3SJ8A

Crystal structure of the 3c protease from coxsackievirus a16
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
179
structure length
179
Chain Sequence
LDFALSLLRRNIRQVQTDQGHFTMLGVRDRLAILPRHSQPGKTIWVEHKLINVLDAVELVDEQGVNLELTLVTLDTNEKFRDVTKFIPETITGASDATLIINTEHMPSMFVPVGDVVQYGFLNLSGKPTHRTMMYNFPTKAGQCGGVVTSVGKIIGIHIGGNGRQGFCAGLKRGYFASE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C protease
publication title Enterovirus 71 and Coxsackievirus A16 3C Proteases: Binding to Rupintrivir and Their Substrates and Anti-Hand, Foot, and Mouth Disease Virus Drug Design.
pubmed doi rcsb
source organism Human coxsackievirus a16
molecule tags Hydrolase
total genus 34
structure length 179
sequence length 179
ec nomenclature ec 3.4.22.28: Picornain 3C.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sj8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sj8A02
2QF3A 4K1EA 2QA9E 1O2HA 1O3JA 1FNIA 1PQAA 4A5TS 2QIQA 1FY5A 2H1UA 1GHBF 1O5EH 1O2PA 1GHYH 3A82A 3GY4A 4YOIA 3IITA 3MU1A 3SHCH 1J8AA 5FX5A 1K1JA 3E6PH 2PWXA 4AFQA 2XCNA 3QDZB 4K8BA 1UCYK 2B5TB 1SG8B 5E2OA 1WAYB 1C1PA 1GI4A 2SFAA 2D8WA 3LGYA 3STJA 4RSPA 1ACBE 5A0CA 1TNJA 9ESTA 3S7KB 3RXHA 2RA3A 4PROA 4UFDH 1TX6A 3NKKA 3ZZ6A 5EGMA 3PO1B 1XKBC 3EGKH 3SV6A 3TIUA 3MO9A 1TRNA 1VITG 1FPHH 4NZQA 3V13A 3KHVA 1O0DH 2ZU2A 5CMXH 4WJG2 2QY0B 1L1GA 3SBKA 4BTTB 1G9IE 3GY3A 3SNAA 2AMDA 1OWDA 3H7TA 1C2FA 3VB5A 3RM0H 2H2ZA 1GHAG 1OKXA 3BSQA 4NSVA 1ZTJA 3TNTA 6CHAC 1AVWA 1W0YH 3LGIA 3RXJA 4ZHAA 1DLKB 1IQFA 2HGTH 1D3QB 2QCYA 1MAXA 4UE7H 4U01A 4NWKA 3NK8A 4NSYA 2BLQA 2W3KA 3P6ZB 2ANKH 1L0ZA 3DT0H 3PWBA 4MNWA 3A7WA 2OXSA 3MU0A 3VB3A 4A92A 4ZKRU 4D7GA 5GCHG 1SVPA 1BT7A 1J17T 1VR1H 2FI5E 3RMMH 5JB9S 2XBVA 1YPGH 1T4UH 3T26A 1ZRBA 1NO9H 1XXDA 1MTNB 2UUFB 3L6PA 4TY7A 3M5LA 3M5MA 1SGCA 3TJUA 1V2OT 1UK4A 1BIOA 1GMDG 1E36B 2BM2A 1CHGA 3QK1A 4NFEA 4KTCA 2GV7A 1O39A 3MU8A 1A46H 3AW1A 1YPJH 4Y79A 1Y3XA 3BTTE 4MPVA 4B2AA 5DK1A 1V2RT 3P8GA 3U8OH 1V2NT 1C2KA 2LNCA 2Z9KA 1FN8A 3U69H 1F2SE 2AGIX 1ELFA 1DITH 1DT2A 4JYVH 1VGCB 1RGQA 1O5DH 1Y3YA 2B0FA 3WY8A 2AYWA 4E06H 5K0HA 1UCYE 4K1SA 4X6MA 4J2YB 3MFJA 4GLYA 2VGCC 1CHOG 2FOCA 3RXSA 3ZVDA 1G3DA 1AI8H 5EPYA 2FOGA 2Z9LA 2J95A 1OP0A 4YZUA 1TGBA 2EI6A 5DG6A 2J38A 4YT6H 1LKAA 3E90B 2P3UB 3RXPA 1N6YA 3TNSA 1HIAB 3HKJB 3FVFB 5TCCA 3SJOA 3ZZ4A 2ZGCA 2AGGX 3LGUA 2CJIA 1UTLM 2PHBA 3KQBA 1BMNH 4Q7YA 1FQ3A 3FZZA 2PSYA 2JKHA 5AF9H 4AYVB 1KDQA 2B9LA 1RXPA 1T8OA 3ATIA 1EJNA 2ZTZA 2J9NA 1Z1JA 1BMLA 1L1JA 4DJZB 1S84A 1UTKA 1KIGH 2ZHEH 1GBJA 1TAWA 3SJ9A 2ZPSA 3RXTA 1HPGA 1ANBA 3T29A 2BY9X 2TGPZ 4JZDH 1HFDA 3UNSA 1AWFH 1C1VH 4YT7H 6CHAB 1WOFA 2UWLA 3TJOA 1H8IH 3GCHC 3RXGA 3VGCC 4F4OC 2F3CE 3L33A 2ZQ2A 4IN1A 3Q77A 2STBE 2ZP0H 2ZO3H 3CENA 1ARCA 1C5QA 3BTWE 1TX7A 1MH0A 5EU8A 3VB6A 1AVXA 4AG2A 1ETTH 2Z6BD 4K2YA 3RP2A 2GCHG 1XVOA 1Y59T 3A7XA 3V7TA 1OX1A 5LPRA 3M7UA 1KXAA 1BMAA 1TX8A 3KIDU 3UQVA 1QBOA 3QGJA 4FUIA 3VPKA 2WYJA 5EW1H 5GXPA 1CGHA 1HAZB 2ZG0H 3P8FA 4IMZA 4YLQH 2H5CA 1GBTA 2G55A 1V2WT 1A0HB 1L2EA 1FZZA 2FX4A 4U30A 2BDYA 2DE9A 3RU4D 1UHBB 1UTPA 1XUHA 3E8LA 1ELCA 3TPIZ 4NA9H 3A85A 1XUGA 2GP9B 1TIOA 1V2UT 3BIUH 3RXAA 3A89A 3E91A 3Q3XA 1OYTH 1KSNA 3O8RA 1TMBH 1RTLA 2ZDNA 2VVVA 1UJ1A 3SOSA 4I8KA 3K6YA 1C2HA 1ELEE 1O2GH 2RG3A 4ISIH 1GMHF 3GCTF 1V6DA 1C5OH 2VIQA 1EXFA 4IC6A 2UWOA 4ESTE 1ZLRA 2CF8H 1BBRH 2ZCHP 1A0JA 1ANEA 1PQ7A 2BXUH 3BTHE 1TPSA 2OCVB 1XKAC 3HGPA 1L4ZA 3TK5A 2HNTE 2FLBH 2QV1A 2TPIZ 2R9PA 1BDAA 4ABHA 1EQ9A 3HPTB 1P9SA 1FY8E 1PYTD 3RMLH 4FUFA 3S7HB 8KME2 4JK5A 1GL0E 1ZHRA 3A84A 2ZGJA 1C1MA 2GT7A 1WV7H 1TE0A 4H42U 3AASA 5EXLA 2FI4E 1A3EH 3M3TA 4Y7AA 4CHAC 5GIBA 3LH3A 4HI3A 1BJVA 1HAHH 3ATMA 2BD3A 3UNQA 1D6WA 1GJBB 5ETXA 1W8BH 1UK2A 3FP7E 9LPRA 2CF9H 2WPLS 4IMQA 3MH5A 4ISOA 2YNBA 3RLWH 3RXOA 2SNWA 1OYQA 2WUBA 1QQUA 3SGQE 1HIAA 2ZDAH 1QTFA 3S9BA 1E37B 1TWXB 1S5SA 2BXTH 1BTHH 2PUXB 1FJSA 2A32A 1SGPE 4X1SU 2BMGB 1IQLA 5IYTA 5C5NA 1QIXB 3P92A 3URDA 5A0BA 1O3MA 1ZJKA 2FPZA 1PFXC 3RLYH 1TMTH 2ZHQH 2ZTXA 3BTFE 3UIRA 1PQ5A 2A7CA 3ELAH 3SUFA 1LPGB 1OWEA 1C1SA 3R0FA 4ZMAH 1NFYA 2ZFPH 1SHYA 2K1QA 1QHRB 1GJCB 4O3TA 3VGCB 1FONA 3UR9A 1NFUA 2D2DA 4WMFA 4AGKA 4TWYA 5JPMH 1QJ7B 4GPGA 1VCQA 3TGIE 1LMWB 2SGPE 2HALA 7ESTE 1ZHMA 5L2ZH 3KEEA 1JXPA 1GDNA 3HK6B 3LGVA 4B73A 2XXLA 3ODDA 1C5NH 1IQHA 4MDSA 3ZZAA 2V3HH 3F1SB 1GBHA 1UO6A 1GI8B 2BDIA 3LC5A 2XYAA 1D4PB 2ZC9H 1MTWA 1EZUC 1W10U 1ABJH 1TPPA 2FYRA 1CGJE 1KLTA 1A2CH 1AZ8A 1EB1H 5L6NH 5GJ4B 3SNBA 4IC5A 1GGDC 2WPJS 1Z6JH 1V2LT 4X1NU 1A5GH 1EPTA 1GBCA 1QL8A 2P3TB 5A8XA 3MMGA 1SGEE 2AMQA 3FP8E 3EA8A 1BITA 1S6FA 2XBXA 2FOAA 2AFQB 1OWJA 1GI9B 2W26A 2ZDLA 1ZJDA 1S81A 4ZXXH 1L4DA 3SU4A 1BHXB 2BX3A 3QZRA 2AIPA 1ELAA 3E0PB 4MQAA 3M5OA 2SNVA 3SI4H 2XCFA 3K6ZA 2VIDA 2FLRH 1GI5A 4BXWA 1THRH 1FIWA 4Y76A 2WV4A 2GDEH 2BDBA 5EQSA 3W94A 2C8WB 1OXGA 1A1RA 3NUMA 3LOXA 4UEHH 2FOFA 4X1QU 5JBCS 2NWNA 1GBDA 3T62A 4NFFA 1ZYOA 5DP6A 1TA2A 1TGSZ 2W7SA 3MO6A 3TJNA 4R8TB 2JETC 3MU5A 1UTQA 1C5ZB 1JIRA 5FBIA 4DGJA 2UUKB 3S9AA 1K28D 4J1YA 3ZYDA 4INHA 1BQYA 1K1IA 4YTAA 2P3FH 2FM2A 1A7SA 2BZ6H 4D9RA 1C2IA 2ZHDA 7GCHF 2BD2A 1F7ZA 4FU7A 1DFPA 5DGJA 1C5MD 2G52A 4AFZA 3O8CA 2FOMB 1LPKB 3PMAB 4BAQB 1SQOA 1HJAB 3Q00A 2GMTB 2Y82A 1PQ8A 4ABAA 1U6QA 3U1IB 1O2JA 2PGBB 2VNTA 1FAXA 4FVDA 3MNCA 3UOPA 3A8DA 2IPHA 1IHTH 3TGJE 3ZVEA 1P2IA 4K5ZA 2AGEX 3GISB 1O3PB 2F9VA 5C1YA 2BY7X 1LVYA 2AMPA 3TH2H 1HB0B 3SI3H 2EI8A 2GGVB 2CXVA 2PUQH 3AAUA 3HATH 1AUTC 5F8ZA 3E16B 3LONA 4TY6A 2QXJA 2I6QA 4Q2KA 1OP2A 4XBDA 1GMHG 1ELGA 4UFGH 1GVZA 2W5EA 3MHWU 3LU9B 2ZGHA 1TNGA 1RS0A 4DOQA 1YCPM 2J34A 1OSSA 4AGJA 2Y6TA 1F92A 2ZFFH 2VJ1A 3S9CA 1GGDB 1ETRH 1HV7A 1O2IA 1G2LA 1BRUP 3ZZBA 1FV9A 2AH4X 1SL3A 3NPSA 1C5VA 1C1NA 1ESTA 2PKSC 2TGTA 1MTUA 3QTVH 4BANB 1BRBE 1HDTH 4A1XA 3TH3H 2G81E 1BTPA 1T31A 2F9OA 3KCGH 4KKDA 4UONA 5EQQA 2A4GA 3QX5H 3ZVAA 4B71A 2A31A 4GAWA 1DWDH 4AX9H 3NWUA 1JRTA 4Q7XA 1QURH 1P0SH 2UWPA 1ZTKA 3BTGE 2R2WU 4MNYA 3SGBE 5SGAE 3BTKE 2QXIA 5F8XA 1EKBB 1Z8JB 5I46H 1MQ6A 2VH0A 3M5NA 1F0UA 1O3GA 3RXQA 1ELDE 3DD2H 3A8CA 1KTSB 2A4OA 2OC1A 3RC5A 1WQSA 1UVPA 2HPPH 3D49H 1CVWH 1K1MA 4FUCA 4YESB 2ZEBA 3ENSB 1UK3A 2F83A 2ZIQH 2JETB 2OBOA 5FPSA 2R3UA 2VU8E 3M35A 6GCHG 3PROA 1SR5C 4DW2U 2ANWA 5T6DA 2JH6D 1MKXK 2FIRH 4RN6A 1AU8A 2G5VA 1UVSH 3UWIA 5FXLA 3W95A 3T5FH 1Z8IB 4NA8A 1CGIE 5JB8S 2ZI2H 4FUHA 2XWBI 3U8TH 4X8VH 5T3HA 1RD3B 1O33A 3KGPA 2FEQH 5EQRA 1LTOA 1HJ8A 5JBAS 2XBWA 1VCPA 3E1XB 4FUBA 2CHAB 2FXRA 1TPOA 2VWOA 1O31A 3SHAH 1DANH 4ZHLU 5E0HA 2R0LA 4WWYA 4M7GA 1V2TT 3LH1A 4ZAEA 1SQTA 1D6RA 2P16A 2FOBA 3M3VA 1UTNA 3P17H 1DY9A 1C9PA 1MKWH 2R3YA 3GY6A 2Z7FE 8GCHF 2EI7A 4BNRA 1GBAA 1J15A 1SI5H 1F5RA 1O5GH 2IJOB 5C1UA 3MI4A 1DWEH 5AVDA 4SGAE 3PMHB 4ABFA 3QLPH 3NXPA 5EPNA 3SGAE 1DUAA 1GVKB 2CN0H 3OYPA 3HK3B 5FPTA 2AS9A 4MVNA 4GCHG 3GCOA 1TBZH 4CRGA 5C2ZA 1THSH 1K1LA 1TONA 4CH8B 1P03A 2ZU1A 3LPRA 1GMCF 1ZSKA 1AFEH 4AYYB 1YCPK 2O8TA 3I29A 2A5IA 3LJOA 1O30A 1AFQC 1Q31A 2BLOA 4ABBA 2OC7A 2VIWA 4Z6AH 1NZQH 2PKSB 1ZPCA 1G3BA 1DX5M 2WPKS 2ZFRH 3RMNH 1RIWB 1ZGIA 2PTNA 1P04A 1NROH 4B74A 3ZVGA 1C5SA 2ULLA 2SGFE 3UNRA 2BDCA 4ISHH 4DG4A 1A61H 3A80A 4HGCA 1YPLH 3GDUA 3RXVA 5LGOA 4KELA 1QL7A 4X8TH 1ESBA 3NCLA 4OS7A 3BTME 4NGAH 3D62A 1SLWB 1WCZA 3RC6A 1WQVH 3BTDE 1P3EA 4DVAU 1BHXF 1WSSH 2A5AA 1E0FD 1S6HA 2RA0A 4WXVA 4Y71A 3SU0A 3VXEH 5A8YA 2FTLE 3SU6A 3A81A 1KXCA 5J4SA 1GJ8B 2O8UA 2PGQB 3CS7A 4WF8A 1TBRH 3M36A 5JYIA 3PLBA 5L30H 2GDDA 1DOJA 5AFZH 1IQNA 3TGKE 1O2WA 2NU0E 7LPRA 1TQ7B 1F0SA 1SFQB 1O3CA 2FODA 3EQ0H 1IQIA 3HKIB 4OS2A 1WBGB 1F5KU 1RFNA 3QUMP 3SV7A 2OBQA 4YM9A 4QT8C 1KTTB 1AKSB 1B0EA 3A7VA 3JZ2B 2OC8A 2ZCKP 2XTTB 3FANA 2C8XB 1GHXH 5E8EH 1MAYA 3LT3A 1JMOH 1C1UH 2A1DB 4X8UH 2KAIB 2QN5T 2ZFSA 1FPCH 3A8BA 1GBEA 2G8TA 1TNHA 1AO5A 1NFWA 4E05H 3H7OA 4FVBA 1C1RA 1O2ZA 1CA8B 1TA6A 1GG6C 1NESE 1NRPH 3ZYEA 5BPEA 1UTJA 5C67A 4RKJB 2ZHFH 3ESTA 1TABE 4Y0ZE 2O8MA 3ZZ8A 1TNLA 2ZHWH 1JIMA 2FOHA 2Y5FA 4Y11E 4JZ1A 1T8LA 3SUDA 3UR6A 1AE5A 1TGNA 1GCTC 1RTKA 3GDVA 3BN9A 1D3TB 2B7DH 1G30B 2A7HA 1MMJN 1S82A 2XRCA 3TH4H 5JBTA 1IQMA 4KTUA 4A1TA 2DUCA 5HM2A 3RXEA 1P2KA 1P57B 1P9UA 2RCEA 1BRAA 1VJ9U 2BZAA 3PTNA 4WVPE 4XDEA 4YLUA 1AFQB 1OOKB 3MWIU 2GVFA 1S85A 1TPAE 1K9OE 4KGAA 1CT2E 3GY5A 1GHBG 1O2TA 1ZMLA 3F9FA 4R0IA 5TJXA 4MLFB 1TB6H 1TYNA 2Y5GA 3PWCA 1QB9A 1GI6A 1HRTH 5E0JA 2ALVA 1IQEA 3Q76A 1BUIA 1DWCH 1XUFA 1EP5A 4FU9A 2VGCB 1O2VA 5T6GA 1O3NA 2FS9A 1SGFA 2QXHA 1C5PA 2D26C 1JWTA 1XX9A 2BVSH 3FAOA 3A8AA 2LPRA 1W14U 2ZWLH 1Q3XA 1C4Y2 1KXFA 1UCYH 1C9TA 1TQ0B 1CBWC 1QY6A 2ILNA 3GDSA 2C4FH 1VCWA 1YPEH 1QB6A 3MNXA 1AHTH 3T28A 5I25A 3QWCH 4AB8A 2GT8A 3FFGA 1DXPA 2A2XH 1B7XB 1GCDA 5CHAC 1HAOH 4A7IB 1GL1A 1GI1A 3QZQA 1MCTA 5F6MA 5BRRE 3SU2A 3BV9B 1ZSJA 4HFPB 1GBFA 1LHEH 3SJKA 1TRYA 3A7TA 2ZZUH 1BRCE 1Z7KA 1P02A 1NPMA 4WMDA 2V6NA 3RXKA 1V3XA 3SQHE 8ESTE 1PPEE 1C2EA 1M9UA 4CH2B 4TWWA 2PW8H 1DWBH 1QCPA 2OD3B 4X1PU 2VIVA 1BCUH 3UPEA 2DE8A 2Y7XA 3PV4A 2GCTC 4FUGA 5LPFA 3LIWA 3GCHB 2G51A 4Y8YA 3OY5U 2WUCA 1TGTA 3TLOA 4THNH 1O2RA 1C5XB 5F03A 1P2OA 1AKSA 4I8HA 2W7UA 5J4QA 2H5DA 1GG6B 3M7QA 1TFXA 1QRZA 2UUJB 1T8NA 5HM9A 2Q6DA 1O3HA 3TK6A 4UD9H 2VB0A 4KP0A 4UFEH 3RC4A 1C5TA 1ELTA 1QL9A 3BEFB 3KN2A 1VITF 1QA7A 3EDXB 5LPEA 1K1NA 4I31A 4DY7B 3MTYA 1CSOE 1C5UA 2Z9JA 1GMCG 1O36A 3K9XB 4TYDA 3SU5A 3A88A 2G5NA 1W0ZU 1GHAF 1Y5AT 1O2QA 3QN7A 4UDWH 3UY9A 1EJMA 2V0BA 3GOVB 2J4IA 4MTBA 1O3FA 1T7CA 1ZOMA 1IQKA 2BDAA 2SGDE 4WH6A 4INLA 2AIQA 2SGEE 1GI3A 1EUFA 2BQWB 3UOUA 1THPB 4X8SH 2SGAA 1P11E 2J2UA 1UHBA 5HMAA 4Y7BA 1XXFA 1ELVA 1O3EA 5GCHF 2ZCLP 1MU8B 1C2MA 2ZU4A 1TOMH 1NC6A 2HWLB 1TGCA 3FZDA 1QJ1B 4X2XA 5FPYA 1XVMA 2H9TH 4IGDA 5L2YH 5DP9A 4UFFH 5K7RA 1DXWA 1O2KA 1KY9A 3ZZCA 3KNXA 1ZSLA 1CT0E 1RJXB 3MOCA 3F9GA 1G3CA 2FX6A 1GI2A 2OINA 3O8BA 5DPAA 1SBWA 3E3TA 3ZVCA 5ABWA 3PMBB 1HBTH 1AN1E 3P70B 1ARBA 1CQQA 4CHAB 2EEKA 1TLDA 2BOKA 1EAXA 1YPMH 3RXDA 4NCYA 5EW2H 4ZUHA 3F68H 1O5FH 4O03A 5CHAB 1TOCB 4I8LA 1QGFA 2ODPA 1ANCA 2WPHS 5EOKA 4ABDA 5G4BA 1O3AA 4A6LA 2FI3E 4XSKU 1O5BB 5A8ZA 2P94A 1TBQH 2BY6X 2FP7B 3GCNA 1DY8A 1A5HA 1HAXB 1AMHA 1T8MA 2Y81A 3K2UA 4FU8A 1J14A 1O3LA 1CHOF 1FY1A 3VEQB 1WTHD 1TNIA 2G4UA 2YNAA 4ZH8A 3TJVA 1Q2WA 1P8VC 5B6OA 1UVUH 3RXFA 1GI0A 4OS1A 1F0RA 4YOJA 1E34B 4E7NA 1UVTH 1AVGH 1ZR0A 1O3IA 1HAYB 1LCYA 2NU4E 1C5WB 1SGDE 2ZDVH 4AN7A 1NN6A 1LHDH 1TMUH 2A45B 4MPXA 4D7FA 1NS3A 2BX4A 3N7OA 1D3DB 3SO3A 2ZDMA 2YOLA 1YBWA 2XC5A 1NRRH 2TGAA 4JZEH 1K22H 1KXDA 1PPGE 2OQ5A 2I6SA 2ZFQH 5T6FA 1H8DH 1UTMA 4CREA 3GY7A 4O9VA 5PTPA 1ZPZA 1DM4B 4I7YH 1DDJA 1K21H 1Z71A 3DUXH 1QR3E 1V2QT 2D1JA 1P10A 1J9CH 2ZGXH 3GCTG 4B75A 3AAVA 1PYTC 1G37A 2NU3E 1G2MA 1ZRKA 2UUYA 3DHKH 1Z6EA 3UUZA 1N6XA 1DS2E 1QRWA 4ISNA 1SGYE 1QRXA 3A7YA 1EASA 4TPIZ 1YKTA 3SW2B 5C1XA 2GCHF 1LVOA 2GV6A 1SFIA 1AQ7A 3EA9A 2FZZA 2Z3EA 1GJ7B 1O37A 1EZXC 4U32A 3M7TA 4F49A 2R2MB 4WMEA 2BVRH 1V2ST 4OGXA 1DICA 2FS8A 1BTZA 2P59A 4H6SB 1O2OA 3TITA 3ZZ3A 4AG1A 3ZZ5A 2BY8X 2GX4A 3MNSA 4CBOA 4BXSA 2ZPRA 1KXBA 2CV3A 5EODA 1L1NA 5FHTA 1C2GA 1EP6A 4K8YA 1QBNA 2PFEA 2QGRA 3SNEA 3ATLA 4I8GA 1FN6A 1O35A 1BBRK 1SLVB 2J92A 3RMOH 5C3NA 1H1BA 4ASHA 1C4U2 2BVXH 1H9HE 3VFEA 4CRDA 1QNJA 3ZZ7A 1HAGE 1KLJH 2BHGA 1OWKA 3P95A 4BAOB 1QFKH 4MPWA 5FCRA 3V3MA 4AORA 3GY8A 1WTGH 1CE5A 1KDQB 1PPBH 1ETSH 2Z3DA 3HGNA 1ZMNA 2BTCE 2IOTA 1IQGA 1HCGA 3PMJA 3SNCA 1O38A 2VWMA 4BTUB 1Y3WA 3L3TA 2OUAA 5FAHA 3ZV8A 4Y8XA 1SGTA 2H9HA 2P95A 2QF0A 4AFUA 4O3UA 2HRVA 3VB4A 4CRBA 2ZKSA 1LQEA 2ANMH 1GI7B 4TPYA 2QYIA 4WY3A 4GVUA 1ZMJA 1LHCH 2PLXA 1EB2A 1O2LA 1W13U 1GJ9B 1P01A 4D8NA 3R3GB 5FCKA 1AB9C 4NIWA 1W2KH 4K3JA 2Y7ZA 4B2CA 4WH8A 5DO4H 1X7AC 5GDSH 4CRCA 3OSYA 4BAMB 2W3IA 2BLWA 3AVZA 1SOZA 1NY22 2OTVA 1HGTH 5EXNA 4INKA 5ESTE 3KQDA 1Z8GA 1EZSC 2FWWA 2THFB 3EA7A 4DT7B 1SHHB 4FUDA 3U98H 1O3KA 1JOUB 1S0QA 2F91A 2Z3CA 3PM3A 4XOJA 3PYHA 1GHVH 1GPZA 1J16A 2Q6FA 1Y3UA 1LPZB 4FXGH 1XM1A 1W12U 1C5YB 4ABIA 1G3EA 1N8OC 3D65E 1W7GH 5TCAA 2QAAA 1SLUB 3OU0A 5E2PA 4JMYA 3SJIA 3UFAA 1BTXA 1FMGA 2PV9B 3SN8A 4XFQA 1W7XH 2JH5D 1YC0A 1SGFG 4RKOB 1G36A 4Y0YE 3B8JA 5JBBS 2V3OH 1S0RA 1HAPH 1EPTC 5FBEA 2P93A 2HVXA 4B76A 2WYGA 2FO9A 3TVJB 2VH6A 1XMNB 2A0QB 3TU7H 1BBRE 3G01A 2F9NA 2ZQ1A 3S0NA 1KXEA 1VJAU 1SGIB 1PPFE 3EAJA 1GBBA 1EATA 1LQDB 2GZ8A 3A86A 5CE1A 4CBNA 4LK4A 3FP6E 5C20A 2WPMS 3STIA 1ABIH 1FAKH 3KQCA 2BY5X 1A3BH 2OP9A 3OY6U 1FUJA 3CP7A 3E0NB 2C90B 1NTPA 1FLEE 1AD8H 1HAIH 4HZHA 3SNDA 4X6NA 3S69A 1JRSA 1GJ6A 2V35A 1YGCH 2Z9GA 2CMYA 3I78A 2VIOA 1YLCA 1EAWA 2GTBA 2OC0A 3KL6A 4K60A 4BOHA 4CRAA 2H6MA 3PLKA 3MO3A 4YOGA 1P05A 7GCHG 1UMAH 5A09A 1ESAA 1MQ5A 1ORFA 3SV9A 1P2JA 2NU1E 3BG8A 1P2MA 3F6UH 1NM6A 3BG4C 7KMEH 2A4QA 4JYUH 1Y5BT 4VGCC 3BIVH 1C2JA 1CU1A 2B8OH 4I8JA 4X0WU 2BOHB 3T25A 1MUEB 2BD8A 2ODQA 1GBKA 2OLGA 4BAKB 1PPCE 3ATKA 4IS5A 4DURA 3U1JB 5GPIB 1C1TA 1EJAA 1ZHPA 2BQ6B 3VXFH 3IWMA 5F8TA 1EZQA 1AB9B 5GWZA 1HJ9A 1ID5H 3SU1A 1LVMA 1AY6H 3GYLB 4BAHB 3T2NA 4ABGA 4B1TA 1TRMA 1GHZA 3CS0A 1NU9A 3KF2A 5HXFA 1HXFH 2PTCE 3RXUA 6LPRA 1V2KT 3ZVFA 1OWHA 1O2NA 3MYWA 3RU4T 4FUEA 4NZLA 4JZIA 1UVOA 1O3BA 1NU7B 4NIYA 5DKMA 1YP9A 2A4RA 2GZ9A 5C5OA 4ABEA 3RUOA 4GHTA 1GBMA 2BB4A 2Q1JA 4AOQA 3KQEA 1MTSA 3P8OA 1N8OB 3OX7U 2TRMA 1ZPBA 2ZU5A 1MBQA 3K65B 4GSOA 1YPHE 5A2MH 2BD5A 2J94A 3VB7A 3DA9B 3M61U 1LKBA 1E35B 3TK9A 1HXEH 4ZHMU 1WUNH 4AB9A 1ZZZA 1SGNE 2QXGA 1BZXE 1T32A 2A7JA 2QC2A 4JCNA 1MU6B 1BB0B 2OQUA 3GY2A 5DP7A 2ZGBH 2TIOA 3RXRA 1CA0C 5DP5A 1EPTB 4X2VA 1JBUH 2ZU3A 5H4IB 3V12A 2NU2E 2R0KA 3DFLA 1NRNH 1FY4A 3QGNB 5IDKA 5DP4A 1FXYA 1PPHE 4Y8ZA 2G4TA 2BD7A 1A4WH 1FI8A 4OS4A 1DSUA 1W11U 1ELBA 3RXIA 1O2MA 1DLEA 3OTJE 1MTVA 1P2QA 3LDXH 4Q7ZA 4X2YA 2RDLA 4X6OA 4ZKOU 4XBBA 1FDPA 4FUJA 1O3DA 2VIPA 1CT4E 3ODFA 2F9UA 2Y80A 3RU4E 1O2YA 2Y5HA 2BD9A 1SSXA 4NWLA 1YF4A 5DP8A 1EX3A 3SORA 3EE0B 2BDHA 2WINI 4A1VA 1C1QA 3RXCA 1GJDB 1RRKA 3EYDA 2VWLA 3UQOA 5FX6A 2ZNKH 1BOQA 1HYLA 3LJJA 1O32A 1QB1A 1SPJA 1G32B 1C4V2 2AEIH 2FMJA 3A7ZA 1OP8A 1MKXH 2BQ7B 1GBIA 1O5CB 2GKVE 4D9QA 4CRFA 2BLVA 2PKAB 1GDQA 3SJ8A 2C93B 3JZ1B 4JK6A 3BG4B 4ZXYH 2Z9IA 4H4FA 4H6TA 1DSTA 1SC8U 1YYY1 5E0GA 4GUXA 4VGCB 3MH7A 1P3CA 3MNBA 2BD4A 1WYKA 1KYNA 1T4VH 4U2WA 1BA8B 1FIZA 1AWHB 1WU1A 2XBYA 4E7RG 1MBMA 2VVCA 3QO6A 1O2XA 2PR3A 4OGYA 3SUEA 2VINA 2PSXA 4DIIH 1OS8A 1GVLA 8GCHG 2C8ZB 1GJAB 1QA0A 4XE4A 3F9EA 1ZGVA 1GBLA 3Q3YA 2WV5A 2XC4A 3V0XA 1SB1H 3M3SA 3ZV9A 2TBSA 4SGBE 3ZZDA 1OPHB 1LHGH 1IQJA 2F9BH 2STAE 6GCHF 2HLCA 3C1KA 2BYAX 2HNTF 2FOEA 3BTEE 1B5GH 2KAIA 4GHQA 5AFYH 1F0TA 1LDTT 1O3OA 3SU3A 1SOTA 4LOYH 2Q6GA 2M5TA 3SQEE 1INCA 1GCTB 1HJAC 2GMTC 1H9IE 3A83A 1K2I1 4BTIB 2ANYA 1AUJA 3DFJA 1C1WH 1FY3A 1SQAA 1LHFH 2AERH 3IG6B 4AZ2B 5HGGA 3C27B 1AE8H 1K1PA 4YO9A 2ZDKA 1SGRE 1A5IA 1HAVB 1MKWK 1P06A 3MU4A 1K1OA 3T27A 1YCPH 2ZPQA 2FTMA 4LZ4B 3LC3A 1W3CA 5EXMA 3RXBA 5JDUB 4AFSA 1Y3VA 1YM0A 1NRQH 3BF6H 3SZNA 1CA0B 4Z0KA 2JH0D 3URCA 4LZ1H 2CGAA 2P8OC 2FYQA 3ZZ9A 1H9LB 3B9FH 2ZTYA 1EAUA 1MD8A 4ZKSU 4ZKNU 2FESH 1KLIH 3SV2H 4HTCH 1SLXB 2SGQE 4I33A 8LPRA 3D23A 4KTSA 1BJUA 3UWJH 3GYMA 1V2VT 3MH6A 2TGDA 1AGJA 1A0LA 1BTUA 3LGTA 1DVAH 3A87A 3LKWA 1GMDF 1AIXH 1DUEA 2BDGA 1GDUA 1O5AB 6ESTA 1IAUA 4IW4E 4GCHF 1CBWB 1SGQE 2XW9A 2H9EH 1YPHC 3ITIA 2ESTE 1Y5UT 1NRSH 1NFXA 2ALPA 3SV8A 1NT1A 5DJ7A 2G00A 3LGWA 4ABJA 4DIHH 3UREA 4NA7A 4OS5A 1GHWH 1DPOA 1C2DA 5LH8A 2O9QA 1DE7H 3PB1E 2ASUB 2HOBA 4IN2A 2XC0A 1OWIA 1Z1IA 2ZECA 4I32A 3PTBA 3Q3KA 2XWAA 1EOLA 3U8RH 2GZ7A 1PPZA 1IOEA 3AW0A 1VITH 1IHSH 3RXMA 1SMFE 3ZVBA 2HPQH 1HLTH 4O97A 1V2PT 1Y8TA 1GJ4H 2EA3A 4WXIA 3RDZA 2EC9H 4Y6DA 1BTYA 1MZAA 2GCTB 5HYOA 1C5LH 2A5KA 3PO1C 1F5LA 2F9PA 2ZF0H 2C3SA 1PJPA 3BEIB 1AZZA 1HNEE 1BMMH 2PKAA 3ATWA 1RTFB 1QQ4A 2XNIA 1QBVH 2HNTC 1EAIA 4Y10E 5AHGH 4K69A 2GD4B 1E38B 2IN2A 2VVUA 1BTWA 4CR9A 1H4WA 1MZDA 5ESBA 1UTOA 4ZROA 3SUGA 1O2SA 1XUIA 3H5CB 2CHAC 4NIXA 4X2WA 1S83A 3PLPA 4MPUA 2ODYB 3QTOH 4K1TA 1ANDA 3NZIA 1O34A 3GICB 2O8WA 1O2UA 5DP3A 1GWAA 1P12E 1N1LA 4Q80A 4X6PA 1D9IA 3BEUA 1LO6A 1MD7A 2ZA5A 2O8LA 3F9HA 4JZFH 1GJ5H 3O8DA 4ISLA 1C5RA 3B23B 1C1OA 4B2BA 4DCDA 1HUTH 2FDAA 4MG3A 1B0FA 1MCVA 1MTNC 4JYTA 1YPKH 3M37A 1QJ6B 4XBCA 1VZQH 1HAVA 1D3PB 2P8OB 3BTQE 1LVBA 3I77A 1C2LA 1YLDA 4MNVA 3RM2H 3RXLA 1V2JT 4CR5A 5A0AE 1Z8RA 4IBLH 4D76A 2WPIS 1V2MT 1XUJA 1XUKA 2Z94A 3P8NA 1P2NA 1TALA 4NIVA 1ZTLA 2A2QH 2C8YB 4MNXA 4OS6A 1P09A 2VWNA 2ZFTA 1CO7E 4X1RU 1EOJA 3MH4A 3U9AH 4NG9H 5EG4A 1TNKA 1RIWC 1VGCC 3UTUH 4LXBH
chains in the Genus database with same CATH superfamily
2QF3A 4K1EA 2QA9E 1O2HA 1O3JA 1FNIA 1PQAA 3FKSD 4A5TS 2QIQA 1FY5A 2H1UA 1GHBF 1O5EH 1O2PA 1GHYH 3A82A 3GY4A 4YOIA 3IITA 3MU1A 3SHCH 1J8AA 5FX5A 1K1JA 3E6PH 2PWXA 4AFQA 2XCNA 3QDZB 4K8BA 1UCYK 2B5TB 1SG8B 5E2OA 1WAYB 1C1PA 1GI4A 2SFAA 2D8WA 3LGYA 3STJA 4RSPA 1ACBE 5A0CA 1TNJA 4RI0A 9ESTA 3S7KB 3RXHA 5KEDA 2RA3A 4PROA 4UFDH 1TX6A 2EY4C 3NKKA 3ZZ6A 5EGMA 3PO1B 1XKBC 3EGKH 3SV6A 3TIUA 3FOAA 3MO9A 4FETA 1TRNA 2WPDD 1VITG 1FPHH 4NZQA 3V13A 3KHVA 1O0DH 2ZU2A 5CMXH 4WJG2 2QY0B 1L1GA 3SBKA 4BTTB 1G9IE 3GY3A 3SNAA 2AMDA 1OWDA 3H7TA 1C2FA 2AHME 3VB5A 3RM0H 3OEHD 2H2ZA 1GHAG 1OKXA 3BSQA 4NSVA 1ZTJA 3TNTA 6CHAC 1AVWA 1W0YH 3LGIA 3RXJA 2F43B 4ZHAA 1DLKB 1IQFA 2HGTH 5FL7D 1D3QB 2QCYA 1MAXA 4UE7H 4U01A 4NWKA 3NK8A 4NSYA 2BLQA 2W3KA 3P6ZB 2ANKH 1L0ZA 3DT0H 3PWBA 4MNWA 3A7WA 2OXSA 3MU0A 3VB3A 4A92A 4ZKRU 4D7GA 5GCHG 1SVPA 1BT7A 1J17T 1VR1H 2FI5E 3RMMH 5JB9S 2XBVA 1YPGH 3F2HA 1T4UH 3T26A 1ZRBA 1NO9H 1XXDA 1MTNB 2UUFB 3L6PA 4TY7A 3M5LA 3M5MA 1SGCA 3TJUA 1V2OT 1UK4A 1BIOA 1GMDG 1E36B 2BM2A 1CHGA 3QK1A 4NFEA 4KTCA 2GV7A 1O39A 3MU8A 1A46H 3AW1A 1YPJH 4Y79A 1Y3XA 3BTTE 4MPVA 4B2AA 5DK1A 1V2RT 3P8GA 3U8OH 1V2NT 1C2KA 2LNCA 2Z9KA 1FN8A 3U69H 1F2SE 2AGIX 4Q63A 1ELFA 1DITH 1DT2A 4JYVH 1VGCB 1RGQA 1O5DH 1Y3YA 2B0FA 3WY8A 2AYWA 4E06H 5K0HA 1UCYE 4K1SA 4X6MA 4J2YB 3MFJA 4GLYA 5HIYA 2VGCC 1CHOG 2FOCA 3RXSA 3ZVDA 1G3DA 1AI8H 5EPYA 2FOGA 2Z9LA 1UW7A 2J95A 1OP0A 4YZUA 1TGBA 2EI6A 5DG6A 2J38A 4YT6H 1LKAA 3E90B 2P3UB 3RXPA 5EJZA 1N6YA 3TNSA 3N7EA 1HIAB 3HKJB 3FVFB 5TCCA 3SJOA 1E1QD 2ZGCA 3ZZ4A 2AGGX 3LGUA 2CJIA 1UTLM 2PHBA 3KQBA 1BMNH 4Q7YA 1FQ3A 3FZZA 2PSYA 2M2AA 2JKHA 5AF9H 2K0QA 2LP6A 3PRBA 4AYVB 1KDQA 2B9LA 1RXPA 1T8OA 3ATIA 1EJNA 2ZTZA 2J9NA 1Z1JA 1BMLA 1L1JA 4DJZB 1S84A 1UTKA 1KIGH 2ZHEH 1GBJA 1TAWA 3SJ9A 2ZPSA 3RXTA 1HPGA 1ANBA 3T29A 2BY9X 2TGPZ 4JZDH 1HFDA 3UNSA 1AWFH 1C1VH 4YT7H 6CHAB 5KGOA 1WOFA 2UWLA 3TJOA 1H8IH 3GCHC 3RXGA 3VGCC 4F4OC 2F3CE 2RFKC 3L33A 2ZQ2A 4IN1A 3Q77A 2STBE 2ZP0H 2ZO3H 3CENA 1ARCA 1C5QA 3BTWE 3U28C 1TX7A 1MH0A 5EU8A 3VB6A 1AVXA 4AG2A 1ETTH 2Z6BD 4K2YA 3RP2A 2GCHG 1XVOA 1Y59T 3A7XA 3V7TA 1OX1A 5LPRA 3M7UA 4YXWD 1KXAA 1BMAA 1TX8A 3KIDU 2WHXA 3UQVA 1QBOA 3QGJA 4FUIA 3VPKA 2WYJA 3FO8D 5EW1H 5GXPA 1CGHA 1HAZB 2ZG0H 3P8FA 4IMZA 4YLQH 2H5CA 1GBTA 2G55A 1V2WT 1A0HB 1L2EA 1FZZA 2XOKD 2FX4A 4U30A 2BDYA 2DE9A 3RU4D 1UHBB 1UTPA 2L74A 1XUHA 1FX0B 3E8LA 1ELCA 3TPIZ 4NA9H 3A85A 1XUGA 2GP9B 1TIOA 1V2UT 3BIUH 3RXAA 3A89A 3E91A 3Q3XA 1OYTH 1KSNA 3O8RA 1TMBH 1RTLA 2ZDNA 2VVVA 1UJ1A 3SOSA 4I8KA 3K6YA 1C2HA 1ELEE 1O2GH 2RG3A 4ISIH 4Z1MD 1GMHF 3GCTF 1V6DA 1C5OH 2VIQA 3DSGA 1EXFA 4IC6A 2UWOA 4ESTE 1ZLRA 2KR7A 2CF8H 1BBRH 2ZCHP 1A0JA 1ANEA 1PQ7A 2BXUH 3BTHE 1TPSA 2OCVB 1XKAC 3HGPA 1L4ZA 3TK5A 2HNTE 2FLBH 2QV1A 2TPIZ 2R9PA 1BDAA 4ABHA 1EQ9A 3HPTB 1P9SA 1FY8E 1PYTD 3RMLH 4FUFA 3S7HB 8KME2 4JK5A 1GL0E 1ZHRA 3A84A 2ZGJA 1C1MA 2GT7A 1WV7H 1TE0A 4H42U 3AASA 5EXLA 2FI4E 1A3EH 3M3TA 4Y7AA 4CHAC 5GIBA 3LH3A 4HI3A 1BJVA 1HAHH 3ATMA 2BD3A 3UNQA 1D6WA 1GJBB 5ETXA 1W8BH 1UK2A 3FP7E 9LPRA 2CF9H 2WPLS 4IMQA 3MH5A 4ISOA 2YNBA 3RLWH 3RXOA 2SNWA 1OYQA 2WUBA 1QQUA 3SGQE 1HIAA 2ZDAH 1QTFA 3S9BA 1E37B 1TWXB 1S5SA 2BXTH 1BTHH 2PUXB 1FJSA 2A32A 1SGPE 4X1SU 2BMGB 1IQLA 5IYTA 5C5NA 1QIXB 3P92A 3URDA 5A0BA 1O3MA 1ZJKA 2FPZA 1W0KD 1PFXC 3RLYH 1TMTH 2ZHQH 2ZTXA 3BTFE 3UIRA 1PQ5A 2A7CA 2VBCA 3ELAH 1LPGB 3SUFA 1OWEA 1C1SA 3R0FA 4ZMAH 1NFYA 2ZFPH 1SHYA 2K1QA 2RDEA 1QHRB 1GJCB 4O3TA 3VGCB 1FONA 3UR9A 1WDIA 1NFUA 2D2DA 4WMFA 4AGKA 4TWYA 5JPMH 1QJ7B 4GPGA 1VCQA 3TGIE 1LMWB 2SGPE 2HALA 7ESTE 3F0OA 1ZHMA 5L2ZH 3KEEA 1JXPA 1GDNA 3HK6B 3LGVA 4B73A 2XXLA 3ODDA 3OE7D 1C5NH 1IQHA 4MDSA 3ZZAA 2V3HH 3F1SB 1GBHA 1UO6A 1GI8B 2BDIA 3LC5A 2XYAA 2XNDD 1D4PB 2ZC9H 1MTWA 1EZUC 1W10U 1ABJH 1TPPA 2FYRA 1CGJE 1KLTA 1A2CH 1AZ8A 1EB1H 5L6NH 5GJ4B 3SNBA 4IC5A 2K8IA 1GGDC 2WPJS 1Z6JH 1V2LT 4X1NU 1A5GH 1EPTA 1GBCA 1QL8A 2P3TB 5A8XA 3MMGA 1SGEE 2AMQA 3FP8E 3EA8A 1BITA 1S6FA 2XBXA 2FOAA 2AFQB 1OWJA 1GI9B 2W26A 2ZDLA 1ZJDA 1S81A 4ZXXH 1L4DA 3SU4A 1BHXB 2BX3A 3QZRA 2AIPA 1ELAA 3E0PB 4MQAA 1VKYA 3M5OA 2SNVA 3SI4H 2XCFA 3K6ZA 2VIDA 2FLRH 3F2FA 1GI5A 4BXWA 1THRH 1FIWA 4Y76A 2WV4A 2KX4A 2GDEH 2BDBA 5EQSA 3W94A 2C8WB 1OXGA 1A1RA 3NUMA 3LOXA 4UEHH 2FOFA 4X1QU 5JBCS 2NWNA 1GBDA 3T62A 4NFFA 1ZYOA 5DP6A 1TA2A 1TGSZ 2W7SA 3MO6A 3TJNA 4R8TB 2JETC 4F55A 1MABB 1UTQA 3MU5A 1C5ZB 1JIRA 5FBIA 4DGJA 2UUKB 3S9AA 1K28D 4J1YA 3ZYDA 4INHA 2L6OA 1BQYA 1K1IA 4YTAA 2P3FH 2FM2A 1A7SA 2BZ6H 4D9RA 2V7QD 1C2IA 2ZHDA 7GCHF 2BD2A 5EJ1A 1F7ZA 4FU7A 1DFPA 5DGJA 1C5MD 2G52A 4AFZA 3O8CA 2FOMB 1LPKB 3PMAB 4BAQB 1SQOA 1HJAB 3Q00A 2GMTB 2Y82A 1PQ8A 4ABAA 1U6QA 3U1IB 1O2JA 2PGBB 2VNTA 1FAXA 4FVDA 3MNCA 3KYFA 3UOPA 3A8DA 2IPHA 1IHTH 3TGJE 3ZVEA 1P2IA 4K5ZA 3VG8A 2AGEX 3GISB 1O3PB 2F9VA 5C1YA 2BY7X 1LVYA 2AMPA 3TH2H 1HB0B 3SI3H 2EI8A 2GGVB 2CXVA 2PUQH 3AAUA 3HATH 1AUTC 3OAAD 5F8ZA 3E16B 3LONA 4TY6A 2QXJA 2I6QA 4Q2KA 1OP2A 4XBDA 1GMHG 1ELGA 4UFGH 1GVZA 2W5EA 3MHWU 3LU9B 2ZGHA 1TNGA 1RS0A 4DOQA 1YCPM 2J34A 1OSSA 4AGJA 2Y6TA 1F92A 2ZFFH 2VJ1A 3S9CA 2KCYA 1GGDB 1ETRH 1HV7A 1O2IA 1G2LA 1BRUP 3ZZBA 1FV9A 2AH4X 1SL3A 3NPSA 1C5VA 1C1NA 1ESTA 2PKSC 2TGTA 1MTUA 2QF5A 3QTVH 4BANB 1BRBE 1HDTH 4A1XA 3TH3H 2G81E 1BTPA 1T31A 2F9OA 3KCGH 4KKDA 4UONA 5EQQA 4I86A 2A4GA 3QX5H 3ZVAA 3PV5A 4B71A 2A31A 4GAWA 1DWDH 4AX9H 3NWUA 3PRDA 1JRTA 4Q7XA 1QURH 1P0SH 2UWPA 1ZTKA 3BTGE 2R2WU 3DSOA 4MNYA 3SGBE 5SGAE 3BTKE 2QXIA 5F8XA 1EKBB 1Z8JB 5I46H 1MQ6A 2VH0A 3M5NA 1F0UA 1O3GA 3RXQA 1ELDE 3DD2H 3A8CA 1KTSB 2A4OA 2OC1A 3RC5A 1WQSA 1UVPA 2HPPH 3D49H 1CVWH 1K1MA 4FUCA 4YESB 2ZEBA 3ENSB 1UK3A 2F83A 2ZIQH 2JETB 2OBOA 5FPSA 2R3UA 3SYJA 2VU8E 3M35A 6GCHG 3PROA 1SR5C 4DW2U 2ANWA 5T6DA 2JH6D 1MKXK 2FIRH 2PP6A 1AU8A 4RN6A 2G5VA 1UVSH 4FOUC 3UWIA 5FXLA 3W95A 3T5FH 1Z8IB 4NA8A 1CGIE 2KCPA 5JB8S 2ZI2H 3MQKC 4FUHA 2XWBI 3U8TH 2V3MA 4X8VH 5T3HA 1RD3B 1O33A 3KGPA 2JIZD 2FEQH 1LTOA 5EQRA 1HJ8A 5JBAS 2XBWA 1VCPA 3E1XB 4FUBA 2CHAB 2FXRA 1TPOA 2VWOA 1O31A 3SHAH 1DANH 4ZHLU 5E0HA 2R0LA 4WWYA 4M7GA 1V2TT 3LH1A 4ZAEA 1SQTA 1D6RA 2P16A 2FOBA 1COWD 3F3BA 3M3VA 1UTNA 3P17H 1DY9A 1C9PA 1MKWH 2R3YA 3GY6A 2Z7FE 8GCHF 4M9FA 2EI7A 4BNRA 1GBAA 5DN6D 1J15A 1SI5H 1F5RA 1O5GH 2IJOB 5C1UA 3MI4A 1DWEH 5AVDA 4SGAE 3PMHB 4ABFA 3QLPH 3NXPA 5EPNA 3SGAE 1DUAA 1GVKB 2CN0H 3OYPA 3HK3B 5FPTA 2AS9A 4MVNA 4RT1A 4GCHG 3GCOA 1TBZH 4CRGA 5C2ZA 1THSH 1K1LA 1TONA 4CH8B 1P03A 2ZU1A 5HIZA 3LPRA 1GMCF 1ZSKA 1AFEH 4AYYB 1YCPK 1BMFD 2O8TA 3I29A 2A5IA 3LJOA 1O30A 1AFQC 2YMSC 1Q31A 2BLOA 4ABBA 2OC7A 2VIWA 4Z6AH 1NZQH 2PKSB 1ZPCA 1G3BA 1DX5M 2WPKS 2ZFRH 2J97A 3RMNH 1RIWB 1ZGIA 4ZCNA 2PTNA 1P04A 1NROH 4B74A 3ZVGA 1C5SA 2ULLA 2WZQA 2SGFE 3UNRA 2BDCA 4ISHH 4DG4A 1A61H 3A80A 4HGCA 1YPLH 3GDUA 3RXVA 5LGOA 4KELA 1QL7A 4X8TH 1ESBA 3NCLA 4OS7A 4P02A 3BTME 4NGAH 3D62A 1SLWB 1WCZA 3RC6A 5C94A 1WQVH 3BTDE 1P3EA 4DVAU 1BHXF 1WSSH 2A5AA 1E0FD 1S6HA 2RA0A 4WXVA 4Y71A 3SU0A 3VXEH 5A8YA 2FTLE 3SU6A 3A81A 1KXCA 5DSFA 1GJ8B 2O8UA 2PGQB 5J4SA 3CS7A 4WF8A 1TBRH 3M36A 5JYIA 3PLBA 5L30H 5EJLA 2GDDA 1DOJA 2KCAA 5AFZH 1IQNA 3TGKE 1O2WA 2NU0E 7LPRA 2HVYB 1TQ7B 1F0SA 1SFQB 1O3CA 4ACAA 2FODA 5C0TA 3EQ0H 1K0HA 1IQIA 3HKIB 4OS2A 1WBGB 1F5KU 1RFNA 3QUMP 3SV7A 2OBQA 4YM9A 4QT8C 1KTTB 1AKSB 1B0EA 3A7VA 3JZ2B 2OC8A 2ZCKP 2XTTB 3FANA 2C8XB 1GHXH 5E8EH 1MAYA 3LT3A 1JMOH 1C1UH 2A1DB 4Q4LA 4X8UH 2KAIB 2QN5T 2ZFSA 1FPCH 3A8BA 1GBEA 2G8TA 1TNHA 1AO5A 1NFWA 4E05H 3H7OA 4FVBA 1C1RA 2KM0A 1O2ZA 1CA8B 1TA6A 1GG6C 1NESE 1NRPH 3ZYEA 5BPEA 1UTJA 5C67A 4RKJB 2ZHFH 3ESTA 1TABE 4Y0ZE 2O8MA 3ZZ8A 1TNLA 2ZHWH 1JIMA 2FOHA 2Y5FA 4Y11E 4JZ1A 1T8LA 3SUDA 3UR6A 1AE5A 1TGNA 1GCTC 1RTKA 3GDVA 3BN9A 1D3TB 2B7DH 3UB0A 1G30B 2A7HA 1MMJN 1S82A 2XRCA 3TH4H 2EQNA 5JBTA 2J5UA 1IQMA 4KTUA 4A1TA 2DUCA 5HM2A 3RXEA 1P2KA 1KMHB 1P57B 1P9UA 2RCEA 1BRAA 1VJ9U 3N7DA 2BZAA 3PTNA 4WVPE 4XDEA 4YLUA 1AFQB 1OOKB 3MWIU 2YMSB 2GVFA 1S85A 1TPAE 5CDFE 1K9OE 1H8HD 4KGAA 1CT2E 3GY5A 1GHBG 1O2TA 1ZMLA 3F9FA 4R0IA 5TJXA 4MLFB 1TB6H 1TYNA 2Y5GA 3GS9A 1QB9A 1GI6A 3PWCA 1HRTH 5E0JA 2ALVA 1IQEA 5B6LA 3Q76A 1BUIA 3WWBA 1DWCH 1XUFA 1EP5A 4FU9A 2VGCB 1O2VA 5T6GA 1O3NA 2FS9A 1SGFA 2QXHA 1C5PA 2D26C 1JWTA 1XX9A 2BVSH 3FAOA 3A8AA 2LPRA 1W14U 2ZWLH 5C0UA 1Q3XA 1C4Y2 1KXFA 1UCYH 1C9TA 1TQ0B 1CBWC 1QY6A 2ILNA 3GDSA 2WV9A 2C4FH 1VCWA 1YPEH 1QB6A 3MNXA 1AHTH 3T28A 3W1EA 5I25A 3QWCH 4AB8A 2GT8A 3FFGA 1DXPA 2A2XH 1B7XB 1GCDA 5CHAC 1HAOH 4A7IB 3EE7A 1GL1A 4TT3D 1GI1A 3QZQA 1MCTA 5F6MA 5BRRE 3SU2A 3BV9B 1ZSJA 4HFPB 1GBFA 1LHEH 3SJKA 1TRYA 3A7TA 2ZZUH 1BRCE 1Z7KA 1P02A 1NPMA 4WMDA 2V6NA 3RXKA 1V3XA 3SQHE 8ESTE 1PPEE 1C2EA 1M9UA 3H09A 4CH2B 4TWWA 2PW8H 1DWBH 4OM9A 1QCPA 2OD3B 4X1PU 2VIVA 1BCUH 3UPEA 2DE8A 2Y7XA 3PV4A 3OEED 1OHHD 2GCTC 4FUGA 5LPFA 3LIWA 3GCHB 4XRNA 2G51A 4Y8YA 3OY5U 2WUCA 1TGTA 2F4LA 3TLOA 4THNH 1O2RA 1C5XB 5F03A 1P2OA 1AKSA 4I8HA 2W7UA 5J4QA 4ASUD 2H5DA 1GG6B 3M7QA 1TFXA 1QRZA 2UUJB 1T8NA 5HM9A 2Q6DA 1O3HA 3TK6A 4UD9H 2VB0A 4KP0A 4UFEH 3RC4A 1C5TA 1ELTA 1QL9A 3BEFB 3KN2A 1VITF 1QA7A 3EDXB 5LPEA 1K1NA 4I31A 4DY7B 3MTYA 1CSOE 1C5UA 2Z9JA 1GMCG 1O36A 3K9XB 4TYDA 3SU5A 3A88A 2G5NA 1W0ZU 1GHAF 1Y5AT 1O2QA 3QN7A 4UDWH 3UY9A 1EJMA 2V0BA 3GOVB 2J4IA 4MTBA 1O3FA 1T7CA 1ZOMA 1IQKA 2BDAA 2SGDE 4WH6A 4INLA 2AIQA 2SGEE 1GI3A 1EUFA 2BQWB 3UOUA 1THPB 4X8SH 2SGAA 1P11E 2J2UA 1UHBA 5HMAA 4Y7BA 1XXFA 1ELVA 1O3EA 5GCHF 2ZCLP 1MU8B 1C2MA 3F2GA 2ZU4A 1TOMH 1NC6A 2HWLB 1TGCA 3FZDA 1QJ1B 4X2XA 5FPYA 1XVMA 2H9TH 4IGDA 5L2YH 5DP9A 4UFFH 5K7RA 1DXWA 1O2KA 1KY9A 3ZZCA 3KNXA 1ZSLA 1CT0E 1RJXB 3MOCA 3SZEA 3F9GA 1G3CA 2FX6A 1GI2A 2OINA 3O8BA 5DPAA 1SBWA 3E3TA 3ZVCA 5ABWA 3PMBB 1HBTH 1AN1E 3P70B 1ARBA 1CQQA 4CHAB 2EEKA 1TLDA 2BOKA 1EAXA 1YPMH 1E1RD 2QE7D 3RXDA 4NCYA 5EW2H 4ZUHA 3F68H 1O5FH 4O03A 5CHAB 1TOCB 4I8LA 1QGFA 2ODPA 1ANCA 2WPHS 3ZIAD 5EOKA 4ABDA 5G4BA 1O3AA 4A6LA 2FI3E 2IPQX 1O5BB 4XSKU 5A8ZA 2P94A 1TBQH 2BY6X 2FP7B 3GCNA 3WWFA 1DY8A 1A5HA 4RT0A 1HAXB 1NBMD 1AMHA 1T8MA 2Y81A 3K2UA 4FU8A 3N99A 1J14A 1O3LA 1CHOF 1FY1A 3VEQB 1YLNA 1WTHD 1TNIA 2G4UA 1WXRA 2YNAA 4ZH8A 3TJVA 1Q2WA 1P8VC 5B6OA 1UVUH 3RXFA 1GI0A 4OS1A 2QF4A 1F0RA 4YOJA 1E34B 4E7NA 1UVTH 1AVGH 1ZR0A 1O3IA 1HAYB 1LCYA 2NU4E 1C5WB 1SGDE 2ZDVH 4AN7A 1NN6A 1LHDH 1TMUH 2A45B 4MPXA 4D7FA 1NS3A 2BX4A 3N7OA 1D3DB 3SO3A 2ZDMA 2YOLA 1YBWA 2XC5A 3F0PA 1NRRH 2TGAA 4JZEH 1K22H 1KXDA 1PPGE 2I6SA 2OQ5A 2ZFQH 5T6FA 1H8DH 1UTMA 4CREA 3GY7A 4O9VA 5PTPA 1ZPZA 1DM4B 4I7YH 1DDJA 1K21H 1Z71A 3DUXH 1QR3E 1V2QT 2D1JA 1P10A 1J9CH 2ZGXH 3GCTG 4B75A 3AAVA 1PYTC 1G37A 2NU3E 1G2MA 5KECA 1YY3A 1ZRKA 2UUYA 3DHKH 4HG6A 1Z6EA 3UUZA 1N6XA 1DS2E 1QRWA 4ISNA 1SGYE 1QRXA 1SKYE 1EASA 3A7YA 1YKTA 4TPIZ 3SW2B 5C1XA 2GCHF 1LVOA 2GV6A 1SFIA 1AQ7A 3EA9A 2FZZA 2Z3EA 1GJ7B 5HKKD 1O37A 1EZXC 4U32A 3M7TA 4F49A 2R2MB 4WMEA 2IJD1 2BVRH 1V2ST 4OGXA 1DICA 2FS8A 1BTZA 2P59A 4H6SB 1O2OA 3TITA 3ZZ3A 4AG1A 3ZZ5A 2BY8X 2GX4A 3MNSA 4CBOA 2J98B 4BXSA 2ZPRA 1KXBA 2CV3A 5EODA 1L1NA 5FHTA 1C2GA 1EP6A 4K8YA 1QBNA 2PFEA 2QGRA 3SNEA 3ATLA 4I8GA 2JJ1D 1FN6A 1O35A 3KYGA 1BBRK 1SLVB 2J92A 3RMOH 5C3NA 1H1BA 4ASHA 3OFND 1C4U2 2BVXH 1H9HE 3VFEA 4CRDA 1QNJA 3ZZ7A 1HAGE 1KLJH 2BHGA 1OWKA 3P95A 4BAOB 1QFKH 4MPWA 5FCRA 3V3MA 4AORA 3GY8A 1WTGH 1CE5A 1KDQB 1PPBH 1ETSH 2JJ2D 2Z3DA 3HGNA 1ZMNA 2BTCE 2IOTA 1IQGA 1HCGA 3PMJA 3SNCA 1O38A 2VWMA 4BTUB 1Y3WA 3L3TA 2OUAA 5FAHA 4P00A 3ZV8A 4Y8XA 1SGTA 2H9HA 2P95A 3KQ5A 2QF0A 4AFUA 4O3UA 3PV2A 1S6LA 2HRVA 3VB4A 4CRBA 2ZKSA 1LQEA 2ANMH 1GI7B 4TPYA 2QYIA 4WY3A 4GVUA 1ZMJA 1LHCH 1EFRD 2PLXA 1EB2A 1O2LA 1W13U 1GJ9B 1P01A 4D8NA 3R3GB 5FCKA 1AB9C 4NIWA 1W2KH 4K3JA 2Y7ZA 4B2CA 4WH8A 5DO4H 1X7AC 5GDSH 4CRCA 3OSYA 4BAMB 2W3IA 2BLWA 3AVZA 1SOZA 1NY22 2OTVA 1HGTH 5EXNA 4INKA 5ESTE 3KQDA 1Z8GA 1EZSC 2FWWA 2THFB 3EA7A 4DT7B 1SHHB 4FUDA 3U98H 1O3KA 1JOUB 1S0QA 2F91A 2Z3CA 3PM3A 4XOJA 3PYHA 2KFWA 1GHVH 1GPZA 1J16A 2Q6FA 1Y3UA 1LPZB 4FXGH 1XM1A 1W12U 1C5YB 4ABIA 1G3EA 1N8OC 3D65E 1W7GH 5TCAA 2QAAA 4F48B 1SLUB 3OU0A 5E2PA 4JMYA 3SJIA 3UFAA 1BTXA 1FMGA 2PV9B 3SN8A 4XFQA 1W7XH 2JH5D 1YC0A 1SGFG 4RKOB 1G36A 1QZ8A 4Y0YE 3B8JA 5JBBS 2V3OH 1S0RA 1HAPH 1EPTC 5FBEA 2P93A 2HVXA 4ACBA 4B76A 2WYGA 2FO9A 3TVJB 2VH6A 1XMNB 2A0QB 3TU7H 1BBRE 3G01A 2F9NA 2ZQ1A 3S0NA 1KXEA 1VJAU 1SGIB 1PPFE 3EAJA 1GBBA 1EATA 1LQDB 2GZ8A 3A86A 5CE1A 4CBNA 4LK4A 3FP6E 5C20A 2WPMS 3STIA 1ABIH 1FAKH 3KQCA 2BY5X 1A3BH 2OP9A 3OY6U 1FUJA 3CP7A 3E0NB 2C90B 1NTPA 1FLEE 1AD8H 1HAIH 4HZHA 3SNDA 4X6NA 3S69A 1JRSA 1GJ6A 2V35A 2J98A 1YGCH 2Z9GA 2CMYA 3I78A 2VIOA 1YLCA 1EAWA 2GTBA 2OC0A 3KL6A 4K60A 4BOHA 4CRAA 2H6MA 3PLKA 3MO3A 4YOGA 1P05A 7GCHG 1UMAH 5A09A 1ESAA 1MQ5A 4DT4A 1ORFA 3SV9A 1P2JA 2NU1E 3BG8A 1P2MA 3F6UH 1NM6A 3BG4C 7KMEH 1W0JD 2A4QA 4JYUH 1Y5BT 4VGCC 3BIVH 1C2JA 1CU1A 2B8OH 4I8JA 4X0WU 2BOHB 3T25A 1MUEB 1SQRA 2BD8A 5IK2D 2ODQA 1GBKA 2OLGA 4BAKB 1PPCE 3ATKA 4IS5A 4DURA 3U1JB 5GPIB 1C1TA 1EJAA 1ZHPA 2BQ6B 3VXFH 3IWMA 5F8TA 1EZQA 1AB9B 5GWZA 1HJ9A 1ID5H 3SU1A 3WW7A 1LVMA 1AY6H 3GYLB 4BAHB 3T2NA 4ABGA 4B1TA 1TRMA 1GHZA 3CS0A 1NU9A 3KF2A 5HXFA 1HXFH 2PTCE 3RXUA 6LPRA 1V2KT 3ZVFA 1OWHA 1O2NA 3MYWA 3RU4T 4FUEA 4NZLA 4JZIA 1UVOA 1O3BA 1NU7B 4NIYA 2KCOA 3UAIC 5DKMA 1YP9A 2A4RA 2GZ9A 5C5OA 4ABEA 3RUOA 4GHTA 1GBMA 2BB4A 2Q1JA 4AOQA 3KQEA 1MTSA 3P8OA 1N8OB 3OX7U 2TRMA 1ZPBA 2ZU5A 1MBQA 3K65B 4GSOA 1YPHE 5A2MH 2BD5A 2J94A 3VB7A 3DA9B 3M61U 1LKBA 1E35B 3TK9A 1HXEH 4ZHMU 1WUNH 4AB9A 1ZZZA 1SGNE 2QXGA 1BZXE 1T32A 2A7JA 2QC2A 4JCNA 1MU6B 1BB0B 3AK5A 2OQUA 3GY2A 5DP7A 5EIYA 2ZGBH 2TIOA 3RXRA 1CA0C 5DP5A 1EPTB 4X2VA 1JBUH 2ZU3A 5H4IB 3V12A 2NU2E 2R0KA 3DFLA 1NRNH 1FY4A 3QGNB 5IDKA 5DP4A 1FXYA 1PPHE 4TSFD 4Y8ZA 2G4TA 2BD7A 1A4WH 1FI8A 4OS4A 1DSUA 1W11U 1ELBA 3RXIA 1O2MA 1DLEA 3OTJE 1MTVA 1P2QA 3LDXH 4Q7ZA 4X2YA 2RDLA 4X6OA 4ZKOU 4XBBA 1FDPA 4FUJA 1O3DA 2VIPA 1CT4E 3ODFA 2F9UA 2Y80A 3RU4E 1O2YA 2Y5HA 2BD9A 1SSXA 4NWLA 1YF4A 5DP8A 1EX3A 3SORA 3EE0B 2BDHA 2WINI 4A1VA 1C1QA 3RXCA 3DCLA 1GJDB 1RRKA 3EYDA 2VWLA 3UQOA 5FX6A 2ZNKH 1BOQA 1HYLA 3LJJA 1O32A 1QB1A 1SPJA 1G32B 1C4V2 2AEIH 2FMJA 3A7ZA 1OP8A 1MKXH 2BQ7B 1GBIA 1O5CB 2CK3D 2GKVE 4D9QA 3NRLA 4CRFA 2BLVA 2PKAB 1GDQA 3SJ8A 2C93B 3JZ1B 4AC9A 4JK6A 3BG4B 4ZXYH 2Z9IA 4H4FA 4H6TA 1DSTA 1SC8U 1YYY1 5E0GA 4GUXA 4VGCB 3MH7A 1P3CA 3MNBA 2BD4A 1WYKA 1KYNA 1T4VH 4U2WA 1BA8B 1FIZA 1AWHB 1WU1A 2XBYA 4E7RG 1MBMA 2VVCA 2W6JD 3CNRA 3QO6A 1O2XA 2PR3A 4OGYA 3SUEA 2VINA 2PSXA 4DIIH 1OS8A 1GVLA 8GCHG 2C8ZB 3OTPA 1GJAB 1QA0A 4XE4A 3F9EA 1ZGVA 1GBLA 3Q3YA 2WV5A 2XC4A 3V0XA 1SB1H 3M3SA 3ZV9A 2TBSA 4SGBE 3ZZDA 1OPHB 1LHGH 1IQJA 2F9BH 2STAE 6GCHF 2HLCA 3C1KA 2BYAX 2HNTF 2FOEA 3BTEE 1B5GH 2KAIA 4GHQA 5AFYH 1F0TA 1LDTT 1O3OA 3SU3A 1SOTA 4LOYH 2Q6GA 2M5TA 3SQEE 1INCA 1GCTB 1HJAC 2GMTC 1H9IE 3A83A 1K2I1 4BTIB 2ANYA 1AUJA 3DFJA 1C1WH 1FY3A 1SQAA 1LHFH 5T1VA 2AERH 3IG6B 4AZ2B 5HGGA 3C27B 1AE8H 1K1PA 4YO9A 1E79D 2ZDKA 1SGRE 1A5IA 1HAVB 1MKWK 1P06A 3MU4A 1K1OA 3T27A 1YCPH 2ZPQA 2FTMA 4LZ4B 3LC3A 1W3CA 5EXMA 5GNDA 3RXBA 5JDUB 4AFSA 1Y3VA 1YM0A 1NRQH 3BF6H 3SZNA 1CA0B 4Z0KA 2JH0D 3URCA 4LZ1H 2CGAA 5CHBA 2P8OC 1YWUA 2FYQA 3ZZ9A 1H9LB 3B9FH 2ZTYA 1EAUA 1MD8A 4ZKSU 4ZKNU 2FESH 1KLIH 3SV2H 4HTCH 1SLXB 2SGQE 4I33A 8LPRA 3D23A 4KTSA 1BJUA 3UWJH 3GYMA 1V2VT 3MH6A 2TGDA 1AGJA 1A0LA 1BTUA 3LGTA 1DVAH 3A87A 3LKWA 1GMDF 1AIXH 1DUEA 2BDGA 1GDUA 1O5AB 6ESTA 1IAUA 4IW4E 4GCHF 1CBWB 1SGQE 2WSSD 2XW9A 2H9EH 1YPHC 3ITIA 2ESTE 1Y5UT 1NRSH 1NFXA 2ALPA 3SV8A 1NT1A 5DJ7A 2G00A 3LGWA 4ABJA 4DIHH 3UREA 3FN8A 4NA7A 4OS5A 1GHWH 1DPOA 1C2DA 5LH8A 2O9QA 1DE7H 3PB1E 2ASUB 2HOBA 4IN2A 2XC0A 1OWIA 1Z1IA 2ZECA 4I32A 3PTBA 3Q3KA 2XWAA 1EOLA 3U8RH 2GZ7A 2LELA 1PPZA 1IOEA 3AW0A 1VITH 1IHSH 3RXMA 1SMFE 3ZVBA 2HPQH 2YMSD 1HLTH 4O97A 1V2PT 1Y8TA 1GJ4H 2EA3A 4WXIA 3RDZA 2EC9H 4Y6DA 1BTYA 1MZAA 2GCTB 5HYOA 1C5LH 2A5KA 3PO1C 1F5LA 2F9PA 2ZF0H 2C3SA 2KZ4A 5C17A 1PJPA 3BEIB 1AZZA 1HNEE 1BMMH 2PKAA 3ATWA 1RTFB 4B6EA 1QQ4A 2XNIA 1QBVH 2HNTC 1EAIA 4Y10E 5AHGH 4K69A 2GD4B 1E38B 2IN2A 2VVUA 1BTWA 4CR9A 1H4WA 1MZDA 5ESBA 3DSPA 1UTOA 4ZROA 3SUGA 1O2SA 1XUIA 3H5CB 2CHAC 4NIXA 4X2WA 1S83A 3PLPA 4MPUA 1NBME 2ODYB 3QTOH 4K1TA 1ANDA 3NZIA 1O34A 3GICB 2O8WA 1O2UA 5DP3A 1GWAA 1P12E 2OK5A 1N1LA 4Q80A 4X6PA 1D9IA 2GJGA 3BEUA 1LO6A 1MD7A 2ZA5A 2O8LA 3F9HA 4JZFH 2JDID 1GJ5H 3O8DA 4ISLA 1C5RA 3B23B 1C1OA 4B2BA 4DCDA 1HUTH 2FDAA 4MG3A 2HLDD 1B0FA 1MCVA 1MTNC 5F53A 4B6FA 4JYTA 1YPKH 3M37A 1QJ6B 4XBCA 1VZQH 1HAVA 1D3PB 2P8OB 3BTQE 1LVBA 3I77A 1C2LA 1YLDA 4MNVA 3RM2H 2W6ID 3RXLA 1H8ED 1V2JT 4CR5A 5A0AE 1Z8RA 4IBLH 4D76A 2WPIS 1V2MT 1XUJA 4XD7D 1XUKA 2Z94A 3P8NA 1P2NA 1TALA 4NIVA 1ZTLA 2A2QH 2C8YB 4MNXA 4OS6A 1P09A 2VWNA 2ZFTA 1CO7E 4X1RU 1EOJA 3MH4A 3U9AH 4NG9H 5EG4A 1TNKA 1RIWC 1VGCC 3UTUH 4LXBH
chains in the Genus database with same CATH topology
2QF3A 4K1EA 2QA9E 1O2HA 1O3JA 1FNIA 1PQAA 4A5TS 2QIQA 1FY5A 2H1UA 1GHBF 1O5EH 1O2PA 1GHYH 3A82A 3GY4A 4YOIA 3IITA 3MU1A 3SHCH 1J8AA 5FX5A 1K1JA 3E6PH 2PWXA 4AFQA 2XCNA 3QDZB 4K8BA 1UCYK 2B5TB 1SG8B 5E2OA 1WAYB 1C1PA 1GI4A 2SFAA 2D8WA 3LGYA 3STJA 4RSPA 1ACBE 5A0CA 1TNJA 9ESTA 3S7KB 3RXHA 2RA3A 4PROA 4UFDH 1TX6A 3NKKA 3ZZ6A 5EGMA 3PO1B 1XKBC 3EGKH 3SV6A 3TIUA 3MO9A 1TRNA 1VITG 1FPHH 4NZQA 3V13A 3KHVA 1O0DH 2ZU2A 5CMXH 4WJG2 2QY0B 1L1GA 3SBKA 4BTTB 1G9IE 3GY3A 3SNAA 2AMDA 1OWDA 3H7TA 1C2FA 3VB5A 3RM0H 2H2ZA 1GHAG 1OKXA 3BSQA 4NSVA 1ZTJA 3TNTA 6CHAC 1AVWA 1W0YH 3LGIA 3RXJA 4ZHAA 1DLKB 1IQFA 2HGTH 1D3QB 2QCYA 1MAXA 4UE7H 4U01A 4NWKA 3NK8A 4NSYA 2BLQA 2W3KA 3P6ZB 2ANKH 1L0ZA 3DT0H 3PWBA 4MNWA 3A7WA 2OXSA 3MU0A 3VB3A 4A92A 4ZKRU 4D7GA 5GCHG 1SVPA 1BT7A 1J17T 1VR1H 2FI5E 3RMMH 5JB9S 2XBVA 1YPGH 1T4UH 3T26A 1ZRBA 1NO9H 1XXDA 1MTNB 2UUFB 3L6PA 4TY7A 3M5LA 3M5MA 1SGCA 3TJUA 1V2OT 1UK4A 1BIOA 1GMDG 1E36B 2BM2A 1CHGA 3QK1A 4NFEA 4KTCA 2GV7A 1O39A 3MU8A 1A46H 3AW1A 1YPJH 4Y79A 1Y3XA 3BTTE 4MPVA 4B2AA 5DK1A 1V2RT 3P8GA 3U8OH 1V2NT 1C2KA 2LNCA 2Z9KA 1FN8A 3U69H 1F2SE 2AGIX 1ELFA 1DITH 1DT2A 4JYVH 1VGCB 1RGQA 1O5DH 1Y3YA 2B0FA 3WY8A 2AYWA 4E06H 5K0HA 1UCYE 4K1SA 4X6MA 4J2YB 3MFJA 4GLYA 2VGCC 1CHOG 2FOCA 3RXSA 3ZVDA 1G3DA 1AI8H 5EPYA 2FOGA 2Z9LA 2J95A 1OP0A 4YZUA 1TGBA 2EI6A 5DG6A 2J38A 4YT6H 1LKAA 3E90B 2P3UB 3RXPA 1N6YA 3TNSA 1HIAB 3HKJB 3FVFB 5TCCA 3SJOA 3ZZ4A 2ZGCA 2AGGX 3LGUA 2CJIA 1UTLM 2PHBA 3KQBA 1BMNH 4Q7YA 1FQ3A 3FZZA 2PSYA 2JKHA 5AF9H 4AYVB 1KDQA 2B9LA 1RXPA 1T8OA 3ATIA 1EJNA 2ZTZA 2J9NA 1Z1JA 1BMLA 1L1JA 4DJZB 1S84A 1UTKA 1KIGH 2ZHEH 1GBJA 1TAWA 3SJ9A 2ZPSA 3RXTA 1HPGA 1ANBA 3T29A 2BY9X 2TGPZ 4JZDH 1HFDA 3UNSA 1AWFH 1C1VH 4YT7H 6CHAB 1WOFA 2UWLA 3TJOA 1H8IH 3GCHC 3RXGA 3VGCC 4F4OC 2F3CE 3L33A 2ZQ2A 4IN1A 3Q77A 2STBE 2ZP0H 2ZO3H 3CENA 1ARCA 1C5QA 3BTWE 1TX7A 1MH0A 5EU8A 3VB6A 1AVXA 4AG2A 1ETTH 2Z6BD 4K2YA 3RP2A 2GCHG 1XVOA 1Y59T 3A7XA 3V7TA 1OX1A 5LPRA 3M7UA 1KXAA 1BMAA 1TX8A 3KIDU 3UQVA 1QBOA 3QGJA 4FUIA 3VPKA 2WYJA 5EW1H 5GXPA 1CGHA 1HAZB 2ZG0H 3P8FA 4IMZA 4YLQH 2H5CA 1GBTA 2G55A 1V2WT 1A0HB 1L2EA 1FZZA 2FX4A 4U30A 2BDYA 2DE9A 3RU4D 1UHBB 1UTPA 1XUHA 3E8LA 1ELCA 3TPIZ 4NA9H 3A85A 1XUGA 2GP9B 1TIOA 1V2UT 3BIUH 3RXAA 3A89A 3E91A 3Q3XA 1OYTH 1KSNA 3O8RA 1TMBH 1RTLA 2ZDNA 2VVVA 1UJ1A 3SOSA 4I8KA 3K6YA 1C2HA 1ELEE 1O2GH 2RG3A 4ISIH 1GMHF 3GCTF 1V6DA 1C5OH 2VIQA 1EXFA 4IC6A 2UWOA 4ESTE 1ZLRA 2CF8H 1BBRH 2ZCHP 1A0JA 1ANEA 1PQ7A 2BXUH 3BTHE 1TPSA 2OCVB 1XKAC 3HGPA 1L4ZA 3TK5A 2HNTE 2FLBH 2QV1A 2TPIZ 2R9PA 1BDAA 4ABHA 1EQ9A 3HPTB 1P9SA 1FY8E 1PYTD 3RMLH 4FUFA 3S7HB 8KME2 4JK5A 1GL0E 1ZHRA 3A84A 2ZGJA 1C1MA 2GT7A 1WV7H 1TE0A 4H42U 3AASA 5EXLA 2FI4E 1A3EH 3M3TA 4Y7AA 4CHAC 5GIBA 3LH3A 4HI3A 1BJVA 1HAHH 3ATMA 2BD3A 3UNQA 1D6WA 1GJBB 5ETXA 1W8BH 1UK2A 3FP7E 9LPRA 2CF9H 2WPLS 4IMQA 3MH5A 4ISOA 2YNBA 3RLWH 3RXOA 2SNWA 1OYQA 2WUBA 1QQUA 3SGQE 1HIAA 2ZDAH 1QTFA 3S9BA 1E37B 1TWXB 1S5SA 2BXTH 1BTHH 2PUXB 1FJSA 2A32A 1SGPE 4X1SU 2BMGB 1IQLA 5IYTA 5C5NA 1QIXB 3P92A 3URDA 5A0BA 1O3MA 1ZJKA 2FPZA 1PFXC 3RLYH 1TMTH 2ZHQH 2ZTXA 3BTFE 3UIRA 1PQ5A 2A7CA 3ELAH 3SUFA 1LPGB 1OWEA 1C1SA 3R0FA 4ZMAH 1NFYA 2ZFPH 1SHYA 2K1QA 1QHRB 1GJCB 4O3TA 3VGCB 1FONA 3UR9A 1NFUA 2D2DA 4WMFA 4AGKA 4TWYA 5JPMH 1QJ7B 4GPGA 1VCQA 3TGIE 1LMWB 2SGPE 2HALA 7ESTE 1ZHMA 5L2ZH 3KEEA 1JXPA 1GDNA 3HK6B 3LGVA 4B73A 2XXLA 3ODDA 1C5NH 1IQHA 4MDSA 3ZZAA 2V3HH 3F1SB 1GBHA 1UO6A 1GI8B 2BDIA 3LC5A 2XYAA 1D4PB 2ZC9H 1MTWA 1EZUC 1W10U 1ABJH 1TPPA 2FYRA 1CGJE 1KLTA 1A2CH 1AZ8A 1EB1H 5L6NH 5GJ4B 3SNBA 4IC5A 1GGDC 2WPJS 1Z6JH 1V2LT 4X1NU 1A5GH 1EPTA 1GBCA 1QL8A 2P3TB 5A8XA 3MMGA 1SGEE 2AMQA 3FP8E 3EA8A 1BITA 1S6FA 2XBXA 2FOAA 2AFQB 1OWJA 1GI9B 2W26A 2ZDLA 1ZJDA 1S81A 4ZXXH 1L4DA 3SU4A 1BHXB 2BX3A 3QZRA 2AIPA 1ELAA 3E0PB 4MQAA 3M5OA 2SNVA 3SI4H 2XCFA 3K6ZA 2VIDA 2FLRH 1GI5A 4BXWA 1THRH 1FIWA 4Y76A 2WV4A 2GDEH 2BDBA 5EQSA 3W94A 2C8WB 1OXGA 1A1RA 3NUMA 3LOXA 4UEHH 2FOFA 4X1QU 5JBCS 2NWNA 1GBDA 3T62A 4NFFA 1ZYOA 5DP6A 1TA2A 1TGSZ 2W7SA 3MO6A 3TJNA 4R8TB 2JETC 3MU5A 1UTQA 1C5ZB 1JIRA 5FBIA 4DGJA 2UUKB 3S9AA 1K28D 4J1YA 3ZYDA 4INHA 1BQYA 1K1IA 4YTAA 2P3FH 2FM2A 1A7SA 2BZ6H 4D9RA 1C2IA 2ZHDA 7GCHF 2BD2A 1F7ZA 4FU7A 1DFPA 5DGJA 1C5MD 2G52A 4AFZA 3O8CA 2FOMB 1LPKB 3PMAB 4BAQB 1SQOA 1HJAB 3Q00A 2GMTB 2Y82A 1PQ8A 4ABAA 1U6QA 3U1IB 1O2JA 2PGBB 2VNTA 1FAXA 4FVDA 3MNCA 3UOPA 3A8DA 2IPHA 1IHTH 3TGJE 3ZVEA 1P2IA 4K5ZA 2AGEX 3GISB 1O3PB 2F9VA 5C1YA 2BY7X 1LVYA 2AMPA 3TH2H 1HB0B 3SI3H 2EI8A 2GGVB 2CXVA 2PUQH 3AAUA 3HATH 1AUTC 5F8ZA 3E16B 3LONA 4TY6A 2QXJA 2I6QA 4Q2KA 1OP2A 4XBDA 1GMHG 1ELGA 4UFGH 1GVZA 2W5EA 3MHWU 3LU9B 2ZGHA 1TNGA 1RS0A 4DOQA 1YCPM 2J34A 1OSSA 4AGJA 2Y6TA 1F92A 2ZFFH 2VJ1A 3S9CA 1GGDB 1ETRH 1HV7A 1O2IA 1G2LA 1BRUP 3ZZBA 1FV9A 2AH4X 1SL3A 3NPSA 1C5VA 1C1NA 1ESTA 2PKSC 2TGTA 1MTUA 3QTVH 4BANB 1BRBE 1HDTH 4A1XA 3TH3H 2G81E 1BTPA 1T31A 2F9OA 3KCGH 4KKDA 4UONA 5EQQA 2A4GA 3QX5H 3ZVAA 4B71A 2A31A 4GAWA 1DWDH 4AX9H 3NWUA 1JRTA 4Q7XA 1QURH 1P0SH 2UWPA 1ZTKA 3BTGE 2R2WU 4MNYA 3SGBE 5SGAE 3BTKE 2QXIA 5F8XA 1EKBB 1Z8JB 5I46H 1MQ6A 2VH0A 3M5NA 1F0UA 1O3GA 3RXQA 1ELDE 3DD2H 3A8CA 1KTSB 2A4OA 2OC1A 3RC5A 1WQSA 1UVPA 2HPPH 3D49H 1CVWH 1K1MA 4FUCA 4YESB 2ZEBA 3ENSB 1UK3A 2F83A 2ZIQH 2JETB 2OBOA 5FPSA 2R3UA 2VU8E 3M35A 6GCHG 3PROA 1SR5C 4DW2U 2ANWA 5T6DA 2JH6D 1MKXK 2FIRH 4RN6A 1AU8A 2G5VA 1UVSH 3UWIA 5FXLA 3W95A 3T5FH 1Z8IB 4NA8A 1CGIE 5JB8S 2ZI2H 4FUHA 2XWBI 3U8TH 4X8VH 5T3HA 1RD3B 1O33A 3KGPA 2FEQH 5EQRA 1LTOA 1HJ8A 5JBAS 2XBWA 1VCPA 3E1XB 4FUBA 2CHAB 2FXRA 1TPOA 2VWOA 1O31A 3SHAH 1DANH 4ZHLU 5E0HA 2R0LA 4WWYA 4M7GA 1V2TT 3LH1A 4ZAEA 1SQTA 1D6RA 2P16A 2FOBA 3M3VA 1UTNA 3P17H 1DY9A 1C9PA 1MKWH 2R3YA 3GY6A 2Z7FE 8GCHF 2EI7A 4BNRA 1GBAA 1J15A 1SI5H 1F5RA 1O5GH 2IJOB 5C1UA 3MI4A 1DWEH 5AVDA 4SGAE 3PMHB 4ABFA 3QLPH 3NXPA 5EPNA 3SGAE 1DUAA 1GVKB 2CN0H 3OYPA 3HK3B 5FPTA 2AS9A 4MVNA 4GCHG 3GCOA 1TBZH 4CRGA 5C2ZA 1THSH 1K1LA 1TONA 4CH8B 1P03A 2ZU1A 3LPRA 1GMCF 1ZSKA 1AFEH 4AYYB 1YCPK 2O8TA 3I29A 2A5IA 3LJOA 1O30A 1AFQC 1Q31A 2BLOA 4ABBA 2OC7A 2VIWA 4Z6AH 1NZQH 2PKSB 1ZPCA 1G3BA 1DX5M 2WPKS 2ZFRH 3RMNH 1RIWB 1ZGIA 2PTNA 1P04A 1NROH 4B74A 3ZVGA 1C5SA 2ULLA 2SGFE 3UNRA 2BDCA 4ISHH 4DG4A 1A61H 3A80A 4HGCA 1YPLH 3GDUA 3RXVA 5LGOA 4KELA 1QL7A 4X8TH 1ESBA 3NCLA 4OS7A 3BTME 4NGAH 3D62A 1SLWB 1WCZA 3RC6A 1WQVH 3BTDE 1P3EA 4DVAU 1BHXF 1WSSH 2A5AA 1E0FD 1S6HA 2RA0A 4WXVA 4Y71A 3SU0A 3VXEH 5A8YA 2FTLE 3SU6A 3A81A 1KXCA 5J4SA 1GJ8B 2O8UA 2PGQB 3CS7A 4WF8A 1TBRH 3M36A 5JYIA 3PLBA 5L30H 2GDDA 1DOJA 5AFZH 1IQNA 3TGKE 1O2WA 2NU0E 7LPRA 1TQ7B 1F0SA 1SFQB 1O3CA 2FODA 3EQ0H 1IQIA 3HKIB 4OS2A 1WBGB 1F5KU 1RFNA 3QUMP 3SV7A 2OBQA 4YM9A 4QT8C 1KTTB 1AKSB 1B0EA 3A7VA 3JZ2B 2OC8A 2ZCKP 2XTTB 3FANA 2C8XB 1GHXH 5E8EH 1MAYA 3LT3A 1JMOH 1C1UH 2A1DB 4X8UH 2KAIB 2QN5T 2ZFSA 1FPCH 3A8BA 1GBEA 2G8TA 1TNHA 1AO5A 1NFWA 4E05H 3H7OA 4FVBA 1C1RA 1O2ZA 1CA8B 1TA6A 1GG6C 1NESE 1NRPH 3ZYEA 5BPEA 1UTJA 5C67A 4RKJB 2ZHFH 3ESTA 1TABE 4Y0ZE 2O8MA 3ZZ8A 1TNLA 2ZHWH 1JIMA 2FOHA 2Y5FA 4Y11E 4JZ1A 1T8LA 3SUDA 3UR6A 1AE5A 1TGNA 1GCTC 1RTKA 3GDVA 3BN9A 1D3TB 2B7DH 1G30B 2A7HA 1MMJN 1S82A 2XRCA 3TH4H 5JBTA 1IQMA 4KTUA 4A1TA 2DUCA 5HM2A 3RXEA 1P2KA 1P57B 1P9UA 2RCEA 1BRAA 1VJ9U 2BZAA 3PTNA 4WVPE 4XDEA 4YLUA 1AFQB 1OOKB 3MWIU 2GVFA 1S85A 1TPAE 1K9OE 4KGAA 1CT2E 3GY5A 1GHBG 1O2TA 1ZMLA 3F9FA 4R0IA 5TJXA 4MLFB 1TB6H 1TYNA 2Y5GA 3PWCA 1QB9A 1GI6A 1HRTH 5E0JA 2ALVA 1IQEA 3Q76A 1BUIA 1DWCH 1XUFA 1EP5A 4FU9A 2VGCB 1O2VA 5T6GA 1O3NA 2FS9A 1SGFA 2QXHA 1C5PA 2D26C 1JWTA 1XX9A 2BVSH 3FAOA 3A8AA 2LPRA 1W14U 2ZWLH 1Q3XA 1C4Y2 1KXFA 1UCYH 1C9TA 1TQ0B 1CBWC 1QY6A 2ILNA 3GDSA 2C4FH 1VCWA 1YPEH 1QB6A 3MNXA 1AHTH 3T28A 5I25A 3QWCH 4AB8A 2GT8A 3FFGA 1DXPA 2A2XH 1B7XB 1GCDA 5CHAC 1HAOH 4A7IB 1GL1A 1GI1A 3QZQA 1MCTA 5F6MA 5BRRE 3SU2A 3BV9B 1ZSJA 4HFPB 1GBFA 1LHEH 3SJKA 1TRYA 3A7TA 2ZZUH 1BRCE 1Z7KA 1P02A 1NPMA 4WMDA