 3W7PA 1L9WA 5HR7A 1XBVA 1JCXA 1K8YA 3W1QA 1KM4A 3HG2A 1H1ZA 4IPIA 2J9ZA 2E09A 5G2WA 3MBDA 4MY8A 1NF7A 1S5WA 3TC7A 1OF8A 5E93A 4E2DA 3ATYA 4XZ9A 1KFLA 2B4GA 3FKRA 3LV5A 1H61A 1UASA 3IEBA 2E6AA 1TTQA 3UPBA 5AC8A 3W7LA 4PL2A 1TO3A 1WQ5A 4NUWA 1TIMA 3NQGA 2DZXA 3S1UA 1SW3A 5AC6A 4O15A 5CSRA 5AHMA 4CCEA 4NJJA 3STFA 1PE1A 4MZ8A 2OX1A 2QUVA 3I6RA 4FHAA 2HS8A 5D2VA 5LSMA 2ATMA 3M5VA 2VFHA 4UNKA 3P8IA 2QCDB 1JUEA 4HPJA 5K9XA 3STCA 1EP3A 3RU6A 4ORIA 4JXCA 1F5ZA 4X9SA 5E1QA 4IOTA 3CLMA 5CZ0A 4DF0A 1LOSA 3NQFA 1AMKA 6ALDA 4WX2A 2DJLA 2Y7EA 3QSRA 3CIXA 3HGJA 2CLEA 5I3HA 3ZS4A 4OV9A 2J88A 1CW2A 4UR7A 3W7OA 1XI3A 2NWRA 3NVTA 2GUUA 3G24A 3HGOA 3W6YA 1D3HA 3G1YA 3HOJA 3W1XA 3TIMA 1GYNA 4UTLA 3EKZA 4O8RA 3M0ZA 4CQ8A 4Y8FA 3W1UA 2NXIA 4LUIA 4JTHA 2V5BA 1I2OA 3SJ3A 2HS6A 3NXFA 4H6KA 2V81A 1TMHA 4IX0A 4QSHA 3QYQA 1OFPA 1P5BA 3DH7A 3H55A 3IVSA 2ZBTA 4K36A 2BLEA 4TMCA 4NNBA 1QOQA 3NQ2A 3NQ7A 2VFEA 4JDBA 3BV4A 2CLKA 3TW6A 3N9RA 3W2MA 4LC8A 2NV2A 3ZWSA 5AHFA 3FYOA 1WV2A 3T40A 1JQVA 3IIZA 5F1UA 1YADA 4DO6A 1ZCOA 1UUMA 4MYAA 1TPH1 2JGYA 3GVGA 1FY6A 2YR1A 3C2EA 4M7SA 2X2GA 2X1UA 4MOZA 2CLOA 3P62A 2FPYA 1LCOA 3TMQA 4QITA 1MXSA 3PUDA 3KVMA 2E5CA 3UNDA 3C6CA 3ANYA 4PL1A 3TV8A 4CCDA 1ZHAA 4O18A 1GVQA 1S5TA 4JTSA 4LOCA 1JCYA 4XQ6A 1F7BA 3B4UA 4UTTA 1ZJIA 1NFBA 1JCMP 1SZEA 4JTUA 3TA6A 2ZRVA 1SZGA 2B7QA 3RK8A 2B0MA 1FBAA 1KLZA 4E0CA 1X1OA 4GFSA 1UCWA 1GQNA 5DELA 5CG7A 5D03A 1PV8A 1V7YA 3BGGA 3RMJA 2CW6A 5U4NA 1VJIA 3R2GA 3O16A 1YDNA 3GLCA 3NPXA 4R34A 2QJIA 5TQLA 1OYBA 3O05A 4AHOA 3PG9A 3HG3A 2C0AA 4MY9A 4WD0A 1QO2A 2QF7A 2Y61A 1JQXA 3MP5A 2EKCA 1OFDA 1W31A 1ZAHA 3F1QA 3KHJA 5G2IA 3VE7A 1OFEA 3QQ0A 4PODA 4XTDA 1FDYA 1ME9A 3DZ1A 3MP3A 3IVUA 2R91A 4XUGA 4Y9AA 1TPB1 2GQAA 2FFCA 3KX6A 1IIGA 2PRHA 1QPQA 3PS7A 4UMAA 4JIQA 1R30A 3HPXA 3A22A 2WKJA 3PB0A 4LU0A 2GJLA 3LLFA 1W0MA 1K8XA 2CLMA 1GG0A 2YW4A 3MBFA 4S2BA 3BW4A 2ISSA 1GVFA 4O10A 1G67A 3DU0A 1B4KA 1Z42A 3L0NA 3EB2A 3M6YA 4WXYA 4YWIA 3P67A 4JX5A 5EYWA 1AK5A 3W87A 1DVJA 3KVLA 4ZL1A 1LBFA 4GXMA 2KZHA 1KBJA 2Y70A 5DBTA 3NG3A 3OIXA 2ZRZA 1L6YA 3TSMA 2ISWA 2P1FA 4LV4A 4A3UA 1JULA 4N9DA 2RFGA 1OYAA 5D2WA 3W2LA 3W1RA 3IV3A 3W7HA 1LROA 4IMGA 4Z1BA 4FF7A 3FJ6A 3H53A 4CNNA 3VFLA 3S0CA 1C29A 1KTNA 4DBEA 1FDZA 5HULA 3O07A 1GOXA 1JUBA 2QCGA 3C2OA 3EWXA 5D02A 3C52A 5A5WA 3SY5A 1KTBA 3GAKA 4XBKA 4AHQA 4UTKA 3G22A 1QR7A 2WNZA 3N14A 1JCLA 2ZRUA 1NSJA 4O4VA 1GJPA 2PE4A 1XBXA 4HT3A 4RKAA 3GKAA 1H7NA 1F76A 2ZZ5A 4Y96A 3M5ZA 4BF9A 3WJYA 4U4MA 1GVRA 3W1LA 4Y90A 3UWZA 4O1CA 1VYRA 1L2UA 2ZFAA 4ZVJA 4RK8A 2WSYA 3GDRA 3QSTA 5LGZA 4TO8A 4JIPA 3W86A 2DZSA 4O28A 2YX0A 3CTLA 1W54A 5CZJA 1THFD 2Y62A 4N4QA 3EWYA 3W7RA 2A2IA 3TJXA 1F74A 2C16A 3GR7A 3I68A 3TH6A 2YYUA 4NZJA 5I3KA 2VEMA 3IIOA 2OT0A 3EEGA 1LZOA 1EUNA 4R53A 2TSYA 1OX4B 3TQVA 1QNVA 3CQ0A 1QPRA 5DN1A 3G1AA 4HNVA 1OX5A 2D73A 4YLWA 4K7VA 3A24A 2Q8LA 1JCJA 3NA8A 3N73A 1SQ7A 1QMLA 3M43A 5K4XA 3BG5A 1MEWA 1RPXA 2Z0IA 4OT7A 4LWWA 1G4SA 3WK0A 3NO5A 3OHIA 7TIMA 1XL9A 3MHUA 3WJWA 3IGXA 2DORA 1A50A 3LM7A 4NT0A 5C5YA 1F6PA 1XUZA 5D2YA 3IVTA 5FF3A 3CIWA 3V1PA 3DFPA 4A22A 3C2VA 1CI1A 1H60A 3PSWA 1VR6A 1SUXA 1FDJA 3MO7A 5HJLA 2CLHA 1C8VA 2AGKA 1TSIA 2QKFA 2H8ZA 5H2ZA 3B04A 1SW7A 1NEYA 4KFPA 1HG3A 3N3MA 2YW3A 2RH9A 4O1BA 2CLFA 3CHVA 1PS9A 5FF2A 4QQ3A 3O8AA 2R8WA 4GUHA 2V2HA 4JX6A 4RX0A 3EX6A 5CKSA 1R2TA 1OFRA 5G5IA 5LGXA 3LOTA 3QQ1A 3O15A 2WV8A 3BW3A 3M44A 5F2LA 2I1OA 2H6RA 1EWEA 2CU0A 2V9DA 4HNUA 3M9YA 3VE9A 1TJRA 3DHFA 3LRLA 3T55A 2DZTA 2QCNA 4QM1A 2W79A 3E12A 1OG0A 4UTMA 1FCQA 3LCWA 5G4WA 5F1VA 3W1NA 1SSDA 3F4NA 4K6AA 3N2XA 4S2CA 3GXNA 4M6PA 4GC4A 4ZQOA 3TC6A 1OFAA 4LRSA 3GXPA 4I7VA 2QUUA 4AMAA 1SO3A 3BK0A 5EA9A 1W3TA 5F4SA 3LCLA 3TR2A 3JS3A 4K39A 3DHDA 1X1ZA 1HTIA 2XN0A 4ZQNA 2BX7A 4UIOA 5KMYA 2C3ZA 4DQWA 1W5NA 4RLIA 4FNUA 5HWJA 1YXCA 5H91A 3L0KA 1GVOA 3DI0A 3NDOA 1TV5A 2WO5A 1BEUA 3GXTA 1ZY9A 2GJNA 5EMUA 3Q94A 3PG8A 3NEVA 2H90A 1WOAA 3G1HA 3PY2A 1XBYA 4MZ1A 3SZ8A 4ADSA 2G5WA 4ADUA 4ICNA 1S5VA 4BWLA 3IIPA 5I3IA 2W6RA 4W9TA 1T96A 3L5MA 3W7MA 1W1ZA 1QPOA 2ZA3A 3G1SA 1O5KA 2ZTJA 4C1LA 1TPDA 3TSBA 4N6EA 3B0PA 5DXYA 2EAWA 1KBIA 5DCDA 3WJSA 5K9DA 2Q3OA 5AFDA 5F4XA 5G4EA 1LTDA 4RXFA 1G4TA 5KZDA 4IXHA 4JY8A 4BI5A 1DOSA 1W37A 3EXRA 5CSSA 1GTEA 3NM1A 3NQDA 5L6UA 4B5NA 2ZYFA 4NJGA 3W75A 2B7PA 3M16A 2QDHA 4JNMA 1SFLA 4IMEA 3TNOA 5U7SA 3OVRA 3NQAA 2QCCA 5KZEA 1L6SA 1VS1A 4UR8A 3NQMA 4DBDA 3BG3A 3ZFHA 3LHYA 4DF2A 1SZNA 5CPLA 1L6WA 4FX8A 1A5SA 3WK3A 3EWZA 3LI1A 2ZZ1A 5CPOA 2J24A 3N2MA 3LLDA 3STGA 4UTUA 2Q8ZA 4J9JA 3W1TA 3W7GA 2GVGA 2VELA 5AN7A 1O60A 1ONRA 4A2SA 3LDVA 1X7FA 1NVMA 1WXJA 5F2GA 4JGDA 1OJXA 3CC1A 2WNQA 2CWNA 4H3DA 2QAPA 2A21A 3PWAA 1A5CA 3FFSA 1KFBA 2XN2A 4NXSA 3LCGA 2NLIA 3VKJA 2ZRWA 4UTIA 3DAQA 1LBMA 1D3GA 3TAKA 1SU5A 3WJZA 3SR7A 1MO0A 1TQXA 2GVJA 5AHLA 1UJPA 5HQEA 2JKEA 5D09A 5EKYA 3BGJA 4O13A 1IIHA 1HL2A 1RQEA 3S5YA 4JTKA 4LY8A 2E5DA 1W56A 4A29A 1B3OA 4YXGA 4GUJA 3EWUA 5FI8A 3S1VA 2QJGA 8TIMA 4UFIA 4NX5A 1JCNA 3CT7A 3W85A 3UQNA 1J5TA 1OF6A 1J4EA 1WA3A 3QPZA 1SPQA 1H62A 3BLIA 3D0CA 2IQTA 1BKSA 1LRQA 5DXXA 1VH7A 3MMTA 3A9IA 5A8GA 5LNWA 2QCDA 4MJZA 2G97A 4H4IA 1W5MA 2VEIA 4UFLA 3Q2DA 3C56A 4I7WA 4NJHA 4LVDA 5D32A 3MYPA 3AJXA 4WUIA 4LS1A 1TRDA 3S9YA 4HN4A 3SGUA 2ABBA 4DXVA 3OVQA 3VNDA 4Z1AA 4FNQA 1R47A 2WSQA 2ZCGA 4JS3A 3T4CA 1O95A 4MVAA 3FEMA 2JGQA 4N6FA 3PVFA 4K8HA 4O12A 1YDOA 4X22A 3MHFA 2FB3A 3BLFA 4G1KA 5CZSA 2RDWA 4O16A 3E9AA 4RZ6A 3HGSA 4YMZA 3DBPA 2BSLA 2NV1A 2YGYA 3P5YA 1H7RA 1FQ0A 3VI2A 5FF7A 1P4CA 3P84A 3KVKA 5BW6A 4JYDA 2FPTA 3I65A 1GT8A 1Q6OA 2EPHA 1ADOA 3CWOX 4NNCA 3L21A 5DY3A 4HNNA 2TRSA 3B06A 3NQEA 2Y63A 1YTDA 4QAIA 3HGRA 2VEKA 1IF2A 1AL8A 5D37A 4QNEA 1F2JA 4MKNA 1JUKA 1O4UA 2E5BA 4FIQA 1A53A 1XCFA 5FEPA 1D9EA 1KM0A 3DI1A 1PIIA 1ZENA 4RR4A 3NL5A 5DCEA 3HBLA 2FJKA 5LKYA 3S5OA 3EXTA 2J9YA 3IIXA 1LLWA 3OVPA 1AG1O 4GRSA 5FESA 3H54A 5FEWA 5BMXA 3PR2A 1PCWA 1TYGA 3NQ8A 4O57A
chains in the Genus database with same CATH superfamily
4GLEA 4CCZA 1UYQA 1PZ0A 3BMVA 4IIDA 2DZPA 3GVWA 3VIOA 3QC3A 2C14A 3WEZA 3GNNA 2VKZG 2FQIA 1I2PA 2FVKA 1J12A 4ACZA 1V0LA 2HQAA 2VVNA 3EMCA 4JTFA 3TCEA 3GTHA 1FFQA 4M24A 5I06A 3EZ4A 1XC6A 4JTEA 4CEXC 2VFFA 3CMFA 5TNVA 3S5ZA 5ECVA 3HPFA 1D2KA 1V0NA 1E5JA 2GUBA 1IQ8A 2X2YA 3M4HA 2P3EA 3ARTA 4Z08A 1OC5A 4MG4A 4V27A 3NR0A 3FDKA 1BD0A 4J27A 2QLYA 3LERA 3M41A 9XIAA 4WY0B 4IZGA 1RP9A 1FWFC 5DT7A 2VJXA 1HFBA 1C90A 1TWWA 9XIMA 4OE7A 1YYAA 1CYGA 1E0TA 2XIIA 3K46A 4KFNA 4Q22A 3TTYA 1ONWA 3R89A 2WHLA 1I4NA 4H9UA 4QGCA 3EAUA 5EBUA 2FZNA 2WPGA 2Z2AA 4ZSUA 1FWCC 4AWSA 1FUYA 1GCYA 5K4ZA 1V6UA 4GG9A 3QF0A 5EFFA 3A12A 5L9FA 1N8IA 3BJFA 3IUIA 2V63A 4AD3A 1ADDA 2GVYA 3FEQA 2GOUA 5C9WA 2J27A 1YPFA 2I5IA 4ZQMA 1VFFA 5AVNA 3PBVA 3QMSA 5EL1A 3B8VA 1XIHA 2PDGA 3MI3A 3MMWA 3CXOA 4UB9A 1Z69A 3W6LA 5D38A 1FWSA 3T81A 4EVZA 2YL8A 3P8JA 5A8QA 2PU1A 4XD4A 1EB3A 4WJXA 2V2DA 1OC6A 4O52A 4JFSA 4O0ZA 3ES8A 3UWWA 3OBKA 4NYUA 1MXDA 3PZMA 5CC5A 2OX4A 2WVTA 1YEYA 1UKQA 4AMCA 1KM6A 2OWWA 4CVWA 3N18A 4I5UA 3C61A 4QDMA 5GPRA 4XBJA 3QW3A 2F2KA 2GQ8A 4H8VA 3W7KA 3WLJA 3LSCA 5CG0A 4GNJA 4D6EA 1EP2A 5M5DA 2V0TA 4WDUA 3LA4A 2GDUA 1R5YA 4R9OA 5A69A 2DJXA 2B7NA 3D46A 3TNBA 4HD5A 1AZ2A 1XM3A 3T05A 1Q13A 4GX8A 2FDSA 2PBGA 3KOWA 3ITCA 3LTSA 4MAZA 4MIMA 1CX9A 1DIDA 1LLZA 2WJZA 4L64A 2EBNA 3OVGA 1HKIA 3O6DA 2YBVA 4PSRA 3RCYA 5RUBA 1A3XA 1YBQB 3MDUA 4HYWA 2VRJA 3URAA 3CYJA 4KEUA 5IBXC 1G7VA 4PCPA 4IMFA 4E6MA 1X38A 3QH2A 4MJ2A 3S6TA 2OU4A 2X7WA 2I9UA 3S42A 3U8GA 5ABEA 5LIUX 1B3YA 3L7RA 3WK2A 3B97A 4QJ1A 3KOYA 1EJUC 1KFCA 3L0GA 2ZXAA 3STPA 5I03A 2HMCA 2ZA2A 4UQAA 2GZXA 1LOLA 3ATZA 2CNCA 1VJZA 1ESWA 1TREA 3MUZ1 3K4WA 3CL6A 3N4AA 5I0DA 2ZUWA 4X2PA 4I3GA 1EA9C 1WXZA 2QDGA 1OFBA 4ZZ9A 3S9IA 4ZQPA 3L9CA 1ZRQA 4LRTA 1W1PA 4C6CA 1I8JA 1A3HA 3UXIA 3WJXA 2O9OA 2OXNA 3RDKA 4H6QA 4ZFMA 1P7TA 4CU8A 3GFZA 1I2QA 3UZ5A 2A3EA 4FA3A 3T2QA 2DDXA 3AIRA 5CPSA 2HSAA 1KM2A 1OSEA 1TELA 2PF0A 3LGEA 4M6QA 4Q8MA 2HVMA 5DY2A 4PFMA 3DBNA 4XKYB 4UQBA 1UUQA 3VZZA 1SJBA 4R5EA 2PAJA 3MB9A 3NZPA 1Z48A 3QMRA 4GQGA 5CPTA 1CGXA 4R9XA 3TWAA 3A4WA 1US0A 2DZUA 3BPWA 1FRBA 2FVLA 3CWHA 1AVAA 3VUSA 4FAMA 4KWVA 1ISVA 4LF1A 3SCQA 2BG5A 2NUWA 1EQPA 2ICSA 3IJ9A 3Q58A 4L4MA 5BXPA 1KFWA 2YCEA 2PDXA 1WAWA 3ABZA 4S3BA 5KZMA 1F3XA 1MZHA 1S3HA 3ABQA 4MUZA 5XINA 2Y7FA 3GK0A 3EMZA 3R58A 4WOQA 5IM51 4C6NA 1UP3A 4FO4A 3B0YA 1HNYA 1QPKA 4Q8TA 3H2CA 2ONEA 4C6BA 4HPHA 3IIVA 3TE9A 4KWUA 6XIAA 1MUCA 4C6IA 2PLKA 2FZBA 5BOOA 3TTSA 1QTWA 4Q4SA 2QV5A 5FJPA 2VZUA 3NM3A 2V67A 2HBVA 4I8DA 4QSFA 2IKJA 4UXDA 1LUCA 5A1AA 3BJTA 3XINA 2ZX9A 3L2LA 1F4HA 3JW7A 3MPGA 4C65A 3G3DA 4C6JA 1UZ4A 2WPBA 4DWDA 3W1PA 1XIMA 3LNMA 1K77A 1LQAA 3TAOA 3WL0A 1BYCA 3PBYA 4W8AA 3HG5A 3GHSA 2G96A 2YYTA 4YU1A 1UD4A 1OVDA 2EO7A 4P7OA 4V1XA 2ZC1A 4W7VA 4AIBA 4A35A 2PSNA 1MVYA 5CBJA 1TCDA 4O8AA 5C71A 4LUSB 3GDLA 2WMKA 1OCNA 2XZ9A 3N15A 1CCWB 4X63A 3TYBA 4LBUA 1GZ1A 1MNSA 1W3LA 3WFAA 2UZ9A 5FF4A 3UA4A 1V08A 3L5AA 3LHTA 2YSWA 4AD1A 3YPIA 1QWKA 2INEA 2YPIA 1RBLA 2ZUUA 3O6CA 1R3WA 2OEJA 3G1RA 2QGHA 3TC3A 3BMXA 4I7UA 1OK6A 2VRQA 1TV8A 1XICA 4ZQCA 3EPMA 3UT0A 3AIUA 2A3HA 4A8RA 3WN6A 1K7XA 1DORA 1JVNA 4MAVA 4F2UA 2XIJA 5AYZA 4YJ5A 2EGZA 3UJEA 3MSYA 1BTCA 3H2EA 1I60A 4WGXA 2CZDA 1HVXA 4ATWA 3KTCA 2ZIDA 4TX9A 2L5HA 5HMDA 1JPDX 2D0HA 4GVHA 5CZKA 3EA2A 3MUY1 4XWUA 1M7PA 1R86A 1Q65A 2CERA 3PB2A 1QXLA 1YTEA 3USBA 1K70A 1M65A 2A3CA 4EWND 2JBMA 3P5ZA 5D30A 1DJIA 1MSSA 5K7JA 1OHLA 4JX4A 4OVXA 4UTHA 2CPUA 4O1FA 4HMDA 2HVNA 3CS2A 2GDVA 2AQOA 2C19A 2QEZA 3KBJA 4TU1A 4J28A 3H4WA 4FEZA 4QG8A 3DFNA 3B8WA 2ANUA 1BKHA 3BV7A 3KBSA 4Y9MA 3FY1A 3NYDA 3UJSA 2PRMA 1PUDA 1KCXA 3EYPA 4IPJA 1DQXA 4X60A 3RX4A 3RFAA 1LBLA 1LP6A 1GHRA 5LZLA 1ZL1A 1VBHA 4OU1A 4PH6A 1EFZA 4CNUA 3AUOA 4E4PA 4NHVA 3SAZA 3TQ0A 3WF1A 4GOAA 3SUUA 2OOGA 2Z2BA 3DFSA 2NVCA 2VRKA 1UP2A 4S38A 2PMQA 3S46A 1DWAM 2VEPA 1WDDA 2CZ5A 3W81A 5D2XA 3WQFA 4GINA 1SR9A 4PCTA 2YIHA 4HJWA 1TRIA 4NAEB 2Z4GA 4INFA 2YFOA 4QHRA 3K8KA 4DM1A 3SRDA 2ESCA 4HQVA 4G7EB 3OOQA 2RDTA 5REQB 1UBPC 2BBFA 2TMDA 1Z3NA 2BV9A 1RJQA 4KFOA 9RUBA 2OPJA 3FCPA 1OT1A 3CV6A 4LS0A 3DFHA 1VKFA 5CCZA 3CEUA 4P2VA 1DXEA 3EWWA 1XRTA 4EK7A 5CXPA 3KOXA 4GYPA 3BAIA 1YNYA 5HINA 2YKKA 4PTNA 4RPPA 3CV2A 3KRZA 3VDAA 3M0LA 1WBHA 3AHXA 3BARA 3AC0A 5LYRA 3W2UA 2ACQA 3A13A 3MA8A 3AU6A 3UGVA 4PC8A 4Y9OA 4I6VA 4RV8A 1IWBA 3PBWA 2HXUA 4S1FA 3UR5A 2V69A 1ZP3A 3OLEA 3B03A 3VVGA 4ERAA 2BY1A 1Q7ZA 4PMRA 2PDBA 1E4LA 1J0IA 3S2MA 2XH0A 3HFTA 3P60A 5FJOA 4JDYA 4IUOA 3KEHA 3GSMA 1H49A 1TWZA 4MNKA 5C2CA 2YA0A 5LA0A 2JQXA 3PTKA 4D1JA 2E77A 1T0OA 3LCIA 2BFGA 4AEEA 3GNPA 2W3ZA 1A5AA 3ABRA 3FXYA 2VCBA 2PTWA 5ABFB 4GMEA 3WD3A 3L5LA 4HJFA 5AZ1A 2Q71A 5FACA 1A80A 1BSLA 1UA7A 4N7QA 3LHZA 4PRWA 2FZ9A 3HQ1A 3KTSA 3ME3A 1OFOA 4WGHA 2NQJA 2BOGX 1DL3A 4FLOA 3F2DA 1WKDA 5I3JA 3VFCA 4LUTB 1I9CB 4PA8A 4AFYA 3CUJA 1VLWA 3CJPA 2BXZA 1KRMA 2PP1A 4GI9A 3ENLA 2ABAA 4O4WA 1C93A 1JRBA 4XISA 3NSNA 1G6CA 1IEQA 4PCSA 1I2NA 3RRXA 3W76A 4LY4A 2AKZA 1MQQA 3W88A 1V77A 3PZTA 3FHQA 1WYIA 3F4CA 2X1RA 2QCMA 1VENA 2YCIX 1LL7A 4MF4A 1TTIA 2FGZA 2NVDA 1GPFA 3SADA 2QJMA 3FYPA 2J7DA 1A0DA 3Q65A 1TTPA 3AHTA 1E0XA 3W24A 5FF0A 1O68A 4M1RA 3LV6A 1GJUA 2JIEA 4OHQA 3I4EA 5FIPA 4E8DA 2R14A 3HPZA 3WQ4A 1ONEA 5E9AA 3TXVA 1DIEA 1XLCA 1KNWA 5BOEA 1KBBA 2W9MA 4EAMA 1OD8A 1XLDA 1TB3A 1XGDA 4B3KA 2PGEA 4C1NB 3EOEA 5HDRA 3E0IA 2WMIA 1XKYA 5M3WA 1Q4NX 2UV8G 1G7UA 1C7SA 3M0VA 2V3DA 2FFIA 3VD5A 5FJRA 3LUTA 3QGAC 2VFGA 4HYVA 3H12A 4ML4A 3T0CA 3UF9A 4DBUA 2TYSA 1JYNA 1P48A 1DQUA 2OQYA 4V2XA 4QX4A 7XIMA 3MV11 3TYEA 3W7IA 2QQ6A 4C7GA 4FB7A 4O19A 5C9ZA 2NXGA 2SFPA 3BLLA 3NTYA 2G3NA 4EXBA 3UG8A 3BANA 4L9YA 2D24A 4JFWA 4IQEA 4O0QA 1LORA 4JD4A 4OWGA 2CESA 4HPXA 3VDCA 1BSIA 1FXPA 1F73A 3MUIA 1K6WA 5AHNA 1WOBA 4PMJA 1HUVA 4IJBA 4HCLA 4HYRA 1YNQA 3W38A 3ITGA 1OK4A 2YB1A 4IGHA 3TN3A 4HA0A 3NURA 1DHPA 1AL7A 1KR0A 1IXPA 4DHGA 2GPTA 2XM1A 4MLRA 3RILA 2Y2WA 4B15A 3U5YA 1GW9A 3W25A 1T6MA 4GJIA 2QUMA 1K4HA 1UH3A 1PTGA 1FP8A 3GX9A 2WKLA 1JFHA 2BTMA 3EX4A 3W70A 4M81A 1E6PA 1RJRA 1V6VA 1JCTA 1K8YA 3W1QA 1E9YB 4IPIA 3QKZA 1J79A 1NF7A 3TC7A 5T9BG 1EGZA 4E2DA 3AMGA 3AALA 4I9TA 1WO2A 1EDGA 3LGGA 1XIBA 1UASA 3IEBA 1TTQA 2GWNA 1SJAA 3W7LA 3PFRA 3ITTA 1TO3A 4NUWA 1P43A 2XDFA 4O15A 4S3KA 4KCTA 2ZICA 4NJJA 1PE1A 2VCAA 4MZ8A 3GVQA 4HMEA 3C2YA 4FHAA 4Z2KA 5D2VA 5LSMA 2ATMA 3ZT5A 2VFHA 3C0QA 2QCDB 4PZVA 1TZZA 5K9XA 1EP3A 2X42A 4ORIA 4YTUA 1W9BM 1F5ZA 3VGGA 5E1QA 3CLMA 4DF0A 3NQFA 1AMKA 5G1MA 1F3WA 3M7SA 2DJLA 3MSDA 4KF1A 4CN6A 1W32A 3ZS4A 3R4IA 1Q6CA 3G6MA 3W7OA 3UVAA 3PWIA 2NWRA 3NVTA 4UQDA 2GUUA 3W6YA 2O92A 4HOXA 2BNJA 5DT5A 3BAXA 3HOJA 1EC8A 2ODOA 4O8RA 5C2GA 4CQ8A 4H19A 1CGYA 2NXIA 3W1UA 1UKTA 4LUIA 1P1MA 4JTHA 2IMRA 1F8IA 4E5TA 3KCJA 4XZIA 3NXFA 2I16A 1TMHA 1H0GA 4QSHA 3QYQA 2ZBTA 1VD6A 4U10A 5FCZA 4TMCA 4RW5A 1VEMA 5CLTA 1QOQA 2WMHA 3BV4A 3TW6A 4H9TA 3NCOA 3W2MA 1IWPA 3ZWSA 2ZADA 1ZZMA 1V4YA 5D8ZA 5JQ9A 3UNTA 1JQVA 1LWHA 5F1UA 4DO6A 1UUMA 4IIFA 1OIMA 4FR6A 3GVGA 1QW8A 2YR1A 4QROA 2UY2A 4AUBA 4ACYA 2X1UA 2CLOA 1JI2A 3AZRA 1MDRA 4IQDA 3TMQA 1KC7A 1MXSA 5MF5A 1DEDA 4JIEA 3IJ8A 4KEMA 3ANYA 2YBTA 3VM7A 2IPFA 1GVQA 1S5TA 3B4UA 2YBUA 4UTTA 1X1NA 4Y9NA 3VCCA 4PUKA 2B7QA 3G5EA 2B0MA 1FBAA 2WVSA 2WMJA 1KLZA 2DQXA 1X1OA 1UCWA 1GQKA 5D03A 1PV8A 1V7YA 3I4KA 2J74A 5U4NA 3R2GA 1E6XM 3WBAA 3GLCA 1OYBA 2OYMA 3PG9A 3V16A 4PRRA 1QO2A 4HNOA 3M0KA 3T6CA 1OFDA 1XLIA 3CAWA 1E0UA 4NY2A 4B16A 2GGGA 1EJWC 1VAHA 3MP3A 4IG2B 2R91A 4Y9AA 3ITLA 1TPB1 2FFCA 3P14A 3GNXA 4MKVA 1SFTA 4HMCA 4UMAA 4JIQA 4L1WA 4BS0A 3UG3A 1LT7A 3HPXA 1WDQA 3PB0A 3LLFA 2FH6A 4AISA 1A0CA 1K8XA 3MBFA 2ALRA 2WHJA 3SN1A 5BZAA 2ISSA 3N1AA 4ZOBA 2VR5A 3RUBL 1JFXA 4JX5A 5EYWA 3AYSA 4OBSA 3KWXA 5I79A 5BXRA 2AOSA 4TTUA 3CZ8A 5D8WA 4WK9A 4DXKA 2P1FA 4LV4A 4A3UA 3CHDA 4N9DA 2RFGA 3GHRA 3KHDA 1OYAA 5D2WA 3W1RA 3UZXA 3GG0A 3QOMA 3ZOAA 3WFZA 4BCEA 3FJ6A 4CNNA 1CZ1A 2E1WA 3H23A 2ZXQA 4DBEA 1ZJHA 4PMOA 4QLKA 5HULA 4E2OA 2WK2A 2QCGA 1K1DA 1W17A 4NL1A 9CGTA 4XO7A 2BDQA 2RJHA 2ZRUA 3FA3A 4WF7A 4FI4A 4O4VA 4L65A 4HT3A 1H7NA 1F76A 2ZZ5A 2C1GA 4BF9A 4U4MA 3BICA 7REQB 3AFBA 1GVRA 3ITXA 1GJWA 3EWDA 4IIHA 5FJUA 3LLXA 5LGZA 3AS0A 3OO2A 4PUNA 5AYIA 4RL3A 3CTLA 1CT5A 1HJVA 1THFD 2A2IA 5D4YA 3U5UA 4S3FA 1F74A 4GBDA 3IIOA 5KETA 4RE0A 1LZOA 3JUGA 3DECA 4FK9A 3UESA 2BXYA 5A95A 3CHFA 1OX4B 1J01A 1QNVA 3WDIA 1XSJA 4HNVA 3QTPA 4K7VA 5JVLA 3N73A 4H83A 2EG7A 1RCQA 4LANA 4ZXLA 1OQFA 3VZXA 3BG5A 3TW9A 4LWWA 1G4SA 7TIMA 2VD9A 3LPFA 1CGTA 4Q4OA 4NT0A 2XFYA 1F6PA 1XUZA 1K9DA 3VGDA 1E4MM 3QC0A 1H60A 1F07A 1BQCA 1TSIA 3UJFA 2VR4A 1DWIM 2RGLA 2HXTA 2DY3A 3R11A 4AYSA 4HU3A 2PUZA 3ZMRA 1BYAA 3CZLA 4JQ3A 5C70A 1HG3A 1W8GA 3ZR5A 1CB7B 2YW3A 3AI0A 5A3HA 3CHVA 2G3IA 1QHPA 2R8WA 3CQKA 3VK5A 4CNSA 2V2HA 4JX6A 5G5IA 5F2LA 3KCOA 5HXMA 3KOZA 3E3HA 2DZTA 2QCNA 3KL3A 2VUYA 4NP7A 4FZIA 4GJJA 1M7XA 1OG0A 5G4WA 3EWCA 4S2CA 4ERIA 4M6PA 1L8NA 1OFAA 3ITOA 3GXIA 5HAOA 1G9HA 1CXKA 2V68A 4I7VA 1JD7A 4AMAA 3UR8A 3WH8A 3MWCA 2PLCA 5EA9A 3ES7A 1YKWA 3DHDA 4P7NA 1AH0A 2PP0A 4WDTA 4RPQA 4PUJA 4R7WA 1C7TA 5FAGA 1W5NA 3UXLA 3D5HA 3QHOA 2QF8A 4C91A 2VGFA 1XH1A 1HZYA 1KXHA 3GXTA 4M6UA 4M8UA 1ZY9A 3CQIA 1KXVA 3MMDA 3Q94A 1JF6A 3PG8A 3NEVA 7ENLA 2Z00A 1FTXA 3PY2A 1WPCA 4MZ1A 4C90A 3SZ8A 4GY7A 4WDXA 1YIXA 1T96A 1TVNA 3IK4A 4C1LA 1ZLPA 3ZIZA 2EAWA 1S2VA 1RALA 1JDFA 5K9DA 5AFDA 1LTDA 1R8LA 3BGAA 4BQ3A 3M64A 5KZDA 1VIZA 2XISA 4IXHA 3CUXA 5JBDA 3NM1A 3NQDA 4ASTA 1LL6A 1TJ1A 2ZYFA 2NW0A 2QVHA 1SFLA 4WSHA 5IOBA 1GOWA 4LQ1A 3QZ6A 3PK7A 1EZ2A 1VS1A 4UR8A 2OR2A 1FVPA 4LGXA 4A6GA 4JNYA 4HNLA 4GI4A 2E9BA 1TWDA 3WNKA 4Q4PA 1CECA 1L6WA 4FX8A 3M0IA 1UD3A 2J24A 3K13A 3LLDA 2Q8ZA 3W1TA 3DHPA 5CSYA 2VELA 4W8LA 3L4YA 1X7FA 1E4NA 3MKCA 4Q8VA 1NVMA 3R7MA 1CLXA 1IR1A 2XINA 2CWNA 4RE2A 1UW9A 3PWAA 2V6AA 1Y7VA 4LALA 2PB1A 1JZ8A 5G4HC 2EPOA 1UR0A 2NLIA 1L0PA 1BXCA 5A6TC 4UTIA 2R1KA 1LBMA 4B90A 1D3GA 1SU5A 3WJZA 4GO8A 4XV0A 1MO0A 2QIWA 3Q4DA 1LLOA 4KQNA 4W88A 5D09A 4AZ5A 4CEUC 1EO5A 2BGSA 3AICA 2OKTA 1IIHA 3CL7A 3N6QA 1RQEA 2ZOXA 1W56A 1B3OA 4YXGA 1ODUA 2J62A 1E40A 4UFIA 2VYOA 1JCNA 3W85A 3UQNA 2IPWA 3D0CA 3A9IA 3BAJA 3IK2A 1W5MA 4I7WA 1TFVA 2IUZA 5BXTA 1KRBC 4H41A 1XR2A 2WXDM 3S9YA 3NO3A 3SGUA 2HK1A 3R1ZA 1R47A 2QT3A 3MS8A 3VDHA 5JBEA 5CAHA 2YCJA 1O95A 3POHA 3PN8A 4FLQA 5E0CA 4IP5A 2MANA 2XWEA 4N6FA 3PVFA 4K8HA 4CD6A 4O12A 4X22A 3MHFA 2FB3A 3ERPA 5IHSA 4R88A 2RDWA 2FGBA 3POCA 5B80A 4RZ6A 3JU2A 3FV9A 4QS5A 1BXNA 4JCLA 1WDRA 3SCUA 4LCQA 2P50A 3OBEA 4LYKA 1P4CA 3P84A 1GQIA 1JIBA 4FOUA 2IPGA 1AJ0A 1GT8A 1Q6OA 1UC4A 2TRSA 3S2LA 2O55A 4XSMA 3AXHA 4QAIA 3HGRA 3FVMA 3H70A 3VXGA 4YIWA 2VEKA 3CV1A 3IUHA 4MKNA 1O4UA 3UPMA 1C3FA 3AISA 7TAAA 1KM0A 3A9BA 4WDWA 4KIRA 1ZENA 1RCXB 2FJKA 2GK1A 5LKYA 3ZZ1A 8A3HA 3URQA 5FESA 2X41A 3II1A 4O57A 3SSZA 1M01A 3QPYA 3N12A 2G37A 6TAAA 2I56A 2ASHA 2ZZ4A 3MI6A 1UPMB 2WHMA 4ICMA 3OZPA 1ONXA 1YXDA 4HP5A 2OSYA 4Q4KA 1ZTVA 2ZX8A 4H1ZA 3RO8A 5C2XA 1TV4A 1XDMA 1NWUA 2PS2A 4G56A 1PL9A 3IACA 1QAPA 1E6SM 4DNHA 3PF3A 2D22A 3IAPA 3N2TA 3B8IA 3ALGA 2DUAA 3FAXA 3PP7A 2OSXA 2QR6A 4G9PA 3DG6A 3GC5A 4N2YA 2GSJA 2QAFA 2OWCA 3GIPA 3TMLA 4B3ZA 3ABSA 2IXUA 1VBJA 3FIGA 5C7VA 4AH7A 1QO5A 3EDDA 2XVPA 5A6MA 5HQLA 3AMKA 1V51A 5ABTA 4JAWA 1DWFM 3W3OA 2Z24A 1VEOA 3WY1A 2YXOA 3LYEA 1AFSA 1KFKA 1VJSA 1ZB5A 2NWSA 4L6HA 3TA9A 5D05A 3KS5A 4FMVA 3EPNA 1HT6A 3LHVA 2J7CA 3N29A 4PTXA 3SEPA 1FFRA 4GHRA 4FX6M 2IQ0A 1MRAA 4TMBA 2WZMA 1NOUA 2Y4SA 4F4RA 2ZZ2A 3PBUA 3SCSA 1YX1A 4HVXA 3ELFA 3UWVA 1CENA 3G18A 2BGQA 2X1TA 2XN1A 3NL2A 3WBWA 4ZR8A 3NL3A 4AD5A 2WVVB 1J96A 3FLUA 1EP1A 2VR2A 3AZTA 3OHMB 2QXWA 2YL5A 4NZ1A 3AHVA 3R10A 4E2BA 2A7RA 3WCZA 3B9EA 3IJQA 2WMFA 5EMJA 4OJYA 3R12A 4QBXA 1B9BA 1XLJA 5EPDA 1VHCA 4LT9A 1A5MC 2CIPA 2A85A 1JF5A 1V3IA 3LRMA 8XIMA 2OZ8A 3WNLA 3N9SA 2E4TA 4UNLA 2YZ5A 4N0RA 3NQVA 1HJSA 1XLMA 1D8CA 4ML9A 4DLMA 4MJMA 1ZS2A 5LHEA 3WO8A 3SCTA 1XYFA 4UCGA 1QUMA 2Z27A 3E49A 4DELA 2I5QA 1XGZA 2PDCA 3FVDA 3RXZA 2AGTA 3VMOA 1ZALA 5BRQA 4ENLA 3S8HA 2Y89A 3QLDA 3W1AA 1WCGA 3GIYA 3E74A 3EX2A 1NFPA 3NPUA 4Z1YA 1WB0A 3CH0A 4AWUA 1OADA 4UQEA 5BU6A 1HKKA 1R2SA 2NUYA 2R1LA 4KBXA 4NAFA 4JFUA 3KS6A 3RPTA 1XYAA 4MZYA 3LBCA 1VYPX 4IP7A 4PMYA 1QFEA 4JFTA 3OEXA 4JKKA 2QCLA 3PM6A 4ZXOA 3DYOA 3NSXA 5HWMA 2D2JA 1KM1A 4CQ9A 4UFKA 2ZA1A 3W72A 1OCJA 5CH9A 4JZ5A 4PR4A 3GTXA 3VD7A 2O7SA 4EPBC 4L4PA 3EXSA 3IGHX 4HCDA 2WHKA 4XAFA 1NIUA 1FWJC 1VQTA 3I10A 4MDPA 4DNMA 2HTMA 4UTWC 2WBGA 3IUDA 3GBDA 2ZQ0A 2CZFA 3DKJA 3E2VA 1QK2A 3TFCA 1DTUA 4ICCX 3DGBA 4H9ZA 3WYZA 1F05A 1K7FA 2VGIA 4AZHA 3B8DA 4M80A 4JY9A 2WZHA 1P7TB 1AJ2A 1J0KA 3DFTA 3PZVA 1M53A 3G8EA 5DMMA 4O54A 1I1WA 2CEQA 3GNOA 1U22A 1N2VA 4J3XA 4PMVA 4FX7A 2OFJA 1PEZA 1KCKA 1HQTA 4GVFA 4IFKA 1FCUA 3MJYA 1UB3A 2KAUC 4JYEA 2FKPA 2V8ZA 4YNGA 5D9PA 4KRZA 4GUGA 2B7OA 2YDAA 3M47A 1JEZA 5T26A 4NSBA 1WZAA 4V15A 2QW5A 4AZ6A 4RDZA 4PTMA 2I9EA 2POZA 2NT1A 2QJHA 1FHVA 2YLAA 2PD5A 4U5KA 3G1DA 4QG9A 1POJA 2XSAA 4F3HA 3M0HA 4GA8A 5C9UA 3P74A 3PZIA 5DCBA 4AHPA 3KLKA 4AF0B 4BEUA 4E8CA 4GYFA 2YXXA 4K37A 1KM3A 1KFEA 4PMXA 1HO4A 1XDLA 2F2HA 3E96A 3TWBA 3U48A 2BVYA 3THCA 4IL2A 2D3NA 1LQ0A 3JVAA 4K68A 4RXGA 1Y8BA 1VCVA 3AS3A 5HMEA 4DJDC 2WOQA 3KL0A 1M04A 3UWUA 4LAZA 2HROA 1ZFJA 2E1DA 1UMLA 1WX0A 4KEVA 4XVEA 4J3WA 2DGAA 5CBBA 2FH8A 3O63A 1EIXA 3GYEA 1ECEA 4GE8A 4AZGA 4RZ5A 2RAGA 3BO9A 4REQA 4X0NA 2YDSA 1AQMA 3S83A 4C60A 1I75A 3A3WA 5LNUA 1W5OA 3H2OA 4Y9PA 3DG7A 3BSMA 3AHYA 3DFYA 2J8FA 3GKFA 4F40A 2OO0A 1Q6DA 4M56A 3SURA 1TVLA 2V5DA 3NSMA 4LPCA 3QW4B 3M5XA 1EQCA 8CGTA 3TP4A 1IT0A 2REQB 4AQLA 4CU7A 3LQLA 3M7WA 3JR2A 4YVVA 3JRKA 2GWGA 2YZRA 1EH9A 3INPA 3CZKA 1E51A 5G1TA 4KCUA 1OYCA 1K9EA 3L2MA 1YHTA 4UBPC 4X9YA 2OOFA 1B4EA 1M7JA 1XYCA 1S3TC 3DG3A 1V03A 2OMAA 5AOUA 4C7FA 1XQLA 4KGLA 1EPVA 4BKNA 4J2MA 5J04A 1AH3A 1XXXA 3UPWA 2EJ1A 1XGEA 4WJ8A 4MMWA 2O9PA 3P93A 3W9ZA 4DUVA 4CD7A 3IJIA 5BRPA 4BR1A 3A21A 2VZVA 4Y7EA 5MKGB 3G1VA 4V1YA 3SUWA 3P81A 4TVDA 2RKXA 4L4LA 2P10A 3F5KA 2UY3A 1JDDA 4JTGA 3VNYA 3ALFA 1QI0A 3A4JA 1JPHA 1W5QA 1PZ3A 2QUTA 3KTXA 3QMTA 3WX7A 3T78A 2VOTA 4M7TA 2J47A 2Z1XA 2P8BA 4BF5A 4J5NA 3RR1A 4LH8A 1B3XA 2YLLA 5T91A 2C13A 3DERA 2VENA 4NZ5A 3IV8A 2CLPA 3LMYA 1TWSA 3CLWA 3IANA 4CQDA 4S3AA 3ZT7A 3KRSA 4J3VA 4DAIA 1MZRA 2DVUA 2C6QA 5HJXA 3NZ1A 3TYAA 1PYMA 3TK7A 3URBA 4K3ZA 4WZHA 3WLOA 2GQ9A 4CQCA 4L9ZA 3Q37A 4WSJA 2DH3A 1SZFA 1CLKA 1HJWA 1ICQA 3AXKA 2XM2A 3R0KA 1QHZA 3UXDA 2R6OA 3BTNA 5LA1A 2ZX7A 3L4VA 4OQVA 2VD8A 3VGFA 3GFXA 2VFDA 1SW0A 4HMNA 4HGXA 3WQCA 2WM0A 3GR8A 3VX1A 4WCJA 3VM5A 2X30A 3OZMA 3GDBA 5AHIA 4JYFA 3GNDA 4DRSA 1ME8A 2NUXA 2DEPA 3MYOA 3V18A 1YPIA 2Y7GA 3G0SA 1S2UA 3U7BA 2D3LA 3R13A 4DUWA 5EBAA 4ATLA 1E3XA 2F6KA 2V3EA 2YFNA 4BFAA 3RF9A 2J75A 4B9ZA 4XX6A 3U0HA 4HHHA 3VILA 3FS2A 4JEJA 2VDGA 4GUFA 4DLFA 3DXIA 4R27A 2X40A 3J7HA 1C91A 1R3TA 3OODA 1OABA 4H8HA 3VZYA 3ZJ7A 3VIHA 1XD0A 4RZBA 4FOJA 3WIJA 1JPMA 4HK5A 4AVNA 2XZ7A 3LB0A 1BWVA 3E1F1 1DJGA 4XG1A 2JE8A 2VC5A 2VT0A 4GQBA 4WY0A 5KTLA 3UGRA 4K38A 4DAFA 3C4UA 4GQ0A 3HQPA 4IGMA 4PFHA 4LAUA 3JZEA 3RU8X 3BURA 2ZUVA 5HUOA 5D04C 4RE4A 3GC4A 4IWWA 3ZJ6A 3N6HA 4MLJA 1H5YA 3VGBA 2XU2A 1WUFA 2VEGA 4NRRA 4X3ZA 4B5XA 1H50A 2V5LA 3SIZA 2HNHA 4ZSTA 3W1MA 1M68A 3TFXA 1YPXA 1ITXA 4GJ1A 4IX2A 2VQTA 4WVXA 1QJWA 3HU7A 1WZLA 3ARZA 1H3GA 3LXAA 2E7FA 2PDWA 4GVGA 4LV9A 2RHGA 3TX9A 4IISA 4AU0A 1UQZA 1Z8AA 3IGUA 1MEIA 3VDBA 3N25A 2HJPA 4R7JA 5LIYX 1JPKA 3AXIA 3OB8A 4OOUA 3G8RA 4MKSA 2NX9A 1ISYA 1TPFA 1LDCA 4NXKA 1GONA 4QEHA 1ZQ5A 1XC4A 3SGZA 1OB0A 1QNRA 3P7YA 3ZSTA 1JZ3A 2DZWA 4ES4A 4G7FA 4WJEA 2R94A 1TA3B 3THQA 4N9BA 5GVJA 4NZFA 1U1JA 5C9XA 1R9XA 4U33A 1O5XA 3QEZA 1P0EA 2E68A 5AKQA 5XIAA 4WXZA 4YL2A 3NIYA 3GG1A 1U5JA 4DXXA 1O6IA 3CZJA 1KKOA 2PWGA 3LPGA 1YQ2A 2ZRXA 3OBAA 4GX9A 4AWEA 2DUXA 5CGQA 1EO7A 1YLVA 1B3VA 1E9LA 3CV7A 4US5D 4Z0JA 1H7PA 3FN9A 3K1GA 3FJNA 2ZX5A 3SBFA 2I57A 1FWGC 4R85A 1EJ7L 1VPXA 2NQ9A 1ME7A 1PKYA 3W7EA 1RA0A 3ARXA 2W0UA 4WOZA 1AW5A 4M3PA 1T8XA 1NAL1 3W73A 2E8ZA 5FOOA 3PUOA 5DEZA 4Y6GA 1JYXA 1KD0A 1IHIA 4JHOA 3OA5A 4OIFA 4MB3A 5IBXA 1LOQA 4LTSA 4ZCWA 4H6RA 2CFFA 1T7LA 1YBQA 2Q3RA 4Z1DA 2CBUA 1JJKA 3GB6A 3WD0A 4LW7A 3LBMA 1LWIA 4FXRA 5HNRA 1J0HA 4GZIA 4FP1A 1QT1A 3KBWA 4POCA 2JFEX 3H22A 1V6WA 3S2NA 4PCNA 4YTRA 2V2CA 2PLMA 4MM1A 2VX5A 3T4WA 5E6ZA 2WQPA 4HSHA 3W6MA 2EEXA 4M6VA 2Y6ZA 4LAOA 3VCRA 1PYFA 5CZTA 3NO1A 1OIFA 3CT2A 3WQWA 3N19B 3WQDA 3EOUA 3SCWA 2VZSA 3WBYA 2J9XA 2QJJA 3W37A 3RPMA 4GUIA 4BEQA 3AIWA 3EPOA 3O06A 4LAMA 5T9CE 2RGMA 4US5A 4LFYA 4OUIA 1KV5A 1SO5A 1KRAC 2YL6A 3PZOA 1R3VA 1TJ0A 1QBBA 4GH1A 2X0SA 4CQAA 3VDGA 3HA1A 1A49A 4KRTA 4BQ2A 4WEVX 1G4EA 1RVGA 2R9RA 3K5XA 2FPVA 5B7YA 1EWDA 3C86A 2POTA 4E3TA 2DIKA 2GDQA 3KZSA 2BODX 3STEA 1J8VA 5AYXA 4MGGA 3BAYA 1FWTA 1UJQA 4NRSA 5H1WA 3L2IA 3UWYA 5HJYA 1P0NA 4X0VA 3T44A 3B0UX 5GJNA 2HZGA 4XKYA 3B4YA 5D9OA 4GABA 4CLMA 5I24A 1ZGDA 3TROA 2P3ZA 5D9NA 3RJXA 2PF8A 5TBOA 4HOZA 1Q63A 1EL3A 5C55A 3WQOA 1W9UA 4HZMA 3SDOA 2QYGA 4B9YA 4D6DA 5D33A 3CZEA 1BYDA 1VP5A 1K3UA 4LVAA 4QDWA 1PVNA 1JCXA 3WNNA 2HE8A 2J9ZA 4Q8OA 2BMBA 5G2WA 3F5LA 2YB4A 2O9RA 1CGVA 4HCHA 3K2GA 1S5WA 1FWAC 5E93A 4RDWA 3ATYA 3CHCA 5I02A 1C9WA 2IPJA 1KFLA 4TOQA 1I0DA 3FKRA 4E8GA 2E6AA 3UG4A 1S2TA 3UPBA 5AC8A 2XYLA 1DJYA 3PWGA 1SW3A 4L61A 1IEWA 4F0LA 3P0WA 3EEZA 3STFA 3RHGA 3CAQA 1TV2A 4IJCA 4F2BA 4GGBA 4HTBA 1EIBA 2J8GA 3L4WA 2J77A 1ZBCA 1JUEA 5E6YA 1BRLB 4GIAA 4JN8A 4HPJA 2ON3A 2XIMA 3SCNA 4PUMA 2FZDA 2Y24A 4L5ZA 4IOTA 5CZ0A 1V7AA 3T8LA 2GJRA 2TAAA 2Y7EA 4Q4QA 1PTAA 4UWMA 5I3HA 3EDFA 4QG6A 4OV9A 4AIEA 5BXSA 1CW2A 2ISDA 3PJWA 1WKYA 3G24A 3OJGA 3RN6A 2D2OA 3RR4A 3W1XA 3TIMA 3HMCA 1HKJA 4LUSA 4Y8FA 4JHZA 1R6WA 4XKMA 3MKVA 2WJFA 2PWUA 3SJ3A 2HS6A 4H6KA 3T0AA 1P5BA 3DH7A 3BSGA 4XZMX 3IVSA 2E67A 3SRFA 4NNBA 3ARSA 1J0YA 2QDDA 3N9RA 1DXIA 4JKMA 2OKOA 4LC8A 5AHFA 3IIZA 4XAZA 1B3ZA 1CXLA 1ZCOA 3CUHA 1TPH1 1FY6A 3C2EA 3W26A 4M7SA 3S9ZA 2FPYA 4IJRA 1LCOA 4C6QA 2GLKA 2NQHA 4H2HA 3BZGA 2P8CA 2XH2A 2X09A 4PL1A 2F6XA 2OZTA 2D0FA 2FDMA 4JTSA 4LOCA 2DW6A 1A0EA 3N2BA 1NFBA 1JCMP 1KBLA 3TLQA 2X8RA 3TA6A 4AXNA 1SZGA 3RK8A 1XH2A 3TONA 2XTKA 4X61A 3RLHA 3V5OA 3VYLA 3TOYA 4R34A 5TQLA 1NWSA 2GQ3A 3R8HA 4WD0A 1QHOA 2CC0A 4OKDA 2RJGA 2CZVA 3N9KA 4RNIA 1S2WA 1ZAHA 1T8QA 5G2IA 1OFEA 3QQ0A 3MSRA 3IVUA 2PRHA 1QPQA 2YL9A 4W86A 2NLYA 2Y8UA 3A22A 2V3FA 3SQSA 3BZJA 3CMJA 3O6AA 4YHGA 1NWRA 2YW4A 2F9RA 3BW4A 3WELA 2PDLA 1B4KA 1Z42A 2CBIA 4EPDC 3P67A 3CPUA 1AK5A 2ZWZA 1DPMA 1B3WA 4W84A 1LBFA 4GXMA 4K2SA 3UA3A 3COTA 5AY7A 2KZHA 3NG3A 1TR9A 5PTDA 4D6JA 4C6KA 1UWTA 2PLJA 2AL1A 1EJSC 4IMGA 3V5FA 1T40A 3PTMA 3VD3A 1KCLA 2PWEA 3VFLA 3S0CA 1GOXA 1FWEC 3EWXA 1R0MA 2ZWYA 3C52A 3SY5A 1MNZA 3GC2A 4AHQA 4UTKA 2H9AB 4NAEA 1QR7A 2WNZA 1K4GA 1JCLA 2G3MA 1OY0A 4WKHA 1J2BA 1Q66A 2PE4A 1XBXA 4RKAA 4G7EA 3GKAA 5REQA 3AHZA 3VAVA 1L6GA 3WJYA 4W5ZA 3IRSA 3W1LA 4Y90A 4O1CA 1VYRA 4DM2A 4ZVJA 4RK8A 2PDMA 2TODA 3LGDA 1J0JA 2IKHA 5CBIA 1DWJM 2Y62A 4N4QA 3EWYA 3TJXA 5HK4A 1BG9A 3E2RA 1PWLA 2AMGA 2YYUA 3PZQA 4H9VA 2OT0A 1EUNA 1MW2A 1U1UA 3SN0A 1CBGA 8RUCA 1QPRA 3EBVA 1D7KA 1MRQA 1OX5A 4I8YA 4D8AA 4YLWA 2Q8LA 3VCNA 1JCJA 3KL5A 1P0DA 4QJ5B 4XSLA 3AIQA 1LWJA 4JQAA 2D2GA 1QMLA 3JZUA 1KRCC 4ZEPA 5K4XA 1MEWA 2E25A 4OT7A 4HHLA 5ABGA 3QR3A 2C91A 5EFDA 5M2FX 5C5YA 3H2AA 1E6NA 3IVTA 4AZCB 2WSKA 3DFPA 4A22A 1VR6A 1SUXA 5ABFA 3MO7A 5HJLA 2CLHA 3BE7A 1TKKA 1FWDC 3SCVA 3B04A 3V7PA 1OINA 1YDYA 1HKMA 3OW1A 3N3MA 4FR1A 4QCEA 4LUTA 1TZ7A 1XIJA 4Q6JA 4CU6A 1E73M 4O1BA 2CLFA 3W28A 4MB5A 5JU6A 1GOKA 1XKJA 3ZM8A 5FF2A 4QEEA 5I6SA 4GCAA 4NILA 3EX6A 1T41A 2HK0A 2GGIA 1U33A 3FW6A 1W1YA 3O15A 3QQ1A 4P7RA 3BW3A 1S2AA 1UIPA 2H6RA 4GO9A 2V9DA 4HNUA 3APYA 2IW0A 3GS6A 4HU4A 3VE9A 1TJRA 3GHTA 1GQJA 5E0FA 2W79A 4XD5A 4IPPA 5TF0A 1FCQA 4IM4A 1RA5A 3LCWA 1V3KA 1SSDA 3BH4A 4S39A 3N2XA 2DT3A 3MTWA 3DESA 3S6OA 5GNZA 3E5PA 1SO3A 3B9NA 1REQB 3ORWA 4GYJA 3TR2A 3VKBA 2O9TA 3JS3A 3ARWA 3AZSA 4GXPA 2XVLA 4DQWA 2ZVIA 4YTQA 1RLDA 4F48A 1W9VA 4FNUA 4Q6XA 5H8UA 3RCNA 2BHYA 5HWJA 3TLLA 3DI0A 1FH8A 3NDOA 3WQ5A 2WO5A 4C1NA 2VX6A 2GJNA 3UJ2A 3R94A 4Z42C 1RK6A 4W4QA 3TEVA 1F6YA 4JL1A 5DANA 4YPJA 4DWSB 3ANVA 3G1HA 4OZOA 3MZ2A 4ADSA 1X97A 2RDXA 3OQEA 1VFSA 4ICNA 3AIVA 2XVNA 1S5VA 4A05A 5DMLA 1Q2SA 3GXMA 1FOBA 2W6RA 4W9TA 3W7MA 1W1ZA 2PDFA 2ZA3A 4DWSC 1O5KA 2ZTJA 3WNOA 1TPDA 1SGJA 3TSBA 4C6DA 3PPGA 4N6EA 4B5SA 3B0PA 1GKPA 1KBIA 3OQ8A 3WJSA 1PB0A 2Q3OA 3GTIA 1W1A1 5G4EA 1DOSA 3GVRA 2DT1A 3EXRA 5CSSA 3WDJA 1GTEA 1GOMA 3RGTA 2OLAA 2B7PA 3E6EA 3TNOA 3SN4A 1XIEA 1S5MA 5KZEA 2V38A 2CKSA 4EPEC 3NQMA 3LENA 1UR1A 2BOFX 3TOPA 4QLLA 1A5SA 3WK3A 3BCDA 3LI1A 2ZZ1A 5HNUA 5CPOA 3WQ6A 1S38A 3N13A 3KE0A 4QTGA 4JTAA 5IRPA 4QE5A 1ONRA 1RY0A 3GHUA 3LDVA 2Y5EA 4FOKA 3CC1A 4WSKA 2BY3A 2QAPA 1E6ZA 2XN2A 2C71A 2HV5A 2VDIA 1JI1A 1TR1A 3ZYZA 3HM7A 2AL2B 2CYGA 3UU0A 3TAKA 3CNYA 3WKZA 3SR7A 1TQXA 2GVJA 2PGWA 3PBMA 2BY0A 4H9YA 1JYVA 2W67A 1E9ZB 3W4RA 5BYWA 1HL2A 2ZDSA 3S5YA 4CNTA 2BOEX 6ENLA 4BA0A 1OWQA 3EWUA 2YCKX 4MWAB 1H41A 4NX5A 4E4FA 1UZ1A 2WW5A 1OF6A 1J4EA 1WA3A 1H62A 3WD4A 1JAKA 1BKSA 3TJ4A 1M9HA 3U7VA 1LRQA 2OGJA 4MWAC 5DXXA 5A8GA 3ZVHA 2BASA 2QCDA 3AYVA 1HKVA 3BLOA 4LVDA 4KW2A 3R79A 4WUIA 4DO7A 4JTQA 4HN4A 1UD5A 4FNQA 2WSQA 1NDYA 1CLVA 3GIQA 4UR9A 4I6KA 3SCOA 2EPNA 4ZBCA 3S3GA 4JKLA 3WLSA 1G01A 5CZSA 4O16A 3UERA 3H2FA 3GUWA 4UOJA 2NV1A 1H7RA 3IJDA 3VI2A 5FF7A 1Y5WA 3I65A 3GZAA 4NNCA 5DY3A 3EOSA 1PSCA 3NQEA 3WQEA 1YNPA 3S47A 4LCSA 1L2QA 1VPQA 4TTGA 1D8WA 4B5VA 4AX6A 4AZBA 1XCFA 3LQGA 2XHYA 1XQKA 2C8NA 4NIRA 6REQB 1UKSA 3EXTA 2J9YA 1LLWA 3OVPA 3SGGA 1PCWA 3QPEA 4EXQA 4NX0A 5JMUA 1G94A 3QV6A 2O7QA 4A3RA 2DPEA 3PC0A 3CWNA 4HK7A 3T2OA 3VIKA 2FLIA 5CEWA 1C8YA 1TX2A 3EKGA 2P0OA 1RD5A 3VNZA 1X7IA 4K7YA 3BVJA 5LIKX 4UOZA 3KOFA 3PJUA 3UZZA 2V5JA 4XTIA 3I3DA 1RQBA 4DEFA 4NZCA 5FAJA 2NXHA 2JEPA 2G3FA 4ALDA 4J35A 3HV8A 3BUVA 1NOFA 4M19A 3OG3A 2ZE0A 2JKAA 4B92A 4ZFCA 1FWBC 2ZZ7A 1VFHA 2F8QA 3BC9A 1MW0A 5GJPA 3WDQA 3QOKA 2ATSA 1TTJA 2JKPA 3W7CA 4Q32A 1W3IA 4MFEA 4D2JA 1R7OA 1LG1A 3LM3A 4GKLA 1XX1A 3MC5A 3CQHA 5CPMA 3WLMA 1VRXA 3AMCA 4JTRA 5F2MA 5I07A 1KXQA 2PCQA 4RW3A 5C0QA 4HA3A 2QZRA 1IE7C 1DBTA 4JL2A 3QQWA 4IFRA 3R0DA 3PZGA 4CD5A 1FWWA 3L66A 2GJXB 1AA1B 1RHCA 1FWHC 1XLFA 1V0KA 3SSJA 1XISA 1ML1A 1B31A 3W2JA 2Q01A 1VC4A 4JTTA 3SI9A 4XZLX 1ZPTA 1JDEA 2OQHA 4H8NA 5T8GA 1UOKA 1JDCA 3LTYA 3AIBA 4ZO9A 1VHNA 1V5XA 4M0XA 3VKAA 2QDEA 3AAMA 4EF8A 3WENA 3N3TA 4EKJA 5DBUA 4QDPA 4CN1A 1N7KA 3QKEA 4LUJA 3IWPA 3I7QA 1V02E 4TX6A 1QOXA 1BWLA 4ONVA 3H8AA 2CLLA 4P5UA 1CGWA 1GOQA 4S23A 4O17A 3MHGA 1WBJA 2HVOA 3GRIA 1US2A 3WH9A 1BHGA 1X96A 1R9ZA 3PULA 4IMCA 3IARA 4D8ZA 4JFVA 3KRBA 4JOMA 2QPSA 1HJXA 1OX4A 3QY8A 3VMPA 2EXOA 3NFUA 2MUCA 3F4VA 3LXBA 3GBEA 3OIHA 1GVSA 1OGGA 2J7HA 1XINA 4V28A 3U2EA 3G2GA 3ZWTA 4N9EA 4FXJA 5J8LA 4GPNA 1XWYA 2VURA 6PTDA 1A5LC 5HUPA 3RMEA 3C3NA 1XLGA 2ALDA 3S1GA 4GY0A 3A3XA 3H6OA 1XYMA 1NY1A 1K03A 5ECUA 4J3TA 3ARYA 3VNJA 5LNSA 3ZT6A 4HSOA 3VNIA 3VNLA 4PRTA 1IT7A 3NJ3A 2OODA 1Q2RA 1IXNA 2F84A 1KW1A 5FA5A 4IH3A 3FXGA 1DTNA 4RDVA 4D6CA 4M5PA 1ITQA 2VVSA 3PPCA 2A3LA 3LHWA 4GACA 4F66A 2NSXA 1AH4A 4NQ1A 1ICPA 4P8WA 3N6JA 3VABA 1FWIC 3KP0A 4GKTA 3RPDA 1G4PA 5CC7A 5EY5A 4CD8A 1YXYA 4LEFA 2UWFA 3NGJA 3L23A 1SFJA 4AY7A 4WKFA 1HGWA 2BZNA 4KS0A 3I3BA 2C1HA 2VO5A 1R9YA 2QUNA 3KCLA 3GH5A 3O1NA 5JIPA 4GNKB 1JG9A 4US6A 4IT1A 2WWCA 4PE8A 4RZ4A 3RYSA 2C15A 1GW1A 5FD0A 4A21A 3I7SA 4EWJA 3QYSA 3W74A 3TJIA 2ACRA 3H2MA 3KRUA 3MQTA 1X6NA 1JNDA 1FX6A 2V5CA 4KCWA 3MCNA 1MUMA 5A2CA 1P1XA 3VNKA 4EAYA 3AXXA 6A3HA 1WAUA 2YJQA 5C8BB 3TYDA 3NQ6A 1PAMA 3MCOA 4DPPA 3ITYA 3HN3A 3R8GA 5KINA 5A8PA 3QRHA 1H2JA 3PUEA 1E55A 1OT2A 5EGRA 2VX7A 2OT1A 3GU9A 5KSWA 3MMUA 4LS2A 4KWOA 1VEPA 2PI6A 2OLSA 1JGMA 3EKLA 1ELSA 3VOFA 1QW9A 3W84A 1RQHA 4XIAA 2I17A 5ABHA 3AS1A 4GH3A 4KT2A 4PTVA 2VQUA 3W2KA 1UWAA 2VWSA 4WY0F 1FCVA 5LNVA 1AW1A 4R33A 2PGRA 3P0XA 3ARQA 3QZEA 1M6JA 3IPWA 2A6NA 2FTPA 4N02A 1XLLA 4Y8EA 1OGBA 1NP0A 3NPWA 1W3HA 4FSAA 4R3UA 4U5IA 4UFJA 2LLEA 2PURA 3RLUA 1XCWA 3FOKA 1TZ9A 4BI6A 3CEPA 2OZ0A 4R7OA 1EXBA 1MFUA 2WJEA 2CHRA 2YCLB 4P7QA 3A4AA 4LVBA 5A8OA 4DN1A 3APTA 1EHAA 4GI6A 4GNVA 3K1DA 3TTOA 2FYMA 4L4OA 1ZAIA 4KERA 3P80A 1HO1A 1RH9A 2BHZA 2BP1A 3HF3A 4PBEA 3SCPA 4OFCA 3WSUA 3LI0A 3QZAA 2NQLA 5DQPA 3AWNA 3MP4A 4G8TA 5F2IA 3DENA 1GWJA 2VC6A 1FKWA 3ABOA 1EJRC 4K1WA 1O66A 3MCMA 4GC3A 1YE4A 4AYGA 4O1DA 1W3NA 3HG4A 3WLRA 2BWGA 3N4FA 2GGJA 4FIRA 3ITVA 5I09A 1VRDA 2DP3A 3G0UA 2GSHA 1TV3A 4GIEA 4DZ5A 3UY8A 3M0YA 4MY1A 5A6AA 3QHMA 4LUYA 4EOUA 1B1YA 3U4AA 1OEPA 4N4PA 1YTKA 3UW6A 1KGWA 3FGCB 4CVUA 3G1XA 3PSVA 3MW7A 2D69A 4IMDA 2FHFA 4B4HA 1LM1A 3OGVA 1V79A 3KUMA 4D6GA 4PGLA 3LPOA 1KBKA 4Z1CA 3VO0A 4OGZA 1KCZA 3HPAA 4DI8A 3NDZA 1ITCA 3CUFA 1DJNA 3VUPA 3FKKA 1AW2A 4MWAE 4O1EA 3ZJKA 4AD4A 1GTHA 3O2LA 3SW6A 2Y0FA 1GUVA 4UFHA 2G4FA 1HGYA 4RV3A 3NL6A 2VUNA 4GWEA 4UQCA 5M03A 4GBUA 4C1KA 3KXQA 3DFOA 5MHBA 1VLIA 5BU9A 3A5FA 4TVCA 4FLSA 3HO8A 3UR2A 2HDJA 2EPMX 2OJPA 4PEEA 2AAAA 1Z44A 4YCOA 3OZYA 3UXAA 1H7WA 1N82A 3O0KA 4AB4A 3SRHA 1Y5VA 4NASA 1TG7A 4OTKA 3BJSA 3BQ5A 5CQ1A 5FJJA 1UKPA 7PTDA 4CNPA 2E3ZA 4L56A 1N55A 1QPNA 1TPVA 1GZGA 3U2OA 4LC6A 1VZWA 3T0DA 4YVXA 2GJPA 4A3QA 2BGNE 2HPMA 2V5KA 2QGYA 4LXFA 1QNOA 1JZ2A 4I9JA 5BRBA 1J5SA 1ENUA 2OCZA 3C8FA 2FMOA 3TQKA 2C18A 3CQJA 5AVHA 4LSBA 3S2JA 2G8ZA 2NZLA 3FK4A 1VGAA 3RM4A 1W2VA 1DIKA 1PX4A 1R3YA 2WC4A 4JIRA 2ZUMA 5AC7A 1LQ2A 2QIIA 4TIMA 3BAWA 2AQWA 3H4XA 1FCBA 2OGYA 3UZJA 3TW7A 3QFWA 1H7OA 1F9CA 3MO4A 3LRKA 3SO7A 5DMNA 5AB3A 2ZC8A 3N17A 3W7NA 1XFCA 3LZ3A 4AVFA 1SMDA 2A1YA 5TIMA 3RG6A 4U3CA 1UZHA 5FEZA 1UUOA 4UTJA 3EX1A 5HATA 1ODZA 1PX3A 3S2CA 3UY7A 1EPXA 5AHEA 5J5DA 1U83A 1UWQA 3QVQA 2NQ5A 2AKMA 3VOJA 3IRDA 4Q8QA 1N8WA 1GVIA 2OWXA 4L1XA 3TUUA 4DYEA 4HPGA 1DJHA 2WM1A 2CLIA 2XVGA 3LCHA 4LYQA 4PCFA 2PTXA 1LRNA 3B9AA 3DKLA 4O11A 5GNYA 4L6OA 1VFUA 1ICSA 2FMNA 4J2PA 4KKXA 1H63A 3REQB 3I7RA 3NZRA 5FKYA 1ZAJA 3M0JA 1WKFA 2WVVA 3NZGA 2H8XA 2OYLA 1R85A 5AYYA 3H4GA 5A8MA 3U6WA 1E1CB 1BG4A 1CPUA 1JNEA 4Z0SA 1OM0A 3QGVA 1RUSA 1EHNA 3WDPP 2F38A 4ECLA 1S1PA 3GFYA 2BVWA 4XAGA 1TQJA 1KTCA 3L65A 4HNTA 2ZZ6A 2PEVA 4JCMA 4BY3A 1R46A 1OG6A 4CNOA 1WZMA 2Y85A 3L67A 2PP3A 2EPKX 1S2CA 4RJEA 1E0VA 1GYLA 1TIWA 5DRCA 2D2HA 4NNAA 1E3ZA 5DX7A 1XF0A 1NH6A 1KLYA 2VI0A 1R2RA 4KH2A 4XBSA 1W5PA 4KWWA 5DRIA 1F61A 1OCBA 5HPOA 1UD6A 4ZGYA 3WMLA 4P61A 2TPSA 4JTIA 1GG1A 3WH5A 2QULA 1PKMA 4YS1A 2QCEA 1TCMA 1E0WA 2Z7KA 1GOOA 3SUSA 1PTDA 4MUPA 5K9CA 4QQUA 3T42A 3V35A 1J6PA 5G2HA 1A5BA 2Y8VA 3IJLA 3FA5A 3KFTA 1HJUA 2D23A 3AO0A 1DJXA 1Q8AA 3QLLA 4QIUA 3FJ4A 4EF9A 5C6MA 5H8PA 4AG0A 4TV6A 2C1IA 4IIGA 5JUVA 4WQ6A 3T0TA 1W9XA 3PZ9A 1RR2A 1Y5XA 1NF0A 2DT0A 3ZQ9A 3CTTA 4Q7NA 4FPSA 3R5EA 5I3FA 2WQDA 3WL1A 3GZ3A 4UTWA 3RM8A