3SIZA

Crystal structure of the mutant s127a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMAHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mutant S127A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor BMP
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 84
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sizA00
3LV6A 1KV8A 3W7NA 1N55A 1Z44A 3F03K 3R13A 5I3IA 3CHVA 1GJPA 1Q6QA 3GXTA 2E6DA 1NF7A 3QQ0A 2WQPA 4U4MA 5F4XA 2NV1A 3RK8A 1GWJA 3IEBA 1TTIA 3W7HA 4YCOA 1OX6A 3C8FA 4DF0A 3MBDA 2FIQA 1MEHA 1LCOA 2VFEA 3UWVA 5AHLA 3JRKA 2C14A 3MHFA 2CLHA 4WJEA 1GG1A 1SW3A 3INPA 1YXYA 4JX5A 1VHCA 4LNYA 3LV5A 4DO5A 2ZZ2A 5AC8A 3QMSA 5KINA 1SU5A 2QAPA 1J5TA 4LV9A 3W7KA 1DBTA 3S1UA 3L0NA 3DAQA 4O8RA 4UFLA 4XBKA 3TJLA 4I7UA 2QUVA 1EIXA 2Y85A 2QCHA 1L9WA 2A1YA 3EX2A 3RFAA 1TPFA 4WQ6A 5D2YA 3E96A 2TPSA 1OYCA 4QSHA 3PG9A 1HO4A 1KFCA 1GG0A 4N2YA 3R2GA 3GDMA 3DFOA 4GUJA 1YDNA 3W1QA 3IVUA 2CWNA 5G2HA 3GVGA 1ME9A 1O94A 4HIBA 1OX5A 4PFMA 3HO8A 2ZCGA 2C13A 4O53A 4JIQA 4XQ6A 3GXPA 2X1SA 2RFGA 3MBFA 1WOAA 3BG9A 3C52A 2GJLA 3QYQA 5FEPA 2TMDA 4A22A 4JTTA 5BW6A 2E77A 2EGZA 3TX9A 4MLJA 2YW3A 4LY8A 1O60A 3M6YA 3T78A 4NZFA 2FB3A 4YXGA 3N9SA 3LRMA 1IXQA 2ZDRA 5AB3A 4JTHA 4O17A 3SGUA 4HNUA 3NQFA 4FIRA 1AW1A 3HOJA 3CB8A 1LRQA 3KAOA 3W6YA 2KZHA 3I7RA 4A3UA 3EWYA 2E6AA 5AC6A 3THQA 4AXKA 4R53A 4MY8A 4FF7A 5BRBA 3IIVA 3B0VC 3M47A 3W84A 1MEWA 2JGYA 4MZYA 5E0KA 5D30A 5DLCA 4NJJA 4Z08A 1VQTA 2NX9A 1SO5A 4LOCA 5HR7A 1P1XA 5CKSA 1TJRA 2C16A 4QM1A 1W3NA 4FNUA 4JEQA 1J4EA 3QW4B 1KBJA 2H8ZA 4O1CA 5K3VA 2NXGA 1HL2A 2A0NA 3A23A 4M6QA 4FX8A 3ATYA 2B7PA 4YL2A 2YYTA 1QNVA 3TIMA 3C56A 1FUYA 1V7YA 3UWZA 4D2JA 2QCEA 1FX6A 1L6YA 3EX3A 1PIIA 1AMKA 3ABOA 4NZJA 4CNNA 1S5WA 4TMCA 1H51A 3DHFA 3CWNA 1BKSA 3DFNA 3MWAA 3CM4A 1OF8A 2J88A 3NQVA 1YPFA 1M6JA 1PL9A 4QNEA 3NG3A 3GDKA 1GVSA 3L2IA 2C15A 4N9BA 3FFSA 3W7PA 1WBHA 3MW7A 4AVFA 6TIMA 1FXPA 1H60A 1DQXA 5F2MA 1OABA 4LS0A 4GUIA 4O16A 1X6UA 3TKFA 3PBWA 3L5LA 1VC4A 2QJGA 2D73A 3SGZA 2YDAA 1EWDA 4NJKA 1SW7A 3HIJA 3QFEA 4IXXA 5EKYA 3M16A 2ZRWA 4S2CA 3BVJA 4JR5A 1OYAA 4DF1A 3PB2A 2AGKA 2Y70A 1SZEA 3W7CA 4YCPA 2Y7DA 1P4CA 2PCQA 4I7VA 4IMFA 3BLEA 3HPZA 2CZDA 3C2FA 1ICQA 1RZMA 5AHMA 3C61A 5HR6A 1H63A 4FNTA 1NSJA 1LP6A 4RZ5A 2YSWA 1LM1A 3R89A 4MJMA 2HTMA 1PCWA 3N73A 1YADA 1TV7A 1H7PA 3T4CA 4X2RA 1A5CA 1ME8A 3WFAA 3TR2A 5G2WA 3BPWA 4KWVA 1JUBA 5CZSA 3BO9A 3WK2A 4UC5A 4ALDA 2C0AA 1TV5A 1WAUA 3HPXA 5D03A 3QMTA 5CPOA 1KFLA 4R34A 1ZAHA 1WXJA 3M9YA 4Q33A 4NNBA 1A5SA 1DQWA 3EXRA 2G5WA 1WQ5A 4EIVA 1Q6LA 4JTKA 2V5LA 3NPWA 3PM6A 2BSLA 4AF0B 4A21A 3O6YX 3S6DA 2WV8A 3I6RA 1OFEA 4KFNA 4UTKA 3W1LA 3LOTA 1JRCA 3M5XA 5AOUA 3EXSA 3DBPA 3GKFA 4O52A 3PR2A 1ADOA 4WY0A 1LTDA 2DJLA 5EY5A 2NUWA 1RD5A 1YYAA 4JGDA 4RK8A 4AF0A 3NL5A 4PL1A 5D09A 2PRHA 3TA6A 4RV8A 2NLIA 3G1DA 5CPNA 4K38A 1GQNA 2QCDA 4B5NA 2ZA3A 1JCXA 3O06A 4A2SA 4JY9A 3O1NA 3W22A 4ZVJA 3W2UA 5D2VA 2Y7EA 4CLMA 4E2BA 1QCWA 4OE7A 4GUGA 3UWYA 3SW6A 4JD4A 6ALDA 4PEKA 3W72A 2V0TA 3QF0A 4FNPA 3V1PA 3TW6A 3NPUA 4DPQA 5BOOA 1F74A 2VEPA 3SECA 1R2SA 3HGSA 3LCHA 2J9XA 1SZFA 4IJBA 5BNKA 3RMJA 3UWWA 3CEPA 4ZQMA 3NPXA 5DY2A 3LTPA 4O0ZA 1JCLA 2R14A 2V5BA 1LOLA 3BW3A 4ZQRA 5K2ZA 4O1AA 2HMCA 1H7OA 4S2BA 1U5JA 3WJSA 1TO3A 2EF9A 4LUJA 3OBKA 4OWGA 3ZS4A 2OMAA 3L0KA 1Z41A 2C1HA 4O15A 3EWWA 2GUUA 5HMSA 4K8HA 5C5YA 2A6NA 1S5VA 1L6SA 1IIGA 4W9TA 1LORA 2G96A 4N9EA 2ZRZA 3SR7A 2Q8ZA 1DOSA 4I9AA 4Y8FA 1VS1A 4L4MA 2ATMA 3TV8A 4ZZ9A 1OG0A 3VKJA 4AWUA 3PBVA 4YLWA 2Y62A 4WOQA 2H3BA 3NVTA 3DU0A 3R5EA 3N2XA 3QEZA 1LRTA 5HINA 3N19B 5IBXC 2JBMA 3CIWA 3NQDA 1LDCA 1W56A 3I65A 4M6VA 3IVTA 2Y88A 2Q3OA 2NXHA 1SO3A 3IIOA 1V5XA 4X3ZA 5E1QA 1MZHA 3B0PA 4GUHA 2NX1A 4JTUA 3PB0A 2AAMA 2ALDA 1XBZA 1EUAA 1PCKA 4O1DA 1K3UA 5L6UA 3PUDA 2V82A 1JQVA 1F6PA 2WNZA 2YZRA 4MUZA 2R8WA 3F4WA 1OF6A 4WD0A 4JYEA 3TROA 4JS3A 1XUZA 4Q4KA 4O14A 4Z0JA 4IMEA 5TIMA 1JRBA 5F1UA 2X1UA 3TJXA 5U7SA 4LVDA 3LCGA 3KX6A 3ZFHA 1XCFA 5LNRA 3A5VA 4MPQA 1AW2A 4UFMA 2FB2A 1LOQA 1VGAA 2Z2UA 1SW0A 2XN0A 4JTIA 2A21A 3U2OA 4HHPA 4E0CA 3W7RA 4Y9AA 4CCCA 1KM4A 4BI7A 1ZAJA 1QO5A 2FFCA 1A53A 3QH2A 3EEGA 3UY8A 1AG1O 1OK4A 1TPH1 4IX2A 1ICPA 2ZA1A 1GVRA 2VC6A 4UMCA 3S5YA 2Z0IA 3LCWA 1KTBA 3KRZA 1XDMA 3HMJG 3P82A 4UTJA 4Q32A 4IQLA 5LZLA 5HULA 2Y6ZA 5IBXA 3FKKA 3LTYA 1UB3A 3UXDA 3UYCA 5DELA 3CPRA 1ZCOA 3NQ7A 1XDLA 3W73A 2FLIA 3ABQA 4H6KA 5HWNA 3W1RA 1G4PA 2QCGA 1UUMA 3A9IA 4ICNA 1VPXA 3WK3A 2NWRA 1ICSA 1LOSA 4LS1A 3NL3A 4GC4A 4IWWA 3BV4A 4NT0A 4O4WA 3NGJA 4H4IA 3E9AA 1TIMA 3QJAA 3HBLA 2TYSA 3L66A 3KVLA 5GVJA 1W5NA 2CLOA 1I2OA 3W7GA 5A5WA 5E93A 4LUIA 4ORMA 5TQLA 3NM3A 1M7PA 3P60A 3WJYA 1THFD 2W79A 1G4TA 5D05A 1K7XA 3G1HA 2P1FA 1IIHA 3EB2A 2C19A 2ISWA 4BWLC 1WBJA 2YX0A 2ABAA 4K6AA 4MOZA 3LHVA 5AC7A 3RU6A 1QOPA 4DBDA 4MFEA 5A8GA 4LVGA 4WX2A 1MEIA 3TQ0A 5H91A 4PTNA 4CNOA 1HG3A 4JN6A 1IXNA 5F2IA 3UZ5A 4OV9A 3KRSA 3C3NA 3L21A 2RDTA 2NZLA 3NA8A 1KBIA 3DFQA 3W1PA 4LT9A 3G3DA 3W2JA 2CLMA 3FLUA 2FPTA 1KM1A 3NQ8A 3GIYA 3O6CA 3G0XA 3PG8A 2V2DA 3GK0A 3LCFA 4FO4A 1ZHAA 5D2TA 3BK0A 4IMCA 2ZZ4A 1WV2A 3I68A 3L67A 4ZQNA 1DVJA 2AQWA 2ISSA 4Y90A 4AWSA 2VKZG 3W7MA 1EX5A 2C6QA 4UMBA 1MXSA 1XXXA 4LRSA 2ZBTA 4NQ1A 5LGZA 5LNUA 4X9SA 1VYRA 2G97A 2IQTA 4BI6A 2A85A 2Z6JA 4RCXA 3PF3A 3BLFA 1T96A 3FOKA 3P7YA 2QCMA 3LRLA 2A7PA 1W5PA 3BG5A 1I45A 3W2LA 3PULA 4NX0A 4OT7A 4JYDA 1RV8A 3ELFA 3S0CA 3W75A 4TX9A 3PWAA 1VYPX 1EEPA 3EWXA 1KM3A 2YR1A 4UFIA 3ABRA 4JTFA 3N14A 5F1VA 3W71A 3DKJA 4ZQCA 1ML1A 4WZHA 3DFTA 1KFJA 2O7SA 2YCEA 4MFDA 1YXCA 4MLRA 1H7RA 3P8JA 4DO6A 3T40A 4M5PA 2X1RA 1FWSA 1A5AA 2H3DA 3GR7A 2CLIA 3CT7A 2QJIA 4O1BA 4UR7A 1TTPA 3GX9A 4JDBA 2E6FA 1ZALA 3O63A 5FF4A 4HNTA 5LKYA 2V81A 3SIZA 3UZJA 3O15A 1YLVA 3SI9A 4HN4A 4QQ3A 1L2UA 3Q58A 4NVTA 1JR1A 4IUOA 2V30A 3LERA 3H55A 2XN1A 4QITA 3M0ZA 2B7OA 4GJ1A 1KM0A 4C1LA 2ZZ5A 2A7RA 4IOTA 4IMGA 4BWLA 2UV8G 4PA8A 3VE7A 3W2NA 2QDGA 2OJPA 1O95A 3CTLA 4O0KA 3P81A 4S1FA 5D32A 2I9EA 4JICA 3TNOA 1AL7A 4HKPA 3LXCA 3PVFA 1LYXA 1QPOA 3M44A 3L9CA 4EF9A 2E09A 4J9JA 2NXIA 4UIOA 4JXCA 2Y61A 1GPWA 1K02A 4ZQOA 3KVKA 3R12A 1PE1A 3QSRA 1ZY9A 1H1ZA 4JY8A 2E5DA 1QOQA 3LBCA 1R2TA 1AW5A 1A50A 1IXPA 1W0MA 4FNQA 2JKPA 1JULA 4O50A 1QMLA 1FWWA 3MJYA 1C8VA 4QNWA 3G22A 1I4NA 1G7UA 1TQJA 5EL1A 4AEOA 3B0UX 1F05A 4Y96A 2DU2A 1ZJIA 1QAPA 1OFQA 1K7FA 4XTDA 2RHGA 3M43A 1JQXA 4IXHA 2HS6A 2R91A 4MYAA 2Y89A 3OVPA 3OEXA 5DXXA 2JGQA 4M7SA 5AYZA 5D04C 5AYYA 2QR6A 2CU0A 3L5AA 2GPTA 3W7OA 1TCDA 2PC4A 3H54A 3HGRA 1FWTA 3W87A 5AN7A 1W5MA 3G24A 3P67A 3CC1A 2Z1BA 2TSYA 3TQKA 3HGOA 5D2XA 3ANYA 2Q8LA 4RZ4A 3NQ6A 5DCEA 2Y63A 4R33A 3OVQA 4QIUA 2EAWA 4TR9A 1SQ7A 3MI6A 1H61A 4FXRA 1FWNA 1OVDA 4MKNA 3B8DA 3GXNA 1TRIA 1VCVA 5EYWA 1B4KA 2ABBA 5U4NA 4E38A 1OFPA 2DJXA 5G1TA 3TSDA 5LNVA 4XKYB 2X1TA 3TFCA 5AHEA 3TUUA 4R7JA 1DL3A 2Q3RA 1VLWA 3IIXA 4LW7A 2VEKA 5F4SA 5FF0A 3GZ3A 4UTWA 3ZR4A 3CEUA 1OK6A 2FJKA 5G5IA 2NV2A 3RNDA 2OCZA 2WSRA 3TMQA 3FS2A 2GQ9A 2J9ZA 2J27A 5K9CA 4NXKA 1TRDA 1MO0A 3M1ZA 1Q45A 4Z1BA 3SFKA 2RDWA 3O16A 4GNJA 2DZXA 1QDSA 1Z48A 3ATZA 3W7DA 3K30A 1W1ZA 1I2QA 1EPXA 3PSVA 3UPBA 3TC6A 3GDTA 3GR8A 4NNAA 4KWWA 1OHLA 3M7WA 4UTTC 5DXYA 2ATSA 1L6WA 4G1KA 3RLVA 3NPVA 5C2XA 1H7NA 3HG2A 3P5YA 1KFBA 5HWMA 3NZRA 4JTGA 4P2VA 3GYEA 4UTIA 5D02A 3W07A 1NF0A 3HGJA 4ONVA 4BK9A 3TC7A 3W2MA 1FDYA 1R30A 4CNPA 5F2GA 5K7JA 3RLUA 1NFBA 3SSJA 4HSNA 3C2OA 3N2MA 5EMUA 5K9DA 1DHPA 2WSQA 2OT1A 2GVJA 1XI3A 5AHIA 3EWZA 3NNTA 1X1ZA 1PHWA 2QCDB 1SUXA 3DI0A 5D33A 4YWIA 4U28A 3LCXA 1ZFJA 2CZFA 1B3OA 3NDOA 3TSMA 1LLZA 4FNSA 1KLZA 1KM6A 3STEA 3BW4A 4CQAA 5KZEA 3OG3A 1QWGA 3NAVA 3NR0A 2JK2A 5HJLA 5C6MA 1TTQA 4O12A 4RZ6A 3VCRA 2PE4A 1VYSX 3W1TA 4E2DA 3FYPA 1TPDA 2W0UA 3QPYA 1VRDA 2WPBA 1KM5A 2QUTA 3LGEA 3LM7A 1XBYA 5K9XA 3P5ZA 1VCFA 1F6KA 4EVZA 1H1YA 3E02A 4ZMGA 1JUEA 3S1XA 3WJZA 4Z1DA 3MUXA 1C9DA 2J9YA 3MO7A 2YPIA 3W1NA 3C6CA 3EKZA 2E5CA 1RQEA 5EA9A 2I1OA 4CCDA 4WXYA 3Q37A 4Z1AA 3KFTA 5H2ZA 3LCLA 5DCDA 2ZFAA 3B04A 4O19A 3S5ZA 3TAKA 4IPIA 3G8RA 1F73A 4LV4A 3OVRA 3KOFA 4HT3A 4KFPA 3FEMA 2YW4A 3MYOA 2W6RA 5D38A 1PS9A 3LI0A 3N34A 1TMHA 1X7FA 1OFOA 4FXSA 1G6CA 4ADTA 3Q94A 4LC6A 5G4EA 4IMDA 4GRSA 3QC3A 3HQ1A 5DBUA 1R46A 3LHYA 1ZAIA 2C3ZA 1SZNA 4I7WA 1WA3A 3G1YA 1SFLA 1TJPA 2C18A 1A5BA 2J6XA 1X1OA 4UNKA 5HQEA 4UTHA 2QCLA 4FIQA 3WK1A 4Z1CA 2H8XA 5HWJA 3TH6A 1LBLA 1SSGA 3IGSA 2HSAA 4UFHA 3ZWTA 1RR2A 3W7JA 4IPJA 1R47A 1H7WA 3VE9A 3USBA 2RKXA 2QAFA 3DHDA 1OX4A 2WSYA 1O4UA 3W1AA 4POCA 3L5MA 3GAKA 1I2PA 3UNDA 3W7EA 3WK0A 3UWUA 3M41A 1Q3NA 5CSSA 1GZGA 3GNDA 5DCBA 1SR9A 1OFBA 5KITA 1JUKA 2X16A 1UCWA 3TCEA 2V8ZA 5MHBA 1D3HA 1GT8A 2LLEA 2QF7A 4XUGA 1JCNA 1S3HA 3GDLA 3G1VA 4RXGA 4UUIA 1H5YA 3NYZA 2VELA 3EKLA 1Q6RA 2YFNA 3N9RA 1M5WA 4K7VA 3QSTA 4WOZA 5D2WA 4MVAA 3T44A 3O07A 3PBYA 4TMBA 5DN1A 8TIMA 1DORA 3LLFA 3W23A 4BR1A 1TSIA 1YTKA 2J24A 4LTSA 4RLIA 3HG5A 1K03A 4NUWA 5L9FA 2A2IA 1QPNA 1P0KA 2X30A 2B7QA 4UXDA 5CG7A 3DZ1A 3R8RA 3O05A 2P0OA 4UTLA 1GYNA 2E6YA 2RH9A 1I2RA 1JCMP 3MMTA 3GDRA 3FYOA 3LHZA 2QJHA 3TXZA 4TIMA 1Q6OA 3KRUA 1NVMA 4YMZA 3W1UA 1O5XA 3LBMA 1GYLA 1YDOA 1F2JA 2CW6A 1XL9A 4UNLA 3N3MA 4KKXA 2XFWA 2YGYA 5LNWA 3S42A 5BMXA 1ONRA 3O6DA 1AL8A 5AYXA 3PUEA 1HO1A 4DXVA 3HG3A 2CFFA 1GVOA 2GJNA 3QM3A 4LC8A 4JYFA 1YTEA 1JCJA 1DJNA 3QMRA 3HPSA 3U6WA 3NZ1A 2CLKA 1B9BA 5DY3A 1PVNA 1FCVA 2YFOA 4PH6A 5LGXA 2VFHA 1IXOA 2WNNA 5D37A 2A7NA 3KVMA 3DFPA 1BWKA 5J5RA 4CQ9A 2GVLA 3DKLA 1SSDA 4MZ8A 1HFBA 4WY0B 5FEWA 3NQMA 2H90A 4ADUA 5LHEA 2WKJA 3W1XA 3L0GA 3W3OA 4OHQA 2VFFA 2Y7FA 3HF3A 2ISVA 1LZOA 3GLCA 4X22A 4GXMA 5BMWA 1CI1A 3LXAA 1TB3A 1DKWA 1TPEA 3NEVA 1XBXA 3PAJA 5KMYA 4FX6M 3LHUA 3MI3A 2QDHA 1FDZA 3THAA 2BXVA 4BFAA 4LVBA 1ME7A 1BEUA 3W7QA 2PURA 2DZTA 2F7FA 3MI2A 2EHHA 3LHTA 3STCA 4TO8A 2DORA 3G18A 1T0OA 2NUXA 2FTPA 4UTMA 2F84A 3E12A 1IF2A 1OFDA 4RJEA 1J2WA 5T26A 1HTIA 2V2CA 3KVJA 4MYXA 1TPB1 4A29A 1LRNA 3WJWA 3MP4A 2OT0A 1FXQA 2OX1A 5LSMA 1ALDA 4BI5A 1LBMA 5C54A 1PV8A 1E51A 1T8XA 3NQAA 3W7LA 1EWEA 4CCEA 1S5TA 1X8FA 2CZEA 3LLDA 3IIPA 4O10A 2JKEA 5EPDA 3PC0A 3LCIA 5AFDA 3SY5A 1U83A 4OV4A 3AJXA 4NJIA 1PHQA 4NXSA 3CIXA 4UTWC 1QFEA 1KV5A 4QISA 1TPC1 4DQWA 1QR7A 1FCBA 3PY2A 4UFJA 2A5HA 3G3MA 1B57A 1GVFA 1P5BA 2CLLA 5HNRA 4DBEA 3S9YA 1FY6A 3EWUA 5EBUA 1XKYA 1N7KA 1XUUA 2CZ5A 4N6EA 4XBSA 3TQVA 2DZPA 3D0CA 1LLWA 4XWUA 4MIMA 5K4XA 1XC4A 3G0UA 1GTEA 4DPPA 1SPQA 4AMAA 4UTTA 3QW3A 5F2LA 3W74A 1SO4A 4AHPA 3P61A 2QCCA 3W88A 3TW7A 3VI2A 1YPIA 3ABSA 2QKFA 2QCNA 4O57A 3DH7A 3UD6A 1CW2A 2E5BA 3DI1A 1RQBA 3MYPA 1C29A 3MHGA 5LHFA 4LWWA 1FBAA 4C1KA 1W3IA 4FX7A 4XZ9A 5CSRA 3C2RA 4UCGA 1ZNNA 1VR6A 1UUOA 4JTEA 2OZ0A 2ZTKA 3STFA 2H6RA 3CQ0A 1SO6A 2R94A 2PRLA 3UPWA 5DBTA 5FI8A 4RX0A 4RR4A 4K8EA 3TU9A 3FJ6A 4XKYA 3LXBA 1EB3A 2ZRYA 3O8AA 2B4GA 4FHAA 3RF9A 3EXTA 4UMAA 1TPUA 2NWSA 3GKAA 4Y6GA 2GQ8A 2ZRVA 1XM3A 1EP2A 2V9DA 4JTLA 4EF8A 4NJHA 4NU7A 5SWUA 1DV7A 5FF7A 3BGGA 1HUVA 1XFBA 3CU2A 1OJXA 4M19A 3DFSA 4O4VA 1VCGA 4HPJA 3IIZA 5FF3A 2VEMA 4ZQPA 4N4QA 2VOMA 1JJKA 1EA0A 1IGSA 3NL6A 3DENA 3C2VA 4O13A 5FESA 1VH7A 3T7VA 3FKRA 2EKCA 1TPWA 4AHQA 3NQ2A 1XBVA 4DELA 2ZA2A 2WOQA 3LB0A 5G1YA 5G4WA 4OU1A 3W85A 3S1WA 1I2NA 5I3GA 3B4UA 4QJ1A 4HSOA 2ZQ0A 4TU1A 2VENA 3V75A 4OGZA 4JTJA 3E0IA 4O28A 3QRHA 4O18A 1WOBA 5CPLA 1K8XA 4WUIA 3G1SA 2FDSA 3KHJA 5CPMA 1OX4B 1N8FA 1OFAA 3W1MA 2WJZA 4O11A 3P80A 2YXGA 4ZL1A 4O54A 2QEZA 5KSWA 4L4LA 1QPQA 2FQIA 2E68A 3EX6A 2ZRUA 1KTNA 3TK7A 2DZSA 2BZNA 1I8JA 1SFJA 2B0MA 2DZVA 3BW2A 5K4ZA 3BGJA 3EX4A 1KA9F 2WNQA 4AB4A 1G4EA 2BLEA 3Q2DA 4WY0F 1G7VA 3TMLA 4OBTA 3PS7A 2ZZ7A 3NM1A 4K7YA 2XN2A 3UQNA 4JDYA 4BF9A 1FQ0A 3NL2A 1KFEA 3STGA 2BWGA 2O7QA 3QQ1A 3W76A 1GTHA 3F1QA 5CZTA 5LNSA 3S1VA 4JTSA 3U8GA 4IGHA 1YDVA 3M5ZA 5KZMA 2I14A 3B03A 4MY9A 2BX7A 1LROA 5FF2A 4GWEA 1AK5A 3CLMA 1TREA 1D9EA 4ADSA 4HNVA 3GAYA 1FCQA 1G69A 1K8ZA 2E1DA 2BTMA 5C55A 3IV3A 4MZ1A 4DO4A 2JKAA 1DJQA 2ZZ6A 5I3KA 4DEFA 5CZJA 2VEIA 4RKAA 4GE8A 3MP5A 1RPXA 3OHIA 5AHNA 1W37A 5FEZA 2TRSA 3W70A 1KFKA 4JX4A 3LX9A 4HPXA 1GOXA 3NQEA 1FCUA 5HUOA 4AH7A 2VFGA 3P62A 4AWTA 1UASA 4GFSA 5AHFA 2FPVA 3HG4A 1H7XA 4OQVA 4CQ8A 3TE9A 4WXZA 4LVAA 2ZZ1A 1OYBA 2A4AA 2A6LA 1SZGA 3YPIA 2B7NA 3A5FA 1EP1A 1VZWA 4MJZA 2FPYA 3A22A 2QUUA 3S5NA 1BTMA 2DZWA 1Z42A 1WX0A 3UY7A 2VXNA 4N9CA 1RQHA 3P74A 4GBUA 4UFKA 1W3TA 1F76A 3AO0A 5I3FA 1QPRA 2ZYFA 1P0NA 3FA5A 2EPHA 3BLIA 1EP3A 3EX1A 4NNCA 3L65A 4NX5A 1W54A 3C2EA 4A2RA 4H3DA 4LVFA 4K36A 1EUNA 5IM51 1Y0EA 3MP3A 4M6PA 1W5QA 4FEZA 1TQXA 1TPVA 1QO2A 3ZWSA 3M5YA 2G95A 4AAJA 2ZZ3A 4MY1A 3FJLA 3B06A 3LTSA 4DF2A 3UWQA 4GUFA 2GOUA 4PC8A 5HUPA 3W7IA 4LU0A 3MHUA 3H53A 4EOUA 3IRDA 3IGXA 1BWLA 1VJIA 3A21A 3LI1A 1R2RA 3F4NA 1F7BA 2NX3A 4AHOA 3G1AA 4LRTA 4RXFA 3G1FA 3QPZA 3JS3A 4PCFA 5I3JA 3W86A 1FDJA 4K37A 3TFXA 1TYGA 2RDUA 1G67A 4JX6A 1YXDA 1KLYA 3OA3A 1O5KA 4IX0A 3C0JA 3G1XA 4UTUA 3QZEA 3C4UA 1MSSA 4JIPA 3PUOA 4N6FA 1KM2A 1GVQA 4LS2A 4XTIA 1TV8A 4PODA 1G4SA 3PSWA 1M7OA 2CLEA 4N4PA 2VFIA 2NUYA 3PBUA 2YYUA 4UR8A 4JNMA 1D3GA 2P10A 5ABTA 4FNRA 3TXVA 4K39A 1T99A 3GNNA 4P61A 4HNNA 2QCFA 4ORIA 1JCYA 5KTLA 1KTCA 3IVSA 3VFLA 3NQGA 3B05A 3SJ3A 1TTJA 1CX9A 3P84A 4NJGA 2WO5A 4FB7A 3NQCA 3BG3A 4M7TA 3OIXA 7TIMA 1WYIA 1ZENA 3TSBA 3P8IA 3NXFA 1B4EA 1YTDA 4N02A 3S8HA 2ZTJA 5I3HA 5J5DA 1VHNA 1RVGA 3NOEA 3JR2A 1W8SA 3HJZA 3M5VA 1F5ZA 3LHWA 5KZDA 1VLIA 3BARA 1W31A 4QAIA 1K8YA 3KXQA 2X2GA 3NO5A 5TBOA 3W83A 3GB6A 5G2IA 3WJXA 3DXIA 1GEQA 4KFOA 1H50A 4EWND 2DZUA 2GVGA 1WDWA 3W2KA 2V2HA 3EWBX 4ML9A 3I7QA 3S5OA 2VFDA 3IGUA 1UBSA 5CZ0A 1FWRA 3HB9A 5CGQA 3UXAA 2Y7GA 5FEXA 2ZRXA 2GQAA 3W9ZA 3TDFA 2HS8A 2Z6IA 1NEYA 3E49A 3CWOX 3FIGA 3SZ8A 3G8EA 1H62A 1LBFA 1KW1A 3LRKA 2CLFA 2DP3A 3L68A 3DGRA 1OFRA 1W5OA 3VNDA 4PL2A 1NAL1 4Z0SA 1K7EA 3A24A 1JVNA 3TAOA 3T55A 5F4WA 1UJPA 3G0SA 4N9DA 3LDVA 3I7SA 2PRMA
chains in the Genus database with same CATH superfamily
1KV8A 2CC0A 2VVNA 3N2BA 3F03K 4Q7NA 1RHCA 3R7MA 2E6DA 3QQ0A 3MCNA 1S2UA 5EU9A 3RK8A 4C6JA 1GWJA 4Q8PA 3P0WA 4AG0A 3BUVA 1GQLA 3C8FA 4DF0A 3CS2A 2IPGA 1LCOA 1XRSA 4AZIA 1V93A 1SW3A 1JYVA 4GA8A 3SIMA 2D2JA 2OB3A 1VHCA 3KZPA 3LV5A 2ZZ2A 1SU5A 2QAPA 1IT0A 1QTWA 4ACZB 1LWJA 3S1UA 4HB7A 4O8RA 4H6RA 4BJHA 1P0BA 3CHCA 4LUTB 1TA3B 4I7UA 2QUVA 4ZFMA 5A94A 1TPFA 4WCJA 4PSRA 5FSDC 2RJGA 4QSHA 3FY1A 1HO4A 2Z28A 3H2FA 4H8NA 4MTVA 1GG0A 4QBXA 4N2YA 2PF0A 4MWAE 3WX7A 3RO6A 1KRCC 3DFOA 3LUTA 4TTGA 4Z1YA 1ME9A 3UA3A 3HO8A 1WNOA 4OBSA 3CPGA 2FZMA 2QLYA 3SO7A 3OBAA 4WJ8A 3T0CA 4UQ9A 3VX0A 3K13A 3VGBA 4W5ZA 1IQ8A 2TMDA 4A22A 4JTTA 2EGZA 1ISWA 3M6YA 3T78A 1I0BA 3R0UA 4YXGA 5LA0A 1IXQA 2ZDRA 2QXWA 2X05A 5AB3A 1JD9A 4O17A 3NQFA 3W4RA 3NZGA 3PUGA 3VDGA 3EWYA 4AXKA 3HURA 4B5SA 1V6TA 4FF7A 4PBFA 3GNRA 3EOUA 1BYCA 2OLSA 3M47A 1Q5MA 4I9MA 1SO5A 1SVDA 4G8TA 4YTUA 1SJAA 2R82A 2J4GA 1KBJA 2H8ZA 4O1CA 2NXGA 2IXUA 1HL2A 3A23A 4ZCWA 1E0VA 2P3EA 3C56A 1V7YA 3UWZA 1B31A 1L6YA 1ISZA 3CO4A 3OGSA 3GVRA 3ZR5A 4TMCA 3W81A 3EDJA 4DRSA 3L2MA 3AS0A 3DFNA 3CM4A 3NQVA 3FVDA 4QNEA 4N9BA 3W7PA 1OD8A 2BG5A 4XD3A 1WAWA 5CH9A 2R1LA 3NURA 3TW9A 4GI4A 3ARYA 3QGKC 3B8SA 1BRLA 4GG9A 4A05A 4HA1A 2YDAA 1XWYA 1EWDA 4DN1A 5TF0A 4L7ZA 3LEPA 3ZVHA 3URQA 2ZUSA 4R9OA 3EOOA 4S2CA 2EPKX 4DHGA 2J78A 1OYAA 2EJAA 3LSCA 2G3NA 3U2CA 2AGKA 3W82A 1TELA 1EJRC 4D1JA 2ZOXA 1OT1A 3W53A 3JZUA 1X7IA 1RZMA 3C61A 4MNMA 4FNTA 2EG7A 1NSJA 3S2NA 4RZ5A 3RN6A 3R89A 2XIJA 1XSIA 3O7UA 1ISXA 4B90A 4HCLA 1A5CA 1ME8A 2TAAA 3SRDA 3COTA 4QGCA 2XIIA 3BPWA 2E7FA 2YXOA 5CZSA 4IICA 3BO9A 1TZ7A 4A8LA 2C0AA 4CKQA 1TV5A 5DANA 1K6WA 3HPXA 2YL8A 3AZSA 4LQ1A 4J1OA 3H26A 2E8ZA 4EPDC 4Q33A 1QHOA 1Q6LA 4WF7A 2Y24A 1TV4A 2PCEA 3WMSA 4JFWA 4AD2A 3GBEA 6XIMA 4PUJA 4OKDA 4HK6A 3UR2A 4UQDA 3LOTA 3BL3A 1DJXA 1IT7A 5JBEA 1WXZA 1ADOA 4QG6A 5CPQA 3SCSA 5JH1A 5BWAA 2NUWA 4RK8A 4JQ1A 4XSMA 4D9PA 2QV5A 2ZX9A 1DPMA 4K38A 1GQNA 1DWGM 5CQ1A 3RJXA 2NQ9A 1E4IA 4AWEA 3O06A 2EJ1A 4WGHA 1XCWA 3F2BA 2WWDA 3W22A 3OA5A 2P3ZA 3OP2A 2Y7EA 3ANUA 3W0KA 3ARPA 4GINA 3UCCA 1BVNP 5FAGA 2OVLA 1M9HA 5JIPA 3W72A 2V0TA 3V1PA 3QY8A 2QHAA 5BOOA 1NDZA 4PE8A 1LT8A 3SRFA 4E4FA 1QHZA 4JOMA 1LL4A 3CV1A 2HBVA 2PDBA 3DECA 3RUBL 3MKVA 5CC3A 4ZQRA 3BW3A 3FXGA 4P8XA 1TE6A 1TO3A 2AMGA 4GIAA 1CPUA 3AROA 5CAKA 4GCXA 1Z41A 2C1HA 3EWWA 1C9WA 5AYIA 4CQBA 1LORA 3DYOA 3LQLA 4QCFA 4EX4A 4R27A 3N29A 3SR7A 4I9AA 1VS1A 4L4MA 2ATMA 4A8RA 1LJYA 3VKJA 3PBVA 4YLWA 1EOKA 1V51A 2VC5A 1PWMA 2AGTA 3WQ5A 4L1XA 3FK4A 4IJRA 3CIWA 2Y88A 2NXHA 2IKGA 3BLDA 2O9OA 1SO3A 2GSHA 2W27A 3KCOA 4OJYA 2HISA 3VM7A 4GUHA 3VDAA 2AAMA 3WH7A 5HMFA 3SFWA 3THCA 4DAIA 1KXHA 3M6DA 4Z2IA 1IV8A 4G2DA 1V0LA 2DQWA 3GNOA 3IANA 3PHAA 3D3AA 1K3UA 3PUDA 3PZMA 3PPHA 1EO5A 2JALA 1OF6A 3M7SA 1MDRA 3WLSA 4Q4KA 1JRBA 3MT1A 1G94A 4J3XA 1U1JA 3TJXA 3KM8A 3BQ6A 2ZUWA 3TVAA 3TTQA 1V79A 4MPQA 1VF8A 4UFMA 2FB2A 1LOQA 2Z2UA 1UP2A 1T6MA 2A21A 3K5XA 4E0CA 4PB5A 3W7RA 2ZX5A 4D6EA 5JBFA 1KM4A 4U2ZA 4LJ3A 1ZAJA 1QO5A 3WLQA 2VVSA 1A53A 2HRWA 2G8ZA 4U33A 1AG1O 1TPH1 2XZ7A 1AQMA 2ZA1A 1XYAA 1SMAA 2WC4A 5HJXA 4FPSA 3LCWA 1EBGA 1V6VA 5LZLA 4PSPA 5IBXA 1IWAA 5DELA 3CPRA 1HKJA 3NQ7A 3N18A 4U10A 1PSCA 2WZMA 2CWXA 2E3ZA 3LZ5A 5LIYX 3CUHA 3WK3A 2PA6A 1ECEA 4GC4A 4IWWA 5TNVA 4O4WA 3NGJA 4OOUA 5HNNA 3SCQA 1TIMA 3N3TA 2DVXA 1XLCA 3KVLA 3CH0A 5GVJA 2CLOA 4A4AA 5A5WA 1E6QM 1KD0A 4MADA 3FA3A 4RZBA 4LUIA 1GORA 1M7PA 1WKDA 1J0KA 2OGYA 3WJYA 3VNJA 1G4TA 3EAUA 1K7XA 3G1HA 2P1FA 3EB4A 1MFVA 3E2QA 4EPBC 2E9BA 4IQJA 2YX0A 1HJVA 4QEEA 3LHVA 3KP1A 2PSNA 5AC7A 3VAVA 4DBDA 2XDFA 3MSRA 4WX2A 4M6UA 3GE7A 3VM5A 4NRSA 4F3HA 3UZ5A 3PANA 5HAOA 1ADSA 3DFQA 3W1PA 2VUNA 2CLMA 4Y9PA 4IP7A 4XD4A 3GU1A 3WLRA 1KM1A 5C70A 3GIYA 3O6CA 3G0XA 3PN8A 2V2DA 3GK0A 4Y9OA 3LCFA 1ZHAA 3NTYA 1UD5A 5D2TA 4ZOEA 3E3HA 2ZZ4A 4GCAA 1WV2A 1UHVA 4HMCA 5HBFA 2AQWA 2PD9A 1SR0A 3AMLA 4AWSA 1M65A 4HTYA 4H9YA 4LRSA 1T7LA 1W3KA 4XZNX 4DUXA 2F38A 2PGWA 2QCMA 3LRLA 3BG5A 3EOLA 1FA2A 1KFWA 3MUZ1 2FJUB 2R9RA 1OIMA 1RV8A 1VEMA 3S0CA 3F7JA 1AH3A 4H6EA 4HU8A 3PWAA 3AISA 3GH5A 1QI3A 3MJMA 1B3ZA 4GOAA 4UFIA 4JTFA 4V2XA 3N14A 5F1VA 3W71A 4G7EB 1ML1A 1EZ2A 4WZHA 2VC7A 3WSUA 3ICJA 5C2CA 1H7RA 1E40A 3T40A 2O9TA 2GQ3A 2POZA 3GR7A 2QJIA 4IIBA 3VOJA 4JDBA 5CGTA 3L4XA 3STPA 4HHHA 3MS8A 1HNYA 5G1MA 3O63A 3VIJA 3VD5A 2V81A 3LD5A 3K2GA 5T8GA 3O15A 1YLVA 4P8UA 1BGGA 4HN4A 4CU6A 1SJDA 3LPPA 1JR1A 3GUWA 1UZ1A 1UIOA 4QITA 3RRXA 3M0ZA 2E4TA 1ZTVA 2UWFA 3WQ4A 4DJDC 1GEHA 2RGMA 4IOTA 4BWLA 5T91A 1YDYA 3EA3A 4S1FA 1UKSA 1BWVA 4RE0A 3B0YA 1JZ2A 3THUA 1LYXA 3A4AA 3TN6A 1LQ0A 4JFUA 1Z32X 4UIOA 1S2WA 4JXCA 1ZSXA 4ZQOA 3H2EA 3SSZA 1S5NA 1H1ZA 2PBOA 1I6NA 1QOQA 2WSPA 1AW5A 4HZMA 1AQFA 3UR7A 4LEQA 2PPGA 1W0MA 3KBVA 4DIAA 3KBJA 3FHAA 1NARA 2VO5A 1TIWA 2EBNA 1I4NA 2FGBA 1TQJA 3VZYA 3S1GA 1XS2A 1IZKA 1QAPA 4M1RA 1OFQA 1XG4A 4KESA 4EPEC 3M43A 3NJ3A 4C6MA 2Y89A 3OVPA 3CQIA 1PB0A 1WO2A 4UQEA 5AYYA 3WNMA 2A3AA 2OQHA 2YLAA 4AZ5A 1XSKA 4P7RA 1H09A 3AS2A 3HGRA 4Z17A 1FWTA 2OEKA 4GJIA 3P67A 3T05A 2Y63A 3LPGA 3OVQA 3FSUA 4XZLX 4BF7A 2E0PA 3MY9A 4FXRA 3QY7A 1XH2A 1B4KA 3TWBA 4F40A 2DJXA 5G1TA 1R85A 3ME3A 2X1TA 1CTNA 3DHUA 4GJJA 5AHEA 4URIA 4R7JA 2Q3RA 1VLWA 1UOZA 4DXXA 2PGEA 2F9RA 4UTWA 1V02A 1B0IA 2ZC1A 3RNDA 2WSRA 4LAUA 3WLTA 1BKHA 1Q6DA 2J27A 3RCYA 4IGNA 1XIHA 4YS1A 3M1ZA 3E1F1 3SFKA 4A8IA 5JUVA 1IYXA 1WZKA 3WQOA 1O1HA 4CN4A 5A6AA 1QDSA 3BMVA 3W7DA 1E9LA 2VI0A 2PUZA 1DYSA 3GDTA 1C8XA 4NNAA 2IMRA 3WMCA 1QBBA 1OWQA 5DXYA 3UG5A 2ATSA 4G1KA 3W26A 5H8PA 4AD5A 2IQ0A 3Q4DA 5T9BG 1KFBA 2G3JA 2PDJA 1QNPA 1JL8A 4P2VA 4HHMA 3T0DA 2J66A 2GLKA 4QDWA 1TV3A 1NF0A 1XKJA 4EKJA 3REQB 4BK9A 4H9TA 4Y9NA 1HP4A 5F2GA 3VCCA 2J8FA 3C2OA 3EKGA 3N2MA 4O8AA 2A3EA 1DHPA 2VHLA 3SY8A 3CPUA 3WEMA 1PHWA 4B3KA 4CN6A 4C7FA 4DNHA 2VOTA 3NDOA 4IP4A 4IFKA 3BW4A 3OG3A 1CGYA 5HA7A 3K1DA 1K9FA 2ZADA 3FYPA 3EGJA 4EANA 5A6MA 1UOKA 1VRDA 2WPBA 3LM7A 3W02A 5GQBA 3F4VA 3W01A 4ZMGA 1V77A 1JUEA 3OZMA 3S1XA 3WJZA 1Q2RA 5AC4A 3MB9A 3MUXA 1C9DA 2D1ZA 3VNYA 1IEXA 8A3HA 3MO7A 2YPIA 3VMPA 3W1NA 3EKZA 3LGGA 1ZS2A 2J47A 3UBPC 4WEVX 1VP5A 2Z7GA 2BVYA 4WXYA 3B8UA 3KFTA 3CZEA 3CHFA 5DCDA 3BZGA 2R24A 3B04A 3S5ZA 2DIKA 3QOMA 4C6KA 4IPIA 1O12A 4CVUA 1OEPA 3KOFA 4KFPA 3PZNA 2YW4A 1PS9A 2XGIA 3BQ5A 1W1B1 4FXSA 1G6CA 1Q8JA 1VAHA 2OODA 3BXWA 3QC3A 3G2GA 1DJZA 1ZAIA 1J5SA 3G1YA 1A5BA 4FOJA 1BG4A 3II1A 1DTUA 2VT0A 3WK1A 3LN3A 3KL3A 2OEJA 3B8TA 4PTMA 4DY1A 3EMQA 3GFYA 4W89A 1LBLA 3BV7A 4LUSA 4C6DA 4GVIA 1GJUA 3W7JA 2V3EA 1R47A 1K6AA 5DF0A 3T6CA 3N2TA 2RKXA 1QATA 3M0HA 4LXFA 2E9MA 3L5MA 3GAKA 2X7VA 1I2PA 4AD3A 3RO8A 2PTXA 3M41A 3NYDA 5C8BB 2ZUTA 3T1GA 1OQFA 2V8ZA 1GKPA 1D3HA 2LLEA 2ZX7A 2QF7A 3CUJA 4LAZA 4GZJA 3GDLA 3ITLA 1GKQA 3NYZA 1ZJHA 4ZO8A 3IAPA 2RDXA 3N9RA 4EP8C 2NQJA 1TWSA 2BGSA 3ZOAA 1DORA 3AHYA 1W3HA 3LLFA 4W4QA 2Z25A 1X38A 4HA0A 1JG9A 1CIUA 4LTSA 2OTDA 3POCA 5CC7A 4LCSA 1P0KA 4HMEA 3O05A 2P0OA 2Z1XA 1GYNA 3WQPA 4YTRA 1I2RA 2DH2A 3GDRA 1UR0A 1S3TC 3KRUA 3WBAA 4L4OA 3W1UA 1O5XA 3LBMA 5ABGA 3VNKA 3W24A 1US2A 1GYLA 2BS9A 2CW6A 4Z2GA 1RH9A 1XG3A 2WMFA 2XFWA 3S42A 1ONRA 1AL8A 1I1XA 4LPCA 1GUVA 1HT6A 2GJNA 2XHYA 3AYSA 1PYMA 1DJNA 3QMRA 3HPSA 3B9DA 5A8NA 3GTNA 4L1GA 4QAWA 5IOBA 2YFOA 5LGXA 1U33A 4QSFA 4IZGA 1PXGA 1VEPA 3SCUA 2A7NA 3KVMA 3DFPA 1BWKA 4CQ9A 1HFBA 4L6HA 1UA7A 4WY0B 3TTYA 2L5HA 2WKJA 3W1XA 2VM8A 7REQB 4JKMA 1GW1A 3UCQA 3W3OA 4OHQA 4ICMA 3HF3A 4C91A 4IFRA 3VOFA 1KWKA 5I09A 1DJHA 2KX9A 2J8TA 3WG6A 4IIFA 3A9BA 3WLPA 1TB3A 4HSHA 3W37A 4Z2LA 1Y8BA 3I3EA 4GY7A 2PU0A 3WLJA 1A5UA 4P8WA 3MI3A 3THAA 1XINA 3S2JA 2FZ8A 2PURA 5I0DA 3HM7A 3LHTA 2DORA 3G18A 3V0SA 2FVKA 3AI0A 4D71A 4HJFA 4MNLA 2V2CA 3GG8A 4MYXA 3A3WA 1S1PA 1XLKA 3KTSA 8XIMA 4W88A 3GC4A 1LRNA 1ONEA 4ERIA 1FXQA 2OX1A 2OO6A 1ZLPA 2PWHA 2EXOA 1E51A 1V4YA 3LLDA 2JKEA 2J74A 1KGWA 5EPDA 7XIMA 5A6KA 1P6WA 4OV4A 1GQJA 1XIEA 3OZPA 4NXSA 4HVXA 4ZB0A 4WK9A 3WFZA 3HQNA 1WZAA 3BSMA 2X2YA 4IPLA 3CMFA 4IH3A 3VX1A 1P5BA 3GVQA 7ODCA 1KGUA 4UWMA 5EMJA 1N7KA 2VD9A 4EK7A 1MYRA 3BAYA 4XBSA 2DZPA 1B90A 1UJQA 3D0CA 4MIMA 1XC4A 3USZA 3AS1A 3CZ8A 4UTTA 4XAFA 1KRMA 2QULA 2IPFA 3QW3A 3U0HA 3C2YA 4EAMA 1W3JA 2QCCA 4CNTA 4FXJA 1YPIA 1Q6GA 3L12A 1JDEA 2QCNA 3AHVA 4O57A 3UD6A 4YTTA 3DI1A 5M17A 3MYPA 4BEUA 2OSXA 3WELA 4C1KA 1QUMA 3PTMA 1HVXA 3BCDA 1UUOA 3GZAA 3T42A 1SO6A 4PMDA 2PRLA 5DBTA 1JNEA 4ERAA 3H22A 3TU9A 1I1WA 4AX7A 3N6HA 1EB3A 3O8AA 2QUMA 4UMAA 1HJXA 1N8WA 2XGBA 1XM3A 2V9DA 4JTLA 4US5D 4EF8A 4YHGA 6REQA 1OJXA 3DFSA 4O4VA 1VCGA 1DE5A 2MUCA 1FTXA 4N4QA 4YVXA 4K1GA 4CQCA 1IGSA 1QVBA 4O13A 5FESA 1KXVA 3FKRA 2EKCA 3C0LA 1VB9A 1JDAA 2WOQA 2ZWYA 3S1WA 4UOJA 4L6OA 1I2NA 3ARXA 5I3GA 4CU7A 4QJ1A 1SJCA 2ZQ0A 2PP3A 4H2HA 2VENA 3V75A 4JTJA 3E0IA 4PMZA 3ITGA 4Q3MA 1K8XA 2PDPA 2WW5A 3EPMA 3LMZA 3KHJA 5CPMA 1OX4B 4IIGA 1E1EA 1P43A 3V18A 2ZXBA 2GFTA 4ZL1A 2QEZA 5KSWA 2H9AB 4I5RA 1ITXA 2FQIA 2E68A 1C8QA 1XGEA 3EX6A 1J8VA 4C1NA 1QPKA 1HL8A 2ZRUA 1MI3A 3WF3A 1W1PA 3MVTA 3BLPX 3BW2A 5K4ZA 3UERA 4EXQA 4WKFA 3S5SA 2WNQA 1UZDA 4AB4A 2XFYA 4ZA0A 3Q2DA 4CU8A 1RD6A 2EO7A 3UJSA 3OYXA 1J9YA 4KBXA 4JFSA 5I07A 1Q66A 2XN2A 3GQYA 3UQNA 4IUGA 1KFEA 1TX2A 3BGAA 2O7QA 3QQ1A 1GTHA 1IGWA 3U8GA 2E28A 4YVVA 3AXIA 5CSUA 1RK5A 2I14A 5BU6A 4L9XA 2GK1B 1MW0A 1LROA 5FF2A 3GD6A 5JMUA 3IJ7A 2FZBA 2OPJA 3TP4A 2PLMA 1K8ZA 1G69A 3MMUA 3W27A 2ZZ6A 4F66A 4XB3A 4WVXA 2BHYA 2ZUVA 4GE8A 1F61A 3MP5A 2WK2A 3OHIA 1EPVA 4B3ZA 2O55A 1W37A 1KFKA 3ITYA 2D24A 4HPXA 3SCRA 3NZQA 3BTNA 5AHFA 3U2EA 4CQ8A 2W66A 3F4CA 3TE9A 4INFA 1CENA 2A4AA 3YPIA 2BVTA 5FAJA 4MJZA 2FPYA 3A22A 3OW1A 3S5NA 1BTMA 1JPKA 1M7JA 3T2PA 3UY7A 4PMXA 1XJBA 1QI0A 2BXYA 4GBUA 1F76A 1EQPA 1TWIA 3AO0A 3UZXA 5I3FA 1QPRA 4JFVA 3FA5A 3BLIA 1EP3A 3EX1A 1AJ0A 4RE3A 4NNCA 3L65A 3ZYZA 2F6XA 1V3JA 1C90A 4GVFA 5IM51 3WL0A 4A8NA 4WHBA 3M5YA 2ZZ3A 2RJHA 4MY1A 1JAKA 4LANA 1E9IA 3LTSA 2GOUA 1I60A 3MHUA 3H53A 4EXBA 1EF3A 1XIMA 5DEZA 5REQA 2A3HA 1DXEA 5FOOA 2DUZA 2VX6A 3QPZA 3IWPA 4PCFA 4CD4A 4JIIX 3TOPA 2FGLA 4E2OA 5FJOA 4K37A 4C90A 6CGTA 1Z8AA 4HK7A 1BF2A 3PFMA 1W8GA 1C92A 1H0IA 2HV5A 2FKPA 2GUYA 4LS2A 3S2MA 1E5JA 2DSUA 3KCLA 4PODA 1NWUA 1G4SA 3PSWA 4FLQA 3N1AA 3TYAA 2VFIA 2NUYA 4UR8A 4JNMA 5ABEA 3M64A 2P10A 4S3EA 4S3FA 5ABTA 1F3WA 3VUSA 4FNRA 2HE8A 1OINA 5E5CA 4ORIA 1JCYA 2Y0FA 4OUIA 1TTJA 4NJGA 3AZRA 2WO5A 1R38A 4FB7A 2ZVRA 3TSBA 3VINA 2PDFA 3NXFA 3P8IA 3S47A 2BGQA 1R87A 3WQCA 4IIDA 3S8HA 2WPGA 1VHNA 3PK7A 4A3HA 1JDDA 5XIMA 5KZDA 1QI5A 3URAA 1VLIA 4U3CA 5BCAA 4ATDA 2AMXA 3UPMA 1FHLA 3WBXA 4PMUA 2X2GA 3W83A 1UR9A 3DXIA 1GEQA 4XIMA 1T40A 2ACUA 3GVVA 3TYUA 2GVGA 3WNPA 4U31A 1UR3M 4ILSA 3CK5A 4ML9A 1VFUA 3S5OA 4G6CA 3OODA 2VFDA 2W62A 1F3EA 5M03A 2BY1A 3BURA 3UXAA 2D0GA 2HS8A 2NVAA 4PR4A 4AQLA 1OADA 3SZ8A 1E0WA 2VWTA 3SCOA 2DSVA 3ABZA 1OFRA 1W5OA 2ZIDA 1NAL1 4Z0SA 1K7EA 3CAKA 2EPLX 5CSYA 3BAIA 3O3RA 2BVWA 3T55A 4P7OA 2CHRA 3OLEA 2GQ8A 2PRMA 1FWIC 3BOFA 4HK5A 1Z44A 1G1YA 3DYPA 3UVIA 1XLEA 3CHVA 2PDUA 3GXTA 5CBJA 4LYQA 3F5KA 2XVPA 4C6PA 4GKLA 1W9DM 3W7HA 4DAFA 1OX6A 3MBDA 1MEHA 4R7WA 3TC3A 4E3TA 2HK1A 4U3AA 1H49A 1UWQA 1US3A 1PO9A 2VX4A 3JRKA 5GNZA 3VD4A 1BF6A 2C14A 2CLHA 4WJEA 1YXYA 3OQEA 2WZIA 1A5LC 1PTGA 4LUTA 4CD8A 1TFVA 4AZGA 4G7EA 5AC8A 3QMSA 2Z27A 5C9RA 1JAEA 1JZ4A 5KINA 3KTXA 3EOSA 1XV8A 3VNZA 2D69A 3L0NA 3DAQA 2FTWA 1FHVA 4P5UA 3TJLA 1JPIA 3CHDA 3URBA 1EIXA 2QCHA 3HPAA 3EX2A 2A1YA 2OO0A 1CXEA 4WQ6A 3SURA 3E96A 1TMQA 1PDYA 1MZRA 2V63A 4W8AA 4D6JA 3ZMRA 1HL9A 1UQZA 4GUJA 4FR6A 4E4PA 4TXEA 1W9BM 3N4EA 2CWNA 2HDJA 5G2HA 3GVGA 2VRJA 1J6OA 3KW3A 4D6HA 1UIPA 2C13A 4O53A 3VGHA 3TWAA 1IR1A 4FP1A 3NUKA 3MMWA 4YVPA 2X1SA 4HGXA 3MBFA 3DOPA 1WOAA 3BG9A 2GJLA 3QYQA 5FEPA 1Z7AA 3O0KA 2E77A 4LYRA 4MLJA 2NQZA 1O60A 4NZFA 2VP8A 4GY1A 1K77A 1QBAA 3EEZA 4GNKB 1Q2SA 4HNUA 3SGUA 1DJWA 3TTEA 4CCZA 2ACSA 3CB8A 1AVAA 4GI9A 3U2ZA 4ROQA 3KAOA 2BOEX 2CBIA 3UJ2A 4A3UA 1BTCA 2E6AA 5D9NA 3WL1A 4KRUA 2AKMA 3MCOA 5BRBA 3GM8A 3B0VC 2J77A 1MEWA 2JGYA 4MZYA 5D30A 4US6A 4NJJA 3OQ8A 3GU9A 3M0KA 5HR7A 1P1XA 3APTA 2BHZA 2C16A 4BF5A 4QM1A 4MUPA 4IIHA 4K8GA 5K3VA 3R58A 4AUBA 3EWCA 3AIQA 4DWSB 1D8WA 2YYTA 1BQCA 4D2JA 3O6AA 3EX3A 4NZJA 1C7TA 3DHFA 3CWNA 4HOXA 2HROA 1OF8A 1PTDA 3NSXA 3NG3A 5BZAA 3GDKA 4YTSA 1RBLA 1HGWA 3MW7A 4AVFA 1XHGA 3OYZA 3B9NA 1UC4A 1OABA 4GUIA 1V03A 1PAMA 3PBWA 4GO9A 3L5LA 3V36A 2QJGA 3SGZA 2XINA 3MUCA 3GW0A 2HE5A 3TCSA 3AJ7A 3QFEA 2DGAA 1X6LA 1JZ6A 2CKRA 4I5XA 1B5TA 2A3LA 1YKWA 4DJEA 1PX3A 4H83A 3W7CA 4YCPA 1P4CA 4PRTA 4J35A 2CEQA 1BHGA 5FL1A 2CZDA 3P93A 5HR6A 1TR1A 1H63A 3NOYA 1E5NA 3WH5A 3DESA 3E2SA 2YSWA 1C8YA 2HTMA 3P14A 3ALFA 3U7BA 5C9XA 4CQDA 4X2RA 2CNCA 2V3DA 3GHTA 4AYGA 3WD0A 1DIOA 4D6DA 3TR2A 2QUNA 1CDGA 1JUBA 2WVVA 4ZSUA 3U5UA 5JQ9A 2WVTA 4CNSA 1YHTA 2YCLA 5D03A 5CPOA 1FKXA 1WXJA 6PTDA 2FTYA 1POJA 2I56A 1WQ5A 4B15A 4JTKA 2V5LA 1J96A 5C9ZA 4A21A 2CXEA 3PJUA 5JIWA 5E70A 3TNBA 4UTKA 1IWBA 3WQDA 2YL5A 2Z7KA 5AOUA 4M1BA 3KS6A 3OHMB 4PTWA 4O52A 4G7FA 2DJLA 4AISA 1JCTA 4KEVA 1YYAA 2XYLA 1J11A 4NG3A 4WDWA 5CPNA 5EMYA 2ISDA 4HJWA 4WLCA 1XCXA 5ECVA 1GOMA 2G50A 3O1NA 4JPGA 4H19A 2DIEA 3W2UA 5D2VA 2DY3A 2PDKA 4KCWA 1BVZA 4BQ5A 4ATLA 4OE7A 4GUGA 3SW6A 4JD4A 4PEKA 3WUGA 1A3HA 3QF0A 3TW6A 3KDNA 4DPQA 2VR2A 4GACA 3SECA 5DMMA 3B9AA 1R2SA 3HGSA 3IUIA 3KE0A 3LCHA 2J9XA 5BNKA 4DBSA 3RMJA 3ZLGA 5E9XA 3CEPA 2W9MA 5DY2A 3LTPA 3WFLA 1JCLA 2R14A 4AU0A 4O1AA 1CGTA 4KEUA 1IEQA 5I00A 4J3WA 2EF9A 1F3XA 1CLXA 5IHRA 4OWGA 5HMSA 5LA2A 4K8HA 4EACA 2A6NA 2D3LA 1S5VA 3AZTA 3VGDA 4AXNA 4Y8FA 2WWCA 2Y62A 4WOQA 3NVTA 3R5EA 3QEZA 3KBMA 3LQGA 5HINA 7PTDA 1EO7A 3NQDA 1W56A 3IVTA 3NO1A 3IIOA 2XH0A 4F0KA 3VOIA 4GYKA 2QS8A 5E1QA 3B0PA 2NX1A 4JTUA 3PB0A 4H01A 2ALDA 1IWPA 1PCKA 5JH2A 2WXDM 2V82A 2YXXA 1JQVA 4PBEA 2IKIA 1G9HA 2R8WA 1Q85A 4WD0A 3PZOA 4XAYA 4JYEA 4JS3A 1XUZA 3N2OA 5TIMA 5BXSA 3KOZA 1V8EA 1RUSA 1OBAA 4LVDA 2CLPA 3LCGA 2AL1A 3RCMA 4JTAA 3UG8A 3DUGA 3GC5A 1XLDA 2J75A 2OYKA 2FFCA 3QH2A 1ICPA 4MKVA 1GVRA 4UMCA 1B1YA 1RCOB 1P7TA 2Z0IA 1E0UA 4GZ7A 3KRZA 4AIEA 2PODA 3HMJG 4YJ5A 2VRQA 1V0NA 1FFQA 1LG1A 3M0XA 1JZ3A 4NRRA 3LTYA 1UB3A 3UXDA 1Q63A 2HJPA 1O68A 3F4DA 3W73A 2FLIA 3QZAA 3E0FA 5FJPA 4B9ZA 3W1RA 2QCGA 4Q4MA 2XGZA 3A9IA 2I7GA 4ICNA 4UQBA 2IKJA 1AZ1A 3NL3A 4LB4A 4NT0A 4H4IA 1TJ0A 3HBLA 3AXXA 4J40A 1W5NA 1I2OA 3W7GA 3GG0A 4O0QA 4W7VA 4Y2WA 3NGFA 3EB2A 4C5ZA 4C6NA 5A8PA 1L8NA 2Y5JA 3UYIA 3DG6A 3TOYA 1QOPA 3QKEA 4F0HA 3PBMA 1LL6A 1UYQA 1EF2A 3RG6A 5A8GA 2PS2A 4PUUA 4NP7A 1XFCA 2XUCA 2YCJA 5H91A 4V27A 3VIOA 3ZLFA 5F2IA 3IJ8A 4OV9A 3KRSA 3QFWA 1SGJA 3C3NA 3L21A 3VKKA 2NZLA 4LB3A 2YL6A 2JQXA 2X1IA 4XZHA 4IIEA 3FLUA 4C6CA 2W63A 4DWSC 4CEXC 3L67A 5HK4A 4Y90A 2VKZG 4UTFA 4GHRA 5LGZA 5LNUA 2XM2A 2PLCA 3PZTA 3VFCA 4PN2A 3QXBA 5LYRA 4QQUA 3PF3A 1T96A 3P7YA 2ICSA 3AHZA 4WDTA 3LY0A 1P6BA 2WSKA 4JYDA 4AZCA 1UP3A 1S38A 4LY4A 4DWDA 3AYVA 3FN9A 3Q45A 1EEPA 3EWXA 1VPQA 4IGSA 1KM3A 2YR1A 4ENLA 3LENA 4O1EA 5E0CA 3TTSA 2ZXAA 3BSGA 1RALA 2DT2A 3DFTA 3KBNA 2O7SA 4MFDA 1YXCA 4MLRA 5T9CE 4DO6A 4GYPC 4M5PA 1A47A 1FWSA 2XH7A 3WN6A 2E6FA 3T8LA 1MW1A 1Q7MA 4LH8A 5FF4A 3UG4A 4LCQA 4QQ3A 3TTOA 4IT1A 1J0YA 3LERA 2Z1WA 5CBBA 1RXOB 3MANA 3H55A 3ONBA 2XN1A 1F9CA 1TWWA 1W1VA 2B7OA 1OGGA 1UWAA 5BRPA 1KM0A 4HCDA 3AXMA 2ISFA 4PA8A 4H8UA 3W2NA 1FWBC 1ZBVA 2QDGA 2OJPA 1O95A 4B2DA 3CTLA 1R9XA 3GBDA 3PVFA 2QGYA 3UXKA 1QPOA 1UR4A 4J9JA 2NXIA 1UWIA 2ZXQA 5MKGB 1PIFA 1D3CA 1GPWA 1K02A 5IDIA 4PMRA 1EXBA 2UY5A 4YHEA 1LF1A 3CZJA 3E6EA 1OZQA 1A50A 1CEOA 3FYYA 1DP0A 2D2OA 1IXPA 2ZE0A 1PUDA 2JKPA 1JULA 3A47A 4O50A 3G22A 4LCRA 1NDVA 1G7UA 4AEOA 3DERA 1K9TA 4XK2A 4TOQA 1ZJIA 3PPFA 3WNOA 3TYCA 2RHGA 3TLLA 3DGBA 1JQXA 1E6ZA 4IXHA 4UZUA 2PD5A 3SQMA 4LEFA 2R91A 3SAZA 1TUFA 3OEXA 5DXXA 2HCVA 1M3UA 2O9PA 1YBQA 3V0TA 2CU0A 2GPTA 3APGA 5F7UA 2PC4A 2B31A 1UWSA 3W87A 1W5MA 3VIHA 4L6DA 5A6BA 3CC1A 3V16A 4GQRA 2Z2AA 3FXYA 1JEZA 4MMWA 3HGOA 3ANYA 1XP3A 4GMEA 1QU4A 3GIPA 4J2MA 3W38A 3NQ6A 4CD6A 1AJ2A 1UG6A 1PZ1A 3MV01 2EAWA 4WR3A 2XVNA 2VNCA 3QBUA 1H61A 4MKNA 2ABBA 3IJLA 4PMQA 1OFPA 2NLYA 5FL0A 2NSXA 3TSDA 1BVWA 5LNVA 4XKYB 4BY3A 3TFCA 2GWNA 3C8NA 1LWHA 2PDXA 3TN5A 3B3DA 5F4SA 3ZT5A 3ZSTA 2WANA 4HYWA 3ZR4A 3CEUA 4MB4A 5G5IA 2NV2A 2YKKA 4HNLA 3FS2A 3VDHA 2J9ZA 3CQKA 2OKTA 4GIYA 2V68A 5K9CA 4NXKA 2D0HA 1XLGA 1P1MA 3ZIZA 1Q45A 4Z1BA 2OSWA 2VL4A 3OTRA 1JD7A 3OIHA 1Z48A 2O56A 1O6IA 3RLHA 3RPMA 1YE6A 4NIRA 3AALA 3PSVA 1K70A 4KWWA 3QOKA 4F79A 1PTAA 1K4HA 1WKFA 3GDBA 2NV9A 4UTTC 3G6LA 1AD4A 3RLVA 3NPVA 5C2XA 4B91A 9RUBA 1H7NA 1AZ2A 3HG2A 4NYYA 4QLKA 3ARWA 4XVEA 1HXJA 4ZFCA 4D72A 3GYEA 4C6FA 4UTIA 1GHRA 1UP0A 2NVCA 4Z2JA 3WY1A 2WC7A 4CNPA 5K7JA 3SSJA 2YBVA 5EMUA 1H5VA 2HNEA 3KZSA 1TVPA 5HJYA 2OT1A 2DZBA 2FMOA 3WDRA 3EWZA 2QYGA 2P8BA 1X1ZA 2QCDB 1SUXA 3KCJA 3PTQA 3JU2A 1X97A 1ZFJA 1SFTA 3VU2A 1LLZA 1KLZA 3GR4A 1D7FA 4N42A 3NR0A 1GJWA 4UBPC 1TTQA 4RZ6A 1KQZA 1WP6A 4F8XA 5JXQA 1GOOA 1TPDA 2W0UA 2VDGA 1IEWA 1TE1A 4N0RA 3U4AA 1XBYA 2WQDA 2BP1A 2GVYA 1F6KA 4EVZA 1H1YA 1WCGA 1UW9A 2F6KA 3ZM8A 4RNFA 5GJPA 3AU6A 2J9YA 3QR1A 2DDXA 3TYZA 2E5CA 4DJFA 3IUHA 5EA9A 4EE9A 4Z1AA 1YX1A 2GSJA 4NZCA 2ZFAA 4H2CA 3AS3A 1UZHA 3OVRA 4XAZA 3S9IA 3CBWA 2Y8VA 4UQAA 4ZENA 1IZJA 1RK6A 5D38A 1TVNA 2W6RA 3LI0A 3N34A 1TMHA 4AZBA 6XIAA 1E9YB 1NFGA 2Q6ZA 4LUSB 5G4EA 4IMDA 4GRSA 2WZHA 5DBUA 1R46A 1EZWA 3WUBA 1A0DA 1TJPA 4QJ3B 3WQEA 4UTHA 4UOZA 4D1IA 2H8XA 3TH6A 1HX0A 4MNKA 1XH0A 2HWGA 1EBHA 3USBA 3VOHA 2QAFA 3R25A 4IG2B 4M0XA 5E0FA 4BHYA 3W7EA 1CBGA 3VD9A 4PCPA 2Z24A 4KW2A 4L80A 3QYSA 5KITA 1W9VA 2X16A 5MHBA 1EKOA 2CCRA 1NP2A 4XUGA 1XLFA 1S3HA 1NH6A 3V35A 4RXGA 5CLWA 4PUDA 2VURA 3UR8A 3ITXA 3ZVHB 2WAGA 1UD3A 1M5WA 2F61A 4BA0A 5D2WA 4MVAA 3OVGA 3PBYA 3SADA 4TMBA 1U1HA 3W23A 3VGGA 4BR1A 4JQ4A 1TSIA 1DWAM 1YTKA 3VC5A 2WM1A 2Q8XA 4AW7A 4RLIA 4OFCA 3SDOA 2WCGA 3HG5A 1TG7A 3RMEA 4JQ3A 3HFYA 2B7QA 3R8RA 3DZ1A 1XF0A 2RH9A 3RRAA 4DM1A 4RPPA 1KCZA 1DWIM 2QJHA 4PMOA 3TXZA 3TONA 1TJ2A 4TIMA 2HNHA 3HQPA 1UMLA 1VRXA 3RAOA 1UD8A 1YDOA 5FJUA 1CLKA 4UNLA 4KKXA 1Y5WA 1LLOA 3P3BA 5BMXA 3O6DA 5AYXA 4GQQA 4GI6A 2IQDA 4QLJA 3MKKA 3QM3A 4JYFA 3WENA 5HATA 3QTGA 4JKKA 4RE4A 2XIBA 2ZKMX 3FGCB 4QFUA 1XGDA 3U6WA 4FLSA 1B9BA 3TR9A 3DHPA 1FCVA 1EA9C 4OZOA 3I6TA 2QPSA 2VFHA 4HP5A 3E74A 1IXOA 5D37A 3AUOA 4TX8A 5J5RA 2GVLA 4BEQA 2DVTA 3NQMA 2QW5A 1W91A 2H90A 2XJ7A 4ADUA 2C7FA 1VEOA 4FK9A 4TQTA 2Y7FA 2ISVA 1LZOA 3GLCA 4NZ5A 4GXMA 5BMWA 1FOBA 3WMLA 2OLHA 1CCWB 2ACRA 1W9XA 4F0LA 1TPEA 3CZKA 5C0QA 1OZMA 3NEVA 3PAJA 4FX6M 1XQKA 3LHUA 4NZ1A 2BXVA 4LVBA 1UPMB 1BEUA 4P8VA 4OUEA 1DQUA 1EH9A 2F7FA 3MI2A 4F2UA 1Q4WA 2EHHA 4TO8A 1YIXA 3UZZA 1T0OA 5EMMA 3MA8A 1FP9A 2FTPA 4UTMA 2VQUA 1OFDA 5T26A 3KVJA 3VOGA 1VFOA 3OZYA 2QPUA 2CBVA 3LK6A 4A29A 3WJWA 3MP4A 1UWRA 1K9DA 1R0MA 1KWGA 3K4DA 3VNLA 1P6CA 1LBMA 4C6LA 1NWRA 2E1WA 4M82A 5C54A 1VFSA 4J2PA 1EX1A 1ISYA 1M04A 3NQAA 3W7LA 1X8FA 2CZEA 3IIPA 1Q7ZA 3PC0A 1JZ5A 5AFDA 3AJXA 3CIXA 1S1RA 2PDYA 4XZIA 1QFEA 2UY3A 1JFHA 1A5NC 2PWUA 4MKSA 4AEFA 5LA1A 1TPC1 1QR7A 3OLDA 5DQPA 1OSEA 1GVFA 1VPYA 4DBEA 4CN1A 3T0BA 1R3SA 3G77A 2CZ5A 1GOQA 1PKLA 3QHMA 3TQVA 3CGTA 2DPEA 2Y8UA 1XPGA 5K4XA 4PMVA 1EC7A 2OOFA 3EPOA 1EOMA 3D46A 2Z4GA 3E5BA 3N13A 4AHPA 1W17A 3W88A 2WZTA 4FR1A 3WNKA 2V3FA 3BMWA 3TW7A 3WDJA 3ABSA 3V5CA 1TJ1A 3POHA 1VFMA 1NDWA 3CUXA 3QLLA 5HPCA 2PGFA 3DH7A 4MWAB 1RQBA 1M03A 3LBOA 3SGGA 3VKDA 1FBAA 3JW7A 1JPHA 2E25A 3C0QA 4UCGA 4KCUA 4NAFA 4WSKA 4JTEA 3CV2A 1UH3A 5FI8A 5I2UA 4RR4A 4K8EA 3VA8A 2IS7A 4ML4A 4B16A 2I17A 3EXTA 1TPUA 4JL2A 4H9UA 3WO8A 1EP2A 1JXJA 3CNYA 5SWUA 4CEUC 4F9DA 3CU2A 1XPYA 1V6WA 4GXPA 2CHOA 1EA0A 2WBKA 4R5EA 4ZB2A 1TPWA 4EXAA 2BBFA 3H4WA 1PBGA 3CJPA 1TWDA 1EL3A 2ZA2A 4Z42C 4M3PA 1KXQA 2REQA 1E72M 4ZO7A 4HSOA 2QZRA 1UH4A 4RW3A 1WOBA 2X41A 4FZIA 3G1SA 2QVHA 2RAGA 2FGZA 1FWJC 1N8FA 1OFAA 3W1MA 4AYSA 2VGIA 3WD3A 4O11A 1K4GA 1NOFA 4O54A 3T4WA 5C71A 2WBGA 4AIOA 1QPQA 5IFPA 3WLKX 1A3WA 1XLJA 3GNPA 1C91A 2FHCA 3A12A 3TK7A 2WCSA 4MF4A 1I8JA 4JNYA 3EB3A 2WMJA 1YNQA 4F0RA 1G4EA 3GHRA 4WY0F 2C8NA 1G7VA 4OBTA 4UQCA 3PS7A 3WLOA 3NM1A 3DFYA 1WZLA 5B7YA 4BF9A 1NJJA 2PLJA 3STGA 2BWGA 4E6MA 3VXGA 4AC7C 3SBFA 2I9UA 1LQ2A 1B30A 1H1NA 4GWEA 1R3WA 4REQA 1AK5A 2KAUC 2AQVA 1TREA 4LAMA 2QJJA 4HNVA 2BTMA 3IV3A 4EWJA 5DO8A 5I3KA 2VEIA 1X96A 4C6BA 1RPXA 5AHNA 1MUMA 1QNRA 2TRSA 4JX4A 1E1CA 1FFRA 3NVDA 1DIKA 4JHZA 3NQEA 3TA9A 1VFFA 1M01A 3NSMA 3GG7A 1UASA 5XINA 2FPVA 3F5JA 1H7XA 1WDQA 4OQVA 2OFJA 1Z6KA 3CYJA 2OZTA 4WXZA 4LVAA 1E73M 5CAHA 3QV6A 2DZWA 2OQYA 2OYMA 3WH8A 2O9RA 4XAPA 4DJED 1UKQA 2A3CA 4N9CA 1BD0A 2ADAA 4OVXA 2ZYFA 1P0NA 2EG8A 3CMJA 5GNYA 2EPHA 5ECUA 3C2EA 4A2RA 1V6UA 4UR9A 2DH3A 4H3DA 3VILA 1AMYA 3U48A 4K36A 3MP3A 3KWXA 4M6PA 3LLXA 3CUGA 3WCZA 3WNNA 1JZ8A 5BOFA 4JIRA 4ICCX 4DF2A 3UWQA 4PC8A 5HUPA 3W7IA 4H9XA 4LU0A 2VD8A 1X39A 4M29A 3IGXA 1BWLA 3A21A 3LI1A 2OWWA 1ZJBA 1E43A 4IISA 3UZYA 3F4NA 1W9PA 2NX3A 1BXBA 4GC3A 4Y9MA 4LRTA 4CNUA 1J0ZA 3G1FA 3JS3A 1SFSA 1V3IA 4JCLA 4AIBA 1OC6A 3RR4A 3W86A 2I16A 1FDJA 1RSCA 3TFXA 1TYGA 2V3GA 4JX6A 3ZSSA 3OA3A 3C0JA 4UTUA 1RBOB 2IUZA 1MSSA 3QZEA 3E5PA 3BLOA 3PUOA 3PWGA 1CNVA 1CWYA 3DC0A 4KMQA 1GVQA 1TV8A 3QPEA 1JF6A 4KWUA 4NAFB 2Z1VA 3PBUA 2YYUA 4XBJA 4C6IA 2R1KA 3V1HA 5JBDA 1GQIA 1T99A 4LSBA 1ITQA 3M46A 4B5WA 2QCFA 3UWEA 1LG2A 2FH8A 3VFLA 5MKGA 4L56A 3SCWA 3SJ3A 3GTXA 4B92A 2CITA 1CX9A 1A4MA 3BG3A 3LA4A 3TYEA 7TIMA 4L61A 1YTDA 2NW0A 4N02A 3PTKA 2ZTJA 1Q65A 3NOEA 1W8SA 2V67A 3M5VA 5TAOA 3RJYA 5KZ6A 2XISA 2GDUA 4IQDA 4PULA 4QAIA 1K8YA 5CG0A 1KQYA 1BFNA 1JGIA 3M0JA 4R3UA 5FJTA 4FLOA 1H50A 2EQDA 3WLNA 3W2KA 2P76A 4LF2A 1AD1A 3IJDA 2QT3A 2XSXA 1DIDA 1IEVA 1EGZA 3LMYA 5CGQA 4QX4A 1P48A 5FEXA 1RAKA 3D47A 5A6TC 3TDFA 3H2MA 2F2KA 2VRKA 1NEYA 4GYJA 3CWOX 1BXNA 1H62A 4RNJA 1ZQ5A 2XTKA 1V3LA 5KETA 2CLFA 3L68A 3MMDA 4HA4A 4X0VA 4PL2A 2QGHA 4S39A 1JFXA 1XRVA 4NHVA 1FP8A 2JEPA 4C7GA 3EDEA 1FWHC 1JDFA 2V5CA 4DLMA 3QSRA 3WEZA 3WBEA 4NAEB 1IHIA 4QE5A 3UJFA 4G1NA 3R13A 3UGRA 5ABHA 1R9YA 1PX8A 3K8LA 2WQPA 5FIPA 2NV1A 1TWZA 3IEBA 4YCOA 4DUVA 4LFYA 4HHLA 2FIQA 3H12A 2VJXA 2VFEA 5AHLA 4B5VA 3MHFA 1O1ZA 3WYZA 4DZHA 1GG1A 3INPA 3AICA 1HP5A 3WNLA 4LBUA 4DYEA 4DO5A 3WQ8A 3R10A 1I9CB 1XLLA 4LV9A 9XIAA 3SUSA 3W7KA 4W84A 1DBTA 3MCMA 3Q67A 3L4WA 4UFLA 4XBKA 1DE6A 1GZJA 1Z89A 3UR5A 2TPSA 1AODA 3DCPA 1ZPTA 1CXFA 4XSLA 4HNCA 1DJIA 5DFAA 4LYKA 3T0AA 1YDNA 3CL7A 3W1QA 1S2CA 3AIWA 3IVUA 2PDLA 1V3HA 3DX5A 4C65A 4BQ4A 1O94A 4GQ0A 1OX5A 4PFMA 1F4HA 5CZKA 2ZCGA 1GPFA 3N15A 2VZVA 3GXPA 4S3AA 1ELSA 1SMDA 4Q4SA 1UD2A 3TJIA 1E6SM 3ZO9A 5BW6A 5CJMA 3TX9A 5I77A 1VJSA 2YDSA 4PUEA 1XX1A 1WZMA 4JTHA 3MUY1 1UPPA 4FIRA 4GK8A 2HEJA 4GH1A 2KZHA 1EGMA 3THQA 4R53A 4MY8A 1V7AA 1HKVA 4PCTA 1KNWA 3W84A 5E0KA 3G6MA 5I24A 5DLCA 4Z08A 3N4AA 2NX9A 1F6YA 4LOCA 4MJ4A 5CKSA 2GVEA 4X60A 1OCBA 3U4FA 2A79A 4HA3A 1W3NA 4FNUA 3VMOA 1ZL1A 1J4EA 3VPLA 1H3GA 4ROPA 3QW4B 2OEMA 4DLFA 1Z3NA 3I6EA 4FX8A 4YL2A 1QNVA 3TIMA 1FUYA 1VJZA 1PIIA 4JEJA 1E4LA 3ABOA 3BCJA 4W93A 1H51A 3ITTA 4ZBCA 4D8AA 1BKSA 2XPKA 1YPFA 2BY0A 4TV6A 1GVSA 3L2IA 2PP1A 3FFSA 1WBHA 3BJTA 5IFTA 6TIMA 1FXPA 1H60A 4LS0A 5D4YA 3FEQA 4O16A 1X6UA 2HVNA 4DWSD 5AKQA 2HVMA 4FF5A 1J2BA 3PNUA 1SJBA 3FVMA 4HZ7A 4E8CA 3HIJA 1J0IA 3LPOA 1EJSC 3GTIA 3M16A 2ZRWA 3W29A 3T07A 4KPLA 5FD0A 4JR5A 4DF1A 1XYMA 1E1FA 6REQB 4FMVA 3AOFA 4E4UA 1BPLB 2PCQA 5D9OA 3BLEA 1ICQA 5AHMA 1LWIA 3OOQA 3URNA 1LP6A 3ARQA 1LM1A 1OT2A 1GCYA 4LX4A 1V3KA 3N73A 2P0IA 4ZR8A 3R43A 4PMJA 5CC5A 3T4CA 3NO3A 3FDKA 2VQTA 4I8YA 2GSEA 3WFAA 3KWSA 5G2WA 3PAOA 4KWVA 2D2GA 3WK2A 1E56A 1CB7B 4ALDA 1DWJM 1WAUA 1RLCL 3FJNA 7ENLA 2QPXA 1DQWA 1TA3A 4S3DA 3NPWA 4M24A 1W1YA 2BSLA 5AVNA 4Q4OA 2WC3A 3O6YX 2WV8A 3I6RA 1JRCA 3CZGA 2PTDA 1JPDX 3QLDA 4HTBA 3DBPA 2E9LA 1REQB 3REQA 5M1TA 1D2KA 3SN4A 1BLIA 5BROA 3PR2A 3WZ0E 4HOWA 3H2OA 1QRQA 3NCOA 3RM9A 4DI8A 4AF0A 4PL1A 2PRHA 3TA6A 4RV8A 2NLIA 3G1DA 4PCSA 1W2VA 5GJMA 3FA4A 4B5NA 3RYSA 4AY7A 4MPKA 1JCXA 1AQ0A 4A2SA 3PPCA 4JTCA 2I5GA 4ZVJA 3GTHA 5EMKA 4DJDA 4MG4A 3AUJA 4KF1A 1GGOA 4CLMA 1QCWA 2VZUA 1F8MA 1FH7A 2YB4A 6ALDA 2D0FA 3KLKA 4ZOAA 5I78A 4J7RA 3NPUA 2YA0A 4LAKA 1F74A 2GDQA 3AWNA 4JCMA 2PC8A 4RNHA 4ZQMA 3KHDA 1EJXC 4S3KA 4O0ZA 4JAWA 2BVDA 5GPRA 5K2ZA 1H7OA 4S2BA 4QG9A 3NSNA 1GK8A 4FALA 3OBKA 2GOKA 4O15A 5C5YA 3H6OA 1IIGA 1KBKA 3DN5A 1SZRA 2G96A 2FMNA 1XSJA 3AIUA 4QS5A 4ZZ9A 1OG0A 4AWUA 3AC0A 1ZBKA 2H3BA 3LNMA 4JZ5A 1LRTA 3N19B 4NF7A 1LDCA 3I65A 3WDHA 1RJQA 2Q3OA 4DNMA 3I4EA 2OYLA 4X3ZA 2DSWA 1TV2A 1MZHA 4S3CA 3C5QA 2P5NA 1JF5A 4O1DA 5I06A 5L6UA 2E67A 1F6PA 4M8UA 2OG9A 2YZRA 3DG7A 3SQLA 2C71A 3F4WA 1Q6FA 2CERA 4YU1A 3ARUA 1OCJA 3TROA 4Z0JA 1EDQA 2BDQA 2F6UA 5F1UA 1R8LA 1PDZA 1C3FA 5AYBA 4QE1A 5U7SA 3WDPP 3APYA 4QE4A 5XIAA 3KX6A 3K8KA 5LNRA 1P7TB 4HCHA 3VNMA 1E71M 3RR1A 1VGAA 1QNOA 2RUSA 3RXZA 3TEVA 2XN0A 3OG2A 3U2OA 3SY1A 2P53A 1EHAA 4HHPA 4D6GA 4Y9AA 4CCCA 4BI7A 1GQKA 1R86A 2ONEA 3EEGA 1B2YA 1OK4A 2BOFX 4E5TA 1RP8A 2UY2A 3M0YA 1POKA 2PDCA 1KTBA 3S83A 1XDMA 2BNJA 4QCEA 4UTJA 4Q32A 3AQUA 4IQLA 4L65A 2PWGA 5HULA 2Y6ZA 3FKKA 3M4HA 1UQYA 2C0HA 1KKOA 2Z29A 4ZOBA 3ABQA 5A69A 4PRRA 3OJGA 1E4NA 2Q01A 4W85A 1M68A 1ICSA 1XIJA 4WIWA 4DYKA 3R8GA 2HXUA 3BV4A 4PZVA 4GKTA 1HZYA 1UKOA 4PB4A 3O2LA 4H00A 4AZ6A 3L66A 1OB0A 5E93A 4KT2A 2IXVA 3NM3A 5TQLA 4ACYA 3P60A 5D8WA 2W79A 4X0NA 1UR2A 3ZQ9A 2DZAA 3S6OA 1IIHA 2C19A 2ISWA 3A4JA 4NAEA 4BWLC 4IQEA 1WBJA 1X8CA 4K6AA 3MTWA 4MOZA 3M0IA 3RU6A 3K4WA 1X98A 2O4MA 4L9ZA 4MFEA 2EPMX 3NDZA 1TVLA 1UBPC 1MEIA 4H41A 2WJFA 3ZT7A 4V33A 4CNOA 5A6JA 4P7LA 2QF8A 3KOXA 2HK0A 3VIKA 1KBIA 2GJRA 4LT9A 3W2JA 4H1ZA 3HV8A 3SUVA 3QV9A 2CESA 1NP0A 2NQ5A 3WLMA 3NXLA 3AXHA 2V38A 3PG8A 1JPMA 5M2FX 2YBUA 3BK0A 4QLLA 1FWFC 4IMCA 3I68A 4ZQNA 1DVJA 1AA1B 3TJ4A 2ISSA 1D8CA 4AIUA 2C6QA 2FZ9A 4UMBA 4D8LA 2ZBTA 4TTUA 5BYWA 2BOGX 3MUAA 2G97A 2IQTA 4BI6A 2Z6JA 3WIJA 3AXKA 3FOKA 2V5JA 2A7PA 4H7CA 5HMDA 3R6IA 1I45A 3PULA 3UGVA 3FGCA 4GBDA 1DWFM 2PTZA 3W75A 4TX9A 1RVKA 3EA2A 5TD4A 2WZEA 1VYPX 3PFRA 3ABRA 4ZQCA 1KCLA 2J7HA 4JQ2A 2GWGA 3G5EA 1ENUA 2YCEA 3P8JA 4RNIA 3IS4A 1A5AA 2CLIA 4UR7A 4O1BA 3GX9A 4K3ZA 1B3XA 4HQVA 2DFAA 5LKYA 3SIZA 3VUPA 5A3HA 5LIUX 2PZNA 1PYFA 4NVTA 4IUOA 2V30A 1H4PA 1A5MC 3E38A 4ZB5A 2A7RA 3A64A 4IMGA 5EGRA 1J0HA 1J01A 2WMIB 4RUBA 5BRQA 1XLMA 4WRHA 4O0KA 3B40A 4PMNA 1X6NA 1AL7A 3L9CA 2E09A 3A3HA 1E4MM 2PDGA 5FACA 1HW6A 1AH0A 2Y61A 4Z2KA 4TVCA 2XVLA 3R12A 1ZY9A 4JY8A 2G4JA 3NIYA 3B8IA 2E5DA 3LBCA 3HPFA 4IM4A 2V5KA 2D2HA 3ITCA 4W8BA 4HZ6A 3WMBA 1QMLA 1C8VA 3PJWA 4QNWA 3HMCA 5EL1A 2XU2A 4E8DA 4Y96A 1PKNA 2DU2A 3GH4A 2CBUA 4XTDA 3DEQA 2HS6A 3CV7A 1R9ZA 4GO8A 3H7VA 1HJWA 2JGQA 4M7SA 4B2DD 4CUCA 4ZTXA 3UCDA 5I03A 1XYFA 2QR6A 1JI2A 3LGDA 3L5AA 2EG6A 1TCDA 3H54A 1TKKA 4YNGA 2Q71A 5AN7A 4Q4QA 2INFA 2TSYA 1HQTA 3TQKA 1J12A 3ZJ7A 4MWAA 5D2XA 3RIKA 4RZ4A 2GJXA 2V69A 4NSBA