3SJAC

Crystal structure of s. cerevisiae get3 in the open state in complex with get1 cytosolic domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
b'MNELSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
molecule tags Hydrolase/transport protein
source organism Saccharomyces cerevisiae
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
total genus 24
structure length 61
sequence length 61
chains with identical sequence D, G, H, J
ec nomenclature
pdb deposition date 2011-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3sjaC00
3SJCC 3QG5A 3ZS8C 2F66C 2CAZC 1SKVA 1NT2B 3B2EE 3CSXA 3SJBC 3ICXA 3SJAC 3THOA 3QF7A 1X4TA 2JS5A 2P22C
chains in the Genus database with same CATH superfamily
3OEEG 2QWNB 1MOFA 4CBCA 3D3QA 2GDSA 4P2ZA 1N34B 3SJQC 1W2BU 1K7DA 2EJ7A 4FFBB 1N0JA 2EX3A 2ZE7A 4ZOLB 4DV1B 2BOCC 4IHJA 4PA9A 4PDRA 2VQFO 2ZD9A 5CB4A 3RYHA 2Y0IA 3CD6V 4TV9B 3EXAA 3FKSG 3CXCU 1IBKB 4HNAA 1QVGU 3ZJZA 4R7CA 4IYIA 4X89A 4XBFA 2P67A 4BW5A 3A0HZ 3CCEV 5LOVB 4DR7O 4H0LB 1VARA 4JZ2A 3OEHG 4O4HB 5B1BC 1NBMG 3BABA 4NXNB 2BCCH 4FVMA 1IXMA 3C3SA 2EIJB 4N23A 4RQEA 3RVZA 4CS3A 3DSQA 1YTFD 3R66A 4YXWG 1YJWV 4B7EA 2OCCC 3KG2A 3L73H 4AHCA 3HKDB 1H8HG 4WBNB 3ZEDA 4JI8O 1G6UA 3VQXA 4RUEA 5KX5B 1VF6A 3RYCA 1I0HA 2OIGA 5EYPA 1N8RW 4TUYB 1QLNA 4PA3A 1NH2D 2CUGA 1AILA 3ASNB 2N74A 3ETQA 2A06H 1SRYA 3FFQA 1M56B 5H5NA 3T1HO 2Q0AA 3E8FA 3JSNA 3K5LA 4X1YB 4XDJA 1Z5VA 4WFHA 3OMNB 1B3QA 1PKXA 2D3OW 3B8MA 1K3EA 2Y4UA 1VEWA 4X1YA 2ZXWB 1AI6A 2LJ2A 2WLMA 2XTAA 2W0XA 1GMGA 2AZ0A 2ZQMA 2UU9B 4UV8A 2UUBO 2CH7B 4G2KA 2IW5A 4LWSA 2EILC 5E79Z 3HKBB 1PNMA 2EULA 2NR5A 4NXMB 5KAIZ 5C8YB 3RN4A 2WLLA 4JV5B 3TJTA 1OCZB 1GM7A 2MW2B 2EZOA 1H38A 3FAVB 1R3JC 3JASA 5LHHA 3ZMSA 1HNZB 2NN4A 3ASNC 3A0RA 3AK3A 3CWBH 3CP1A 4MVUA 5FNVB 3F5TA 4B3RO 4R50A 4XDKA 3QVNA 4X66O 4LF4B 1NR1A 3S3WA 3THOA 2IH3C 3RW0A 3WG7C 2VS0A 4CS2A 1F7YA 1PNLA 1ZL8A 2EJRA 4MS2A 4YHHB 5KHKA 3SPGA 1JPXA 4DUYB 4PJ0Z 3H1HH 4ASUG 1FXHA 4DUZB 2JJ2G 1K97A 4CH4A 2Q7GA 2UXNA 4OX9O 4TT3G 4UCRA 4JGSA 2ILMA 2HHHO 1FXKA 2DJVA 4JTCB 4FFBA 3ZBHA 3PJSK 3O9OA 5L3BA 2EIJC 1EM1A 1FFXB 4GZRB 1VF5B 1ZTEA 4MVZA 3JSLA 1VIBA 1H2KA 2WWWA 4Q20A 2PI5A 3W7SA 4DRXA 3QO8A 1KECA 3JALB 3GWKC 1AP5A 1NVPD 4I4TA 4DV6B 2DYRC 2DWEC 4DR6B 1HR0O 3ZIAG 4D6TH 1NS1A 4NTWA 1KP2A 2QDOA 3AG1C 4DR3B 1K92A 2DWDC 4L8JA 1CEZA 5F2VO 4PD4F 1JJOA 1V54B 1KBHA 1GKFA 4GYCB 4OX9B 5CMUA 3E83A 4I55B 1MSDA 3HKEB 3TETA 1FFTB 1AJNA 3G6EV 5KUKA 5J2TA 2BTOA 2A7WA 1KMIZ 3QNEA 4DV4B 1OJHA 3OW2U 1KD1W 1KP3A 5EZYB 4WF9V 3ABUA 4D7SA 1BT8A 2ZDIC 2XAFA 5J2TB 1YVWA 1M4UA 3CXHF 3X2QC 1Q6HA 1RM1B 2JEXA 2BOBC 3ZRVA 3LNMB 2AHZA 1P4RA 1F51A 3TK1A 4FLUA 3ZHUA 3RBZA 5FPOA 3OGIB 1YEWA 3FB6C 2M7WA 4X1IB 4DV3B 1VF7A 1YSCA 1F4MA 5E1AC 1WA8A 3FX7A 1S72V 3BRCA 1B6QA 2XOKG 4Z1VA 1GM8A 1AJPA 4PELA 3CCUV 1TAEA 4O4HA 2OTJV 1GTOA 5BR8B 2FB5A 2RCVA 3CCMV 1YJ9V 1GAXA 2AXTZ 5LXTA 2JIZG 5EBLC 3K08A 5CBGA 1IBMB 5CB4B 2H8PC 2N04A 4F4LA 5IYCO 1SC5B 1PD3A 1RM1C 5LGUA 4X20B 4FPPA 4GKKO 5KHHA 3G67A 1Q81W 4EKWA 5B3SC 3ABKB 3ZN1A 3K04A 1Q7YW 2P90A 3JD1A 3FB7C 2UXCO 3RGBA 5KHIA 2FKXA 4IIJB 5LMUB 2EIKC 2F4VB 4JAUA 4UCVA 5GTHZ 3CCJV 2HR3A 1VQNV 2GSMB 1BHAA 2B9ZA 1QLEC 2JEUA 5JCOA 3SYPA 4AI8A 2XASA 1AR1B 3C3TA 1IBLO 4KHPO 2WLLB 4DR7B 5LMUO 5H9CA 4DR1O 1TVKB 1EBOA 1Y6XA 3CRQA 1OCOC 1MA1A 2Q73A 2WA3A 4JV5O 1PV0A 1NQTA 4PA6A 4NKGB 5L3EA 2JJ1G 3AG4B 4JYAB 4H44B 2GUZB 3LSQA 4DV1O 3FYIB 1YJNV 3F5WC 3BCCH 2YXHA 3H1IH 3BVOA 4I7ZB 1WP8A 4U3FH 3JASB 2KSDA 3QO5A 1G8MA 3ZX6A 3ZRWB 1YITV 2QWOB 4JI1B 4X88A 5L3CA 4OXSA 2YICA 2CGOA 5TISZ 5ITZA 3FB5C 5LXTB 2XT9A 4EFEA 2R9AA 4AILC 3LDDA 2R70A 1JR9A 1H2GA 4TWKA 2ZKOA 2YXLA 1XREA 5FLXN 3FAVA 2F93B 1GO3F 4JI6B 1UJWB 1JJ2U 2P7TC 4UCTA 2ODMA 4KFMA 1L0NH 1WN7A 1DF5A 1OCOB 1L1FA 5C8YA 4P9PA 1QLEB 1EFRG 2HKOA 4J42A 3R65A 3SJBC 2E74B 2CK3G 4DXWA 1RSOA 3AG4C 2P4KA 5B1OA 5JCOC 1FAFA 1OV9A 4H37A 3EFFK 2ETNA 3STLC 5LMNB 2F23A 3VBBA 2ARHA 3L72H 2ZR3A 4O4IB 1SKVA 2KG7A 2RJZA 5EBWC 1YHQV 1BHBA 1XHZA 3T1CA 4ZIBA 1LUVA 3M99B 2PGGA 4JI5O 2X6CA 2ADPA 1XEQA 2DYSB 5KMGA 4MVOA 4DW1A 1VQ4V 2RDCA 4GCZA 4C7UA 2DE0X 1O9HA 1NVPB 3UKMA 4JI8B 4DV7B 1THZA 4O2AB 3I5DA 4GKJO 5LOVA 3K3WA 4JYYA 4J10A 2YXYA 1K4DC 1VQPV 3AG3C 4IL6Z 2BSKA 3G80A 4F6EA 4PV1B 3DGEA 2JRIA 2QSAA 4FJCC 1HNXB 1FD9A 2JS5A 1ZL8B 3CRMA 1AB3A 2Y48A 3LSSA 4NTXA 4CH3A 1Q86W 5B1NA 4DV2O 3FB8C 3S3XA 4FM0A 2YUAA 3VQWA 4H33A 3CHXA 1BGYH 2ZE6A 5FL7G 2PTMA 2HLDG 1NR7A 3ETGA 4BIZA 2EINB 5ITZB 1N32O 4U7NA 5B1AC 4IYHA 1V54C 4HZ3A 5EIBC 5J9PC 4GT1A 3E8GA 5CA1B 4LFCB 3E8HA 4GKJB 1Q82W 1V55C 4I9WA 3WB0A 1EN5A 1SQPH 2B1IA 4JI0O 1XNRB 3TXQA 3E2EA 4LP8A 1JQ0A 3CCRV 4F6RA 1DGSA 1FPOA 4O4LB 3UQ8A 1MNGA 5B5EZ 1K33A 2XAJA 3U10A 2LQTA 2K9PA 1O9GA 4NTYA 4K3AA 4TV9A 5LL6Y 2UXCB 2EBOA 1RSOB 5LP6C 2K1EA 4NR1A 2LGQA 1WAZA 4K0KO 3CC4V 2E75B 5HFMA 4DO2A 3WFVA 5KAFZ 1SERA 4ZOLA 5CA1A 4UFZA 2Q5ZA 4DK0A 1QBZA 2Q4PA 1KU9A 2P4VA 3UCSC 4QPKA 4I50B 2CTPA 1SQGA 4LF9O 3W7XA 5IJ9B 3L9DA 1SF9A 2ZE8A 1PNKA 5GW7A 4BWAA 1GRJA 3JD4A 1S0VA 1E1QG 4Z2WA 1EZVH 4YIOA 2FL4A 1M9NA 4TOIA 1OCCB 3HPLC 3N2KA 2IU0A 3UM7A 2JK5C 1AVMA 1FS0G 2QWRB 1MZEA 5JVDB 3UT5A 2E76B 1VQLV 4DR2B 4TQDA 4X62O 3OTOB 4KL1A 1XNQB 3BA8A 4JI2O 1DK1A 4PDVA 4FZ0A 2G38A 4O2AA 2YIAA 4LC1A 2GTAA 2FMLA 4NXMO 4WFBV 1WLEA 1WPBA 3SPIA 3K5OA 1N0NA 3ABKC 2ZIOA 4WBNA 3CC2V 4RQFA 3OE7G 2B1GA 3AK2A 1IVSA 1ORQC 5JJJB 2E5LB 4YY3B 1LR1A 3ZHRA 4Q6GA 2UXBB 4J7ZA 5IE9A 1Q6UA 3RYCB 1BQZA 1QHTA 4RO2A 1BMFG 3D8CA 2YIBD 1OCCC 4LF7B 3HKCA 2X6AA 3ICXA 3K57A 4UVAA 5H6QA 4JYAO 1W0JG 5LP6B 3P3PA 1JCHA 1Q8IA 5JWPA 1MSWD 3AK1A 4DR5B 4O4JB 3AG2C 5GONA 1K5SA 3APOA 1M57C 5LYJA 2LW1A 2A9HA 5IYZA 5LGTA 2ZM6O 1S3JA 2L6LA 1XQ8A 4CZZA 3ABMB 3F7VC 4BW9A 2F4VO 5LHGA 5J2UA 3K5MA 4JI0B 2HJFC 4EB6B 4YIPA 3IC9A 2O57A 3K0DA 3SDLA 2XAGA 2Q6AA 2EIKB 2ZCEA 4X1IA 2CGNA 4MTFA 5BY1A 4I5SA 1I5YA 1HNXO 1COWG 2R72A 1V9PA 1VQ9V 5L3GA 2ZDIA 1VMGA 5B3SB 1XL4A 4LF6B 3LUTB 3DC6A 2VWKA 4DR4O 3Q4HB 1KB9F 2UXXA 3OD4A 3B8NA 1QR9A 1QQCA 4IHJB 4WCEV 1LNQA 1IX9A 1ZUQA 3OUFA 4KXRA 4U3JB 4X65B 1S5JA 4X1KA 2PYLA 1Y76B 1AI7A 5IYBO 2WLNA 5FPRA 1M5IA 3L74H 3ABMC 4ZHQB 4GUNA 2L35A 1XHXA 5J2UB 1VF6C 4I50A 1X59A 3CJHA 3K59A 2CTQA 3JAWB 4FLTA 1NTZH 3ABLC 3P32A 1NU1H 4DUYO 1CXZB 4O4JA 2P5OA 2FYUH 4J9ZB 3CMEV 4HNAB 1BL8A 2UUBB 3SPJA 4CC6A 4JI7B 2Q7HA 1M57B 4LBEC 3QG5A 4UV9A 4W4KA 2Q69A 4IIJA 1BS3A 4JAVA 2F43G 2OCCB 1T5EA 3APQA 2E5LO 2CDYA 1GN4A 1Z2GA 1XUQA 4HAMA 1AI4A 4J9YB 4TSFG 3RYFA 3RFRA 5GTIZ 3CEIA 2VRZA 1Q90D 3TCUA 2UXDO 3VQYA 2WLHA 3ZCCA 2N05A 2Y0PA 1NZ6A 1L8DA 1K8AW 4MTOA 5K1PA 2EILB 2UUCO 3IC7A 3K06A 5IJ0B 4MVQA 5KA5A 2ZNJA 3RYIA 3RWRD 3JD2A 5DECA 5JVDA 4JYCA 3JCZA 1R3KC 2AZ2A 2DN9A 2Q9LA 2QJ1A 1DF4A 4NB5A 1BQ0A 2WAMA 2DQ0A 4FM1A 4NXNO 5LA6A 5JH7A 2QE7G 4A5UB 2QWQB 3HKBA 2AHYA 2RN9A 1YDXA 1GN6A 1XDCA 3E22B 2KKWA 4LFBO 2XAHA 4B3SB 5LYJB 1NI8A 4OPAA 4FFKA 3CCVV 4JI3O 4ABMA 2DMXA 3E86A 1Y76A 1X4TA 4YJ3A 1N32B 4U3JA 4Z1MG 5AG2A 1MABG 4O2BA 3E35A 1ZAUA 2LW7A 3CC7V 3UT5B 2JVDA 2PI4A 1M93A 2QM4A 1BCCH 5JQGB 3OTOO 4L87A 1EN4A 2IJKA 3JARB 3K79A 3UO2A 2A79B 2VQFB 4GLXA 5LP6A 2GV9A 2WA4A 4MT8A 1A32A 3CX5F 3QF7A 3I56V 1XMQB 3QTCA 1J95A 1IDSA 4ZI7B 4LF5B 2YSUB 2XHBA 3C90A 1H2NA 3H9VA 2P22C 1H2MA 4LFAO 3G6BA 4I55A 4JI5B 1VQOV 5D5QA 1W0KG 2YDEA 3BAAA 4FMTA 1GK9A 4OPHA 3JAMN 1FKAO 2JS3A 1J5EO 2XUMA 3RYHB 4EFBA 1XBLA 2W6JG 4HBNA 2Y69B 1BE3H 2FTKA 5JJEB 2EIMB 2HVJC 3RVYA 5CA3A 2DW4A 1SESA 1S76D 4PA4A 1CP9A 4QJFB 1VP7A 4O4IA 4R8CA 4DRXB 4O2BB 1HNWB 4JTAB 3SYOA 3M7MX 2GHYA 3SPHA 5KX5A 4JI2B 1JA8A 4JPRA 5H6RA 3DC5A 4RAIA 4LF9B 4W4LA 5A9GA 4UVBA 4J41A 4KHPB 1QU7A 5LBQA 1G4YB 2UUAO 4B08A 2NLJC 1E79G 5IJ0A 4F6RB 5KHJA 3MAQA 1D5AA 4JI1O 1P49A 2EIMC 4FLWA 2M6YA 3J7AU 4WFGA 4WFAV 1Y67A 2ZE5A 4LFAB 1LUWA 2OCHA 4MTXA 3SYAA 5BXZA 4DR1B 1NTKH 3ABLB 2D2CB 3P3NA 1H2SB 4PA7A 4G27B 2VQEO 4MTGA 2WLJA 1NJIW 1AR4A 4KUMA 2PUSA 1KUQA 3E22A 1VQMV 2X7RB 1R6KA 3ZRSA 4CH5A 4X64B 2PZSA 2AW9A 3N2GB 2HP8A 3VQVA 4J7JA 1M56C 5IY5C 1AROP 1PL4A 3SJAC 3ZMVA 2ZR2A 4GKKB 3B40A 2E3CA 3AG1B 1TUBA 3CB2A 3IGAC 3W7TA 3KKYA 2IJHA 5CA0A 4GX5A 3DTUB 5LHIA 5FNVA 4LFCO 2MK3A 4JAAA 2QM8A 2HFEC 4YJ3B 4R6ZA 1E1RG 1YF2A 4YJ2B 3NR7A 1L0LH 1XMOB 2IU3A 3HB3B 5KMGB 4BIUA 2WPDG 1OCRC 1JMKC 3CCQV 4DUZO 1V55B 2BE3A 3HR0A 3L70H 1YXBA 4RWUA 1I94B 5EC2C 3CMAV 1K9MW 5A2QN 3KCXA 4TV8A 1HNWO 5JH7B 3X2QB 2UU9O 4UUJC 5EZYA 3ZMTA 3B2EE 3LDEA 2ITCC 3K58A 1N33B 2P06A 4EB6A 4FLVA 4FK5C 1P7BA 1BSMA 2UUAB 1R1BA 4GX2A 2B5UA 1TGOA 2JGUA 3JAWA 3ZHVA 4B3RB 1N4CA 3BPZA 2UXDB 4JYBA 2YEVA 2XAQA 1H8EG 2QM7A 3CCSV 3T4DA 3WU2Z 1I08A 5HFLA 1KQSU 2ITDC 4P9OA 4DV3O 3K03A 2DYRB 2GTSA 1GN3A 1SS3A 3HKCB 4JZGA 4DYLA 3ASOC 1Y74B 2JGDB 3STZC 5JJNB 3JARA 3CPWU 5B66Z 1P7GA 3OFNG 1XL6A 1WPXA 3E8BA 1JVMA 2ZT9B 4K0KB 1S5LZ 3H1KH 3J80N 2RQ6A 4GX1A 2BTQB 1K4CC 1NT2B 2ZXWC 2WLKA 1Q5OA 3J81N 2VWJA 2LFRA 1Q3EA 1N36B 4AQYB 2QKCA 5LGNA 5IT9N 5IJ9A 5C93A 1U96A 2GUZA 5KLVH 4PHZA 3W7WA 3CCLV 4NYKA 2Z3YA 3ZN0A 4ICGA 1Y4MA 4LH6A 1UPGA 1YTFB 1SQQH 4DR6O 3H01A 1U97A 4JTDB 4LF6O 4YJ2A 1N33O 1R73A 1PP9H 2W0FC 1FJGO 2Q68A 2ADQB 1NTMH 3DXRB 2YC0A 3CRRA 3SR2C 3MD0A 3H1LH 3OUSA 4IGGA 2KQXA 3OGCC 3D3IA 4QPJA 3I55V 2IH1C 3BA9A 4P30A 1W59A 4JI3B 2EINC 2DYSC 3FD9A 3K9SA 1GH6A 4KP4A 3CSXA 4QIWF 1TUEB 3ASOB 1US6A 2GBOA 1FJGB 4LNUA 2HVKC 4X1KB 2C2AA 1IURA 5DM6V 5EBMC 1YZBA 1K5QA 2ZM6B 1DTOA 4E4EA 2UUCB 1RPRA 4LR3A 3T4ZA 2DQ3A 2H94A 3H1JH 4FLXA 4K35A 2YEVB 4FZ1A 1HR0B 2BTQA 3CJHB 3ABTA 3IFXA 1DLBA 2Q8VA 4LF7O 3OR7C 3ML0A 2X6BA 2Q7EA 1SZTA 1N36O 3OR6C 4MW8A 4B3TO 4CH6A 1KC8W 1Y74A 2JGDA 4X62B 1WB7A 1H2LA 4K8XA 2PF4E 4HYOA 3Q4HA 3LNNA 5IDJA 3JAKA 4ZKIA 2F1MA 4FLZA 1ENVA 1SQFA 4K8ZA 4EEQA 1VQKV 4X66B 1AR5A 5L3DA 5KUMA 3UO3A 5L3FA 4I9QA 2OWOA 4UVCA 4QE9A 5BZBA 5IYZB 3TGUH 1K34A 1FXKB 2OTLV 1OCRB 3SGIA 1WP7A 3MHSC 3O65A 2QTSA 2QEXV 2LFSA 4JI6O 4DK1A 4JASA 1WB8A 4DR3O 5H2FZ 1NH2B 5CA0B 1Z5WA 4LF4O 4J80A 5EIBD 2RMKB 2IM9A 2IJIA 3IJ4A 4MVSA 3W7UA 5EYPB 3PN1A 5DN6G 1QR8A 3RT3C 4DV4O 1JFFB 1OHHG 3CYOA 2QKSA 1AJQA 4WFFA 1IXBA 3MHHC 3N2GA 1Q6IA 2LP7A 3A0BZ 3D36A 1JOYA 3T2MA 3HKDA 5KA6A 3SJCC 4DV0B 4B3MO 3NXSA 1MMMA 1XNRO 2KB1A 2P6JA 4I0XB 4LWSB 5EK0A 2CH7A 2CTWA 3OAAG 4MSWC 3T1YO 2HEPA 3SPCA 3D36C 4TQFA 2CTRA 3EVKA 3A8TA 4XDLA 1I5XA 2QTOA 2VQEB 3B4SA 2XNDG 1G1XB 1XI1A 3WB2A 1EZJA 4MVRA 4CS4A 1PM9A 3TXSA 2WSSG 1JFFA 1SA0B 3ZHQA 1I7FA 4J11A 3JATA 4DR5O 1KYOF 1SA0A 3L71H 3IAYA 3ETEA 4DR4B 2PY5A 4N21A 1IZ3A 2ATKC 4X64O 3FYEB 4X8AA 2Y4TA 4BR6A 1Q43A 4UCSA 5D5PA 3AEIA 3K5NA 3B09A 4BIOA 5IWAO 4PDLA 1IBLB 1ZX3A 3JD3A 2X0LA 1R6NA 3JAKB 5DEDA 3ZHTA 3WG7B 5BMVA 4UCUA 1HWYA 4G28B 2CAZC 1IBKO 3RYFB 2YS8A 1BZKA 3OT7A 4DV2B 2OIEA 5CBFA 2DOSA 2QGNA 4DV6O 2ZNIA 3GWOA 2IJJA 3F7YC 4YHHO 2CE4A 4QGPA 3CS5A 1WNSA 5IYDO 4UB8Z 2Q67A 2W6IG 4O4LA 1YI2V 1R3LC 4DW0A 1S5HC 2UXBO 3K0GA 3BEHA 1SZXA 2QKAA 1ROPA 3ZRXA 3T1YB 2F66C 4UCOA 3WB1A 4DV7O 2YI9A 5BR8O 4LFBB 2R9RB 3P30A 2OYQA 3T1HB 3CRAA 1HNZO 2HHHB 1UFIA 4MVMA 4E2LA 1HP8A 1URFA 4QNHB 1B04A 3GVMA 1RFYA 1VQ8V 3CRCA 1NKDA 1TVKA 2YIDA 4PI2A 4LF8O 1HDJA 3ZRWA 2JDIG 3N27A 2Y69C 1YCIA 4D7TA 4ZBMA 1SQBH 1QVFU 2BSKB 3LDCA 3OM3B 1I94O 5IY5B 3A2FA 1RP3B 1SQVH 1TA8A 1VQ5V 3MDSA 2LGWA 3LSUA 1D2DA 2PYJA 4UB6Z 4TUYA 3JATB 2V7QG 2V4DA 3GB7C 4PI0A 1WA8B 1XILA 1B06A 1XMQO 1ZSPA 1P84F 1SETA 4OGQB 5CBHA 3JD0A 4DV5B 3K9AA 5K1XA 4LH7A 4IT5A 1XOUA 1XMOO 4I0XA 2NNUA 1MG1A 2Z5UA 4LF5O 1F4NA 4JI4B 2KG7B 4B3TB 1AI5A 1K73W 1AP6A 1J5EB 4FLYA 3DXRA 4BAYA 2ZINA 2LO1A 1PPJH 5KHGA 4TV8B 2AGAA 3BFRA 2F95B 3SYCA 4B3SO 1VQ7V 1SQXH 4H13B 4FIPC 2H3OA 3ZMZA 2QR4A 1N34O 4FM2A 1YIJV 2ZIMA 3KCYA 3QO7A 1HW7A 2OT5A 3KZIZ 3ETDA 4LCUC 4X20A 1WJZA 4ZI7A 4LNUB 2EZPA 3CE2A 4DV0O 4B3MB 5IWAB 3AG3B 3ZMUA 5B1BB 5CN0A 2R9IA 4J7KA 4AQYO 1JX9A 1XNQO 5GONB 1KKCA 3ZHSA 3OTFA 3RYIB 3N2KB 5LA6B 5JQGA 3AG2B 1Y66A 4X9QA 1M1KW 1CPYA 2QWPB 4QE7A 2QA4V 1GN2A 3E89A 1GM9A 2Q0OC 3OMIB 4JI7O 4RUFA 3U11A 3BHPA 3JYCA 3M8AA 3G71V 1M90W 4JI4O 2HJDA 2YIBA 1MZFA 4YY3O 3B77A 4NVPA 1EN6A 2YI8A 3HKEA 2Z0AA 2WLIB 4DV5O 4MW3A 4UXNA 4I4TB 4PDMA 3JALA 4JF3A 1KKDA 3OMAB 1IBMO 3VOUA 1RPOA 2RNBA 2HG5C 1OZ0A 1ZWIC 1R6TA 1S77D 4CC5A 2V1DA 1FXVA 1FXKC 3L75H 3U0ZA 1QNMA 1QCEA 2A0LA 1VQ6V 4DR2O 3G4SV 1FFXA 1D5NA 5EC1C 1FYJA 3AG7A 1F23A 1R3IC 1ZLZA 4U7OA 4B7KA 2A3QA 2WLIA 5B1AB 1TUBB 5LMNO 4GX0A 4WFEA 3EHBB 4ZHQA 5BMVB 1OCZC 3BY6A 4LF8B 1PL0A 2IBZH 4X65O 3JCUZ 3SYQA 3ZS8C
chains in the Genus database with same CATH topology
4LR3A 5K1PA 4FLXA 1HR0B 2BTQA 1N34B 5IJ0B 4JYAB 2ZNJA 3RYIA 4FFBB 3RWRD 5JVDA 2EX3A 2Q7EA 4ZOLB 4DV1B 3JASB 4CH6A 4IHJA 4X62B 4K8XA 5CB4A 2QJ1A 3RYHA 4JI1B 3LNNA 4TV9B 3JAKA 4FM1A 1IBKB 4HNAA 2F1MA 5ITZA 5LA6A 5JH7A 4FLZA 1SQFA 5LXTB 4EFEA 2R9AA 4EEQA 4K8ZA 3HKBA 4AILC 4X66B 2R70A 5LOVB 3E22B 2KKWA 2YXLA 4I9QA 2OWOA 2F93B 4O4HB 4B3SB 4JI6B 5IYZB 5LYJB 3BABA 4UCTA 3SGIA 4NXNB 1WN7A 5C8YA 1X4TA 4YJ3A 4DK1A 1N32B 4U3JA 3SJBC 4FVMA 4O2BA 1RSOA 5JCOC 1ZAUA 4CS3A 3UT5B 3DSQA 5CA0B 2JVDA 1Z5WA 5LMNB 4O4IB 5JQGB 1M93A 2QM4A 1SKVA 2RJZA 5EIBD 1XHZA 4ZIBA 2IM9A 3JARB 2PGGA 2VQFB 4GLXA 5LP6A 2GV9A 5EYPB 3PN1A 4AHCA 3HKDB 4WBNB 1JFFB 5KMGA 3QF7A 3ZEDA 1G6UA 3VQXA 1XMQB 3QTCA 5KX5B 3N2GA 4ZI7B 1O9HA 3RYCA 3HKDA 4LF5B 3SJCC 4DV0B 2XHBA 4JI8B 5EYPA 4DV7B 4TUYB 4O2AB 2P22C 5LOVA 2HEPA 4TQFA 4I55A 4JI5B 3ETQA 2VQEB 5D5QA 3FFQA 1XI1A 3BAAA 3WB2A 2Q0AA 3JSNA 3K5LA 4CS4A 4X1YB 3RYHB 4EFBA 4HBNA 1Z5VA 1JFFA 1SA0B 5JJEB 1I7FA 1HNXB 3JATA 1SA0A 3IAYA 4DR4B 2PY5A 2JS5A 4CH3A 4X1YA 4O4IA 4FM0A 3VQWA 3CHXA 1Q43A 4UCSA 2UU9B 5D5PA 4DRXB 3K5NA 4O2BB 1HNWB 2PTMA 3HKBB 3M7MX 4NXMB 1IBLB 5ITZB 5EIBC 5C8YB 3JAKB 5CA1B 4LFCB 5BMVA 4UCUA 5KX5A 4JI2B 4JV5B 4GKJB 2CAZC 3RYFB 3WB0A 1XNRB 4LF9B 4DV2B 3JASA 2ZNIA 1HNZB 4F6RA 1DGSA 5FNVB 4KHPB 4LF4B 1WNSA 4O4LB 3UQ8A 3THOA 4CS2A 4O4LA 3U10A 4B08A 5IJ0A 1O9GA 4YHHB 4F6RB 5KHJA 4TV9A 1D5AA 5KHKA 3MAQA 1P49A 4DUYB 4FLWA 2UXCB 5LP6C 4DUZB 3T1YB 4LFAB 4CH4A 2F66C 2Q7GA 4UCOA 4ZOLA 5CA1A 4UFZA 3WB1A 4DK0A 4UCRA 2YI9A 4DR1B 4LFBB 1KU9A 2OYQA 4FFBA 3T1HB 1H2SB 4I50B 2HHHB 1SQGA 2PUSA 3E22A 4CH5A 5IJ9B 4X64B 2PZSA 1B04A 1FFXB 3N2GB 3VQVA 4BWAA 1TVKA 4PI2A 3JSLA 3SJAC 4TOIA 4GKKB 2E3CA 4D7TA 3N2KA 1TUBA 3CB2A 4DRXA 3JALB 4I4TA 4DV6B 3A2FA 5JVDB 5CA0A 3UT5A 4DR6B 4DR2B 4TQDA 3OTOB 1TA8A 4KL1A 1XNQB 3BA8A 5FNVA 2PYJA 4O2AA 2YIAA 4TUYA 3JATB 2V4DA 4DR3B 4PI0A 4YJ3B 1WPBA 4L8JA 4YJ2B 1JJOA 3K5OA 1XMOB 2ZIOA 4WBNA 5KMGB 4GYCB 4OX9B 4DV5B 5K1XA 1JMKC 4I55B 4LH7A 3HKEB 5JJJB 2E5LB 4YY3B 1I94B 4Q6GA 4JI4B 4TV8A 2UXBB 5JH7B 4B3TB 3RYCB 5J2TA 1QHTA 2BTOA 1KMIZ 4DV4B 2YIBD 5EZYA 1J5EB 4LF7B 3HKCA 4FLYA 3B2EE 3ICXA 5EZYB 3K57A 4D7SA 3K58A 1N33B 2ZINA 5LP6B 5J2TB 1Q8IA 4EB6A 5KHGA 1M4UA 4TV8B 4FLVA 4DR5B 4O4JB 5GONA 2UUAB 2F95B 5LYJA 5IYZA 1TGOA 2JGUA 3JAWA 1XQ8A 4B3RB 3BPZA 4FLUA 4BW9A 2UXDB 5FPOA 5J2UA 1YEWA 4X1IB 4FM2A 3K5MA 2ZIMA 4DV3B 1VF7A 4JI0B 1HW7A 4EB6B 3BRCA 4X20A 4ZI7A 4LNUB 2ZCEA 4B3MB 4X1IA 3HKCB 5IWAB 1TAEA 4O4HA 5BR8B 5JJNB 3JARA 2R72A 1V9PA 5GONB 4K0KB 3OTFA 3RYIB 5LXTA 3N2KB 5LA6B 5JQGA 1IBMB 2RQ6A 2BTQB 1NT2B 4LF6B 2VWKA 1Q5OA 2VWJA 5CB4B 1QQCA 4IHJB 1Q3EA 1N36B 4AQYB 4U3JB 4X65B 4X20B 1S5JA 4X1KA 2PYLA 3U11A 3BHPA 5KHHA 5IJ9A 5FPRA 1M5IA 2YIBA 4PHZA 4ZHQB 1XHXA 4NVPA 5J2UB 2YI8A 3HKEA 4I50A 4LH6A 3K59A 3JAWB 4FLTA 4I4TB 3JALA 3RGBA 5KHIA 4YJ2A 4IIJB 4O4JA 5LMUB 2P5OA 2F4VB 4UCVA 4HNAB 2UUBB 4CC6A 4JI7B 4CC5A 2Q7HA 3SR2C 3U0ZA 3QG5A 4IIJA 1FFXA 5JCOA 1T5EA 3BA9A 4JI3B 1TUBB 3RYFA 3RFRA 4ZHQA 3CSXA 5BMVB 4DR7B 4LF8B 1FJGB 4LNUA 4X1KB 3VQYA 1TVKB 2ZM6B 1L8DA 2UUCB 3ZS8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJC C;  3QG5 A;  3ZS8 C;  2F66 C;  2CAZ C;  1SKV A;  1NT2 B;  3B2E E;  3CSX A;  3SJB C;  3ICX A;  3SJA C;  3THO A;  3QF7 A;  1X4T A;  2JS5 A;  2P22 C; 
#chains in the Genus database with same CATH topology
 3OEE G;  2QWN B;  1MOF A;  4CBC A;  3D3Q A;  2GDS A;  4P2Z A;  1N34 B;  3SJQ C;  1W2B U;  1K7D A;  2EJ7 A;  4FFB B;  1N0J A;  2EX3 A;  2ZE7 A;  4ZOL B;  4DV1 B;  2BOC C;  4IHJ A;  4PA9 A;  4PDR A;  2VQF O;  2ZD9 A;  5CB4 A;  3RYH A;  2Y0I A;  3CD6 V;  4TV9 B;  3EXA A;  3FKS G;  3CXC U;  1IBK B;  4HNA A;  1QVG U;  3ZJZ A;  4R7C A;  4IYI A;  4X89 A;  4XBF A;  2P67 A;  4BW5 A;  3A0H Z;  3CCE V;  5LOV B;  4DR7 O;  4H0L B;  1VAR A;  4JZ2 A;  3OEH G;  4O4H B;  5B1B C;  1NBM G;  3BAB A;  4NXN B;  2BCC H;  4FVM A;  1IXM A;  3C3S A;  2EIJ B;  4N23 A;  4RQE A;  3RVZ A;  4CS3 A;  3DSQ A;  1YTF D;  3R66 A;  4YXW G;  1YJW V;  4B7E A;  2OCC C;  3KG2 A;  3L73 H;  4AHC A;  3HKD B;  1H8H G;  4WBN B;  3ZED A;  4JI8 O;  1G6U A;  3VQX A;  4RUE A;  5KX5 B;  1VF6 A;  3RYC A;  1I0H A;  2OIG A;  5EYP A;  1N8R W;  4TUY B;  1QLN A;  4PA3 A;  1NH2 D;  2CUG A;  1AIL A;  3ASN B;  2N74 A;  3ETQ A;  2A06 H;  1SRY A;  3FFQ A;  1M56 B;  5H5N A;  3T1H O;  2Q0A A;  3E8F A;  3JSN A;  3K5L A;  4X1Y B;  4XDJ A;  1Z5V A;  4WFH A;  3OMN B;  1B3Q A;  1PKX A;  2D3O W;  3B8M A;  1K3E A;  2Y4U A;  1VEW A;  4X1Y A;  2ZXW B;  1AI6 A;  2LJ2 A;  2WLM A;  2XTA A;  2W0X A;  1GMG A;  2AZ0 A;  2ZQM A;  2UU9 B;  4UV8 A;  2UUB O;  2CH7 B;  4G2K A;  2IW5 A;  4LWS A;  2EIL C;  5E79 Z;  3HKB B;  1PNM A;  2EUL A;  2NR5 A;  4NXM B;  5KAI Z;  5C8Y B;  3RN4 A;  2WLL A;  4JV5 B;  3TJT A;  1OCZ B;  1GM7 A;  2MW2 B;  2EZO A;  1H38 A;  3FAV B;  1R3J C;  3JAS A;  5LHH A;  3ZMS A;  1HNZ B;  2NN4 A;  3ASN C;  3A0R A;  3AK3 A;  3CWB H;  3CP1 A;  4MVU A;  5FNV B;  3F5T A;  4B3R O;  4R50 A;  4XDK A;  3QVN A;  4X66 O;  4LF4 B;  1NR1 A;  3S3W A;  3THO A;  2IH3 C;  3RW0 A;  3WG7 C;  2VS0 A;  4CS2 A;  1F7Y A;  1PNL A;  1ZL8 A;  2EJR A;  4MS2 A;  4YHH B;  5KHK A;  3SPG A;  1JPX A;  4DUY B;  4PJ0 Z;  3H1H H;  4ASU G;  1FXH A;  4DUZ B;  2JJ2 G;  1K97 A;  4CH4 A;  2Q7G A;  2UXN A;  4OX9 O;  4TT3 G;  4UCR A;  4JGS A;  2ILM A;  2HHH O;  1FXK A;  2DJV A;  4JTC B;  4FFB A;  3ZBH A;  3PJS K;  3O9O A;  5L3B A;  2EIJ C;  1EM1 A;  1FFX B;  4GZR B;  1VF5 B;  1ZTE A;  4MVZ A;  3JSL A;  1VIB A;  1H2K A;  2WWW A;  4Q20 A;  2PI5 A;  3W7S A;  4DRX A;  3QO8 A;  1KEC A;  3JAL B;  3GWK C;  1AP5 A;  1NVP D;  4I4T A;  4DV6 B;  2DYR C;  2DWE C;  4DR6 B;  1HR0 O;  3ZIA G;  4D6T H;  1NS1 A;  4NTW A;  1KP2 A;  2QDO A;  3AG1 C;  4DR3 B;  1K92 A;  2DWD C;  4L8J A;  1CEZ A;  5F2V O;  4PD4 F;  1JJO A;  1V54 B;  1KBH A;  1GKF A;  4GYC B;  4OX9 B;  5CMU A;  3E83 A;  4I55 B;  1MSD A;  3HKE B;  3TET A;  1FFT B;  1AJN A;  3G6E V;  5KUK A;  5J2T A;  2BTO A;  2A7W A;  1KMI Z;  3QNE A;  4DV4 B;  1OJH A;  3OW2 U;  1KD1 W;  1KP3 A;  5EZY B;  4WF9 V;  3ABU A;  4D7S A;  1BT8 A;  2ZDI C;  2XAF A;  5J2T B;  1YVW A;  1M4U A;  3CXH F;  3X2Q C;  1Q6H A;  1RM1 B;  2JEX A;  2BOB C;  3ZRV A;  3LNM B;  2AHZ A;  1P4R A;  1F51 A;  3TK1 A;  4FLU A;  3ZHU A;  3RBZ A;  5FPO A;  3OGI B;  1YEW A;  3FB6 C;  2M7W A;  4X1I B;  4DV3 B;  1VF7 A;  1YSC A;  1F4M A;  5E1A C;  1WA8 A;  3FX7 A;  1S72 V;  3BRC A;  1B6Q A;  2XOK G;  4Z1V A;  1GM8 A;  1AJP A;  4PEL A;  3CCU V;  1TAE A;  4O4H A;  2OTJ V;  1GTO A;  5BR8 B;  2FB5 A;  2RCV A;  3CCM V;  1YJ9 V;  1GAX A;  2AXT Z;  5LXT A;  2JIZ G;  5EBL C;  3K08 A;  5CBG A;  1IBM B;  5CB4 B;  2H8P C;  2N04 A;  4F4L A;  5IYC O;  1SC5 B;  1PD3 A;  1RM1 C;  5LGU A;  4X20 B;  4FPP A;  4GKK O;  5KHH A;  3G67 A;  1Q81 W;  4EKW A;  5B3S C;  3ABK B;  3ZN1 A;  3K04 A;  1Q7Y W;  2P90 A;  3JD1 A;  3FB7 C;  2UXC O;  3RGB A;  5KHI A;  2FKX A;  4IIJ B;  5LMU B;  2EIK C;  2F4V B;  4JAU A;  4UCV A;  5GTH Z;  3CCJ V;  2HR3 A;  1VQN V;  2GSM B;  1BHA A;  2B9Z A;  1QLE C;  2JEU A;  5JCO A;  3SYP A;  4AI8 A;  2XAS A;  1AR1 B;  3C3T A;  1IBL O;  4KHP O;  2WLL B;  4DR7 B;  5LMU O;  5H9C A;  4DR1 O;  1TVK B;  1EBO A;  1Y6X A;  3CRQ A;  1OCO C;  1MA1 A;  2Q73 A;  2WA3 A;  4JV5 O;  1PV0 A;  1NQT A;  4PA6 A;  4NKG B;  5L3E A;  2JJ1 G;  3AG4 B;  4JYA B;  4H44 B;  2GUZ B;  3LSQ A;  4DV1 O;  3FYI B;  1YJN V;  3F5W C;  3BCC H;  2YXH A;  3H1I H;  3BVO A;  4I7Z B;  1WP8 A;  4U3F H;  3JAS B;  2KSD A;  3QO5 A;  1G8M A;  3ZX6 A;  3ZRW B;  1YIT V;  2QWO B;  4JI1 B;  4X88 A;  5L3C A;  4OXS A;  2YIC A;  2CGO A;  5TIS Z;  5ITZ A;  3FB5 C;  5LXT B;  2XT9 A;  4EFE A;  2R9A A;  4AIL C;  3LDD A;  2R70 A;  1JR9 A;  1H2G A;  4TWK A;  2ZKO A;  2YXL A;  1XRE A;  5FLX N;  3FAV A;  2F93 B;  1GO3 F;  4JI6 B;  1UJW B;  1JJ2 U;  2P7T C;  4UCT A;  2ODM A;  4KFM A;  1L0N H;  1WN7 A;  1DF5 A;  1OCO B;  1L1F A;  5C8Y A;  4P9P A;  1QLE B;  1EFR G;  2HKO A;  4J42 A;  3R65 A;  3SJB C;  2E74 B;  2CK3 G;  4DXW A;  1RSO A;  3AG4 C;  2P4K A;  5B1O A;  5JCO C;  1FAF A;  1OV9 A;  4H37 A;  3EFF K;  2ETN A;  3STL C;  5LMN B;  2F23 A;  3VBB A;  2ARH A;  3L72 H;  2ZR3 A;  4O4I B;  1SKV A;  2KG7 A;  2RJZ A;  5EBW C;  1YHQ V;  1BHB A;  1XHZ A;  3T1C A;  4ZIB A;  1LUV A;  3M99 B;  2PGG A;  4JI5 O;  2X6C A;  2ADP A;  1XEQ A;  2DYS B;  5KMG A;  4MVO A;  4DW1 A;  1VQ4 V;  2RDC A;  4GCZ A;  4C7U A;  2DE0 X;  1O9H A;  1NVP B;  3UKM A;  4JI8 B;  4DV7 B;  1THZ A;  4O2A B;  3I5D A;  4GKJ O;  5LOV A;  3K3W A;  4JYY A;  4J10 A;  2YXY A;  1K4D C;  1VQP V;  3AG3 C;  4IL6 Z;  2BSK A;  3G80 A;  4F6E A;  4PV1 B;  3DGE A;  2JRI A;  2QSA A;  4FJC C;  1HNX B;  1FD9 A;  2JS5 A;  1ZL8 B;  3CRM A;  1AB3 A;  2Y48 A;  3LSS A;  4NTX A;  4CH3 A;  1Q86 W;  5B1N A;  4DV2 O;  3FB8 C;  3S3X A;  4FM0 A;  2YUA A;  3VQW A;  4H33 A;  3CHX A;  1BGY H;  2ZE6 A;  5FL7 G;  2PTM A;  2HLD G;  1NR7 A;  3ETG A;  4BIZ A;  2EIN B;  5ITZ B;  1N32 O;  4U7N A;  5B1A C;  4IYH A;  1V54 C;  4HZ3 A;  5EIB C;  5J9P C;  4GT1 A;  3E8G A;  5CA1 B;  4LFC B;  3E8H A;  4GKJ B;  1Q82 W;  1V55 C;  4I9W A;  3WB0 A;  1EN5 A;  1SQP H;  2B1I A;  4JI0 O;  1XNR B;  3TXQ A;  3E2E A;  4LP8 A;  1JQ0 A;  3CCR V;  4F6R A;  1DGS A;  1FPO A;  4O4L B;  3UQ8 A;  1MNG A;  5B5E Z;  1K33 A;  2XAJ A;  3U10 A;  2LQT A;  2K9P A;  1O9G A;  4NTY A;  4K3A A;  4TV9 A;  5LL6 Y;  2UXC B;  2EBO A;  1RSO B;  5LP6 C;  2K1E A;  4NR1 A;  2LGQ A;  1WAZ A;  4K0K O;  3CC4 V;  2E75 B;  5HFM A;  4DO2 A;  3WFV A;  5KAF Z;  1SER A;  4ZOL A;  5CA1 A;  4UFZ A;  2Q5Z A;  4DK0 A;  1QBZ A;  2Q4P A;  1KU9 A;  2P4V A;  3UCS C;  4QPK A;  4I50 B;  2CTP A;  1SQG A;  4LF9 O;  3W7X A;  5IJ9 B;  3L9D A;  1SF9 A;  2ZE8 A;  1PNK A;  5GW7 A;  4BWA A;  1GRJ A;  3JD4 A;  1S0V A;  1E1Q G;  4Z2W A;  1EZV H;  4YIO A;  2FL4 A;  1M9N A;  4TOI A;  1OCC B;  3HPL C;  3N2K A;  2IU0 A;  3UM7 A;  2JK5 C;  1AVM A;  1FS0 G;  2QWR B;  1MZE A;  5JVD B;  3UT5 A;  2E76 B;  1VQL V;  4DR2 B;  4TQD A;  4X62 O;  3OTO B;  4KL1 A;  1XNQ B;  3BA8 A;  4JI2 O;  1DK1 A;  4PDV A;  4FZ0 A;  2G38 A;  4O2A A;  2YIA A;  4LC1 A;  2GTA A;  2FML A;  4NXM O;  4WFB V;  1WLE A;  1WPB A;  3SPI A;  3K5O A;  1N0N A;  3ABK C;  2ZIO A;  4WBN A;  3CC2 V;  4RQF A;  3OE7 G;  2B1G A;  3AK2 A;  1IVS A;  1ORQ C;  5JJJ B;  2E5L B;  4YY3 B;  1LR1 A;  3ZHR A;  4Q6G A;  2UXB B;  4J7Z A;  5IE9 A;  1Q6U A;  3RYC B;  1BQZ A;  1QHT A;  4RO2 A;  1BMF G;  3D8C A;  2YIB D;  1OCC C;  4LF7 B;  3HKC A;  2X6A A;  3ICX A;  3K57 A;  4UVA A;  5H6Q A;  4JYA O;  1W0J G;  5LP6 B;  3P3P A;  1JCH A;  1Q8I A;  5JWP A;  1MSW D;  3AK1 A;  4DR5 B;  4O4J B;  3AG2 C;  5GON A;  1K5S A;  3APO A;  1M57 C;  5LYJ A;  2LW1 A;  2A9H A;  5IYZ A;  5LGT A;  2ZM6 O;  1S3J A;  2L6L A;  1XQ8 A;  4CZZ A;  3ABM B;  3F7V C;  4BW9 A;  2F4V O;  5LHG A;  5J2U A;  3K5M A;  4JI0 B;  2HJF C;  4EB6 B;  4YIP A;  3IC9 A;  2O57 A;  3K0D A;  3SDL A;  2XAG A;  2Q6A A;  2EIK B;  2ZCE A;  4X1I A;  2CGN A;  4MTF A;  5BY1 A;  4I5S A;  1I5Y A;  1HNX O;  1COW G;  2R72 A;  1V9P A;  1VQ9 V;  5L3G A;  2ZDI A;  1VMG A;  5B3S B;  1XL4 A;  4LF6 B;  3LUT B;  3DC6 A;  2VWK A;  4DR4 O;  3Q4H B;  1KB9 F;  2UXX A;  3OD4 A;  3B8N A;  1QR9 A;  1QQC A;  4IHJ B;  4WCE V;  1LNQ A;  1IX9 A;  1ZUQ A;  3OUF A;  4KXR A;  4U3J B;  4X65 B;  1S5J A;  4X1K A;  2PYL A;  1Y76 B;  1AI7 A;  5IYB O;  2WLN A;  5FPR A;  1M5I A;  3L74 H;  3ABM C;  4ZHQ B;  4GUN A;  2L35 A;  1XHX A;  5J2U B;  1VF6 C;  4I50 A;  1X59 A;  3CJH A;  3K59 A;  2CTQ A;  3JAW B;  4FLT A;  1NTZ H;  3ABL C;  3P32 A;  1NU1 H;  4DUY O;  1CXZ B;  4O4J A;  2P5O A;  2FYU H;  4J9Z B;  3CME V;  4HNA B;  1BL8 A;  2UUB B;  3SPJ A;  4CC6 A;  4JI7 B;  2Q7H A;  1M57 B;  4LBE C;  3QG5 A;  4UV9 A;  4W4K A;  2Q69 A;  4IIJ A;  1BS3 A;  4JAV A;  2F43 G;  2OCC B;  1T5E A;  3APQ A;  2E5L O;  2CDY A;  1GN4 A;  1Z2G A;  1XUQ A;  4HAM A;  1AI4 A;  4J9Y B;  4TSF G;  3RYF A;  3RFR A;  5GTI Z;  3CEI A;  2VRZ A;  1Q90 D;  3TCU A;  2UXD O;  3VQY A;  2WLH A;  3ZCC A;  2N05 A;  2Y0P A;  1NZ6 A;  1L8D A;  1K8A W;  4MTO A;  5K1P A;  2EIL B;  2UUC O;  3IC7 A;  3K06 A;  5IJ0 B;  4MVQ A;  5KA5 A;  2ZNJ A;  3RYI A;  3RWR D;  3JD2 A;  5DEC A;  5JVD A;  4JYC A;  3JCZ A;  1R3K C;  2AZ2 A;  2DN9 A;  2Q9L A;  2QJ1 A;  1DF4 A;  4NB5 A;  1BQ0 A;  2WAM A;  2DQ0 A;  4FM1 A;  4NXN O;  5LA6 A;  5JH7 A;  2QE7 G;  4A5U B;  2QWQ B;  3HKB A;  2AHY A;  2RN9 A;  1YDX A;  1GN6 A;  1XDC A;  3E22 B;  2KKW A;  4LFB O;  2XAH A;  4B3S B;  5LYJ B;  1NI8 A;  4OPA A;  4FFK A;  3CCV V;  4JI3 O;  4ABM A;  2DMX A;  3E86 A;  1Y76 A;  1X4T A;  4YJ3 A;  1N32 B;  4U3J A;  4Z1M G;  5AG2 A;  1MAB G;  4O2B A;  3E35 A;  1ZAU A;  2LW7 A;  3CC7 V;  3UT5 B;  2JVD A;  2PI4 A;  1M93 A;  2QM4 A;  1BCC H;  5JQG B;  3OTO O;  4L87 A;  1EN4 A;  2IJK A;  3JAR B;  3K79 A;  3UO2 A;  2A79 B;  2VQF B;  4GLX A;  5LP6 A;  2GV9 A;  2WA4 A;  4MT8 A;  1A32 A;  3CX5 F;  3QF7 A;  3I56 V;  1XMQ B;  3QTC A;  1J95 A;  1IDS A;  4ZI7 B;  4LF5 B;  2YSU B;  2XHB A;  3C90 A;  1H2N A;  3H9V A;  2P22 C;  1H2M A;  4LFA O;  3G6B A;  4I55 A;  4JI5 B;  1VQO V;  5D5Q A;  1W0K G;  2YDE A;  3BAA A;  4FMT A;  1GK9 A;  4OPH A;  3JAM N;  1FKA O;  2JS3 A;  1J5E O;  2XUM A;  3RYH B;  4EFB A;  1XBL A;  2W6J G;  4HBN A;  2Y69 B;  1BE3 H;  2FTK A;  5JJE B;  2EIM B;  2HVJ C;  3RVY A;  5CA3 A;  2DW4 A;  1SES A;  1S76 D;  4PA4 A;  1CP9 A;  4QJF B;  1VP7 A;  4O4I A;  4R8C A;  4DRX B;  4O2B B;  1HNW B;  4JTA B;  3SYO A;  3M7M X;  2GHY A;  3SPH A;  5KX5 A;  4JI2 B;  1JA8 A;  4JPR A;  5H6R A;  3DC5 A;  4RAI A;  4LF9 B;  4W4L A;  5A9G A;  4UVB A;  4J41 A;  4KHP B;  1QU7 A;  5LBQ A;  1G4Y B;  2UUA O;  4B08 A;  2NLJ C;  1E79 G;  5IJ0 A;  4F6R B;  5KHJ A;  3MAQ A;  1D5A A;  4JI1 O;  1P49 A;  2EIM C;  4FLW A;  2M6Y A;  3J7A U;  4WFG A;  4WFA V;  1Y67 A;  2ZE5 A;  4LFA B;  1LUW A;  2OCH A;  4MTX A;  3SYA A;  5BXZ A;  4DR1 B;  1NTK H;  3ABL B;  2D2C B;  3P3N A;  1H2S B;  4PA7 A;  4G27 B;  2VQE O;  4MTG A;  2WLJ A;  1NJI W;  1AR4 A;  4KUM A;  2PUS A;  1KUQ A;  3E22 A;  1VQM V;  2X7R B;  1R6K A;  3ZRS A;  4CH5 A;  4X64 B;  2PZS A;  2AW9 A;  3N2G B;  2HP8 A;  3VQV A;  4J7J A;  1M56 C;  5IY5 C;  1ARO P;  1PL4 A;  3SJA C;  3ZMV A;  2ZR2 A;  4GKK B;  3B40 A;  2E3C A;  3AG1 B;  1TUB A;  3CB2 A;  3IGA C;  3W7T A;  3KKY A;  2IJH A;  5CA0 A;  4GX5 A;  3DTU B;  5LHI A;  5FNV A;  4LFC O;  2MK3 A;  4JAA A;  2QM8 A;  2HFE C;  4YJ3 B;  4R6Z A;  1E1R G;  1YF2 A;  4YJ2 B;  3NR7 A;  1L0L H;  1XMO B;  2IU3 A;  3HB3 B;  5KMG B;  4BIU A;  2WPD G;  1OCR C;  1JMK C;  3CCQ V;  4DUZ O;  1V55 B;  2BE3 A;  3HR0 A;  3L70 H;  1YXB A;  4RWU A;  1I94 B;  5EC2 C;  3CMA V;  1K9M W;  5A2Q N;  3KCX A;  4TV8 A;  1HNW O;  5JH7 B;  3X2Q B;  2UU9 O;  4UUJ C;  5EZY A;  3ZMT A;  3B2E E;  3LDE A;  2ITC C;  3K58 A;  1N33 B;  2P06 A;  4EB6 A;  4FLV A;  4FK5 C;  1P7B A;  1BSM A;  2UUA B;  1R1B A;  4GX2 A;  2B5U A;  1TGO A;  2JGU A;  3JAW A;  3ZHV A;  4B3R B;  1N4C A;  3BPZ A;  2UXD B;  4JYB A;  2YEV A;  2XAQ A;  1H8E G;  2QM7 A;  3CCS V;  3T4D A;  3WU2 Z;  1I08 A;  5HFL A;  1KQS U;  2ITD C;  4P9O A;  4DV3 O;  3K03 A;  2DYR B;  2GTS A;  1GN3 A;  1SS3 A;  3HKC B;  4JZG A;  4DYL A;  3ASO C;  1Y74 B;  2JGD B;  3STZ C;  5JJN B;  3JAR A;  3CPW U;  5B66 Z;  1P7G A;  3OFN G;  1XL6 A;  1WPX A;  3E8B A;  1JVM A;  2ZT9 B;  4K0K B;  1S5L Z;  3H1K H;  3J80 N;  2RQ6 A;  4GX1 A;  2BTQ B;  1K4C C;  1NT2 B;  2ZXW C;  2WLK A;  1Q5O A;  3J81 N;  2VWJ A;  2LFR A;  1Q3E A;  1N36 B;  4AQY B;  2QKC A;  5LGN A;  5IT9 N;  5IJ9 A;  5C93 A;  1U96 A;  2GUZ A;  5KLV H;  4PHZ A;  3W7W A;  3CCL V;  4NYK A;  2Z3Y A;  3ZN0 A;  4ICG A;  1Y4M A;  4LH6 A;  1UPG A;  1YTF B;  1SQQ H;  4DR6 O;  3H01 A;  1U97 A;  4JTD B;  4LF6 O;  4YJ2 A;  1N33 O;  1R73 A;  1PP9 H;  2W0F C;  1FJG O;  2Q68 A;  2ADQ B;  1NTM H;  3DXR B;  2YC0 A;  3CRR A;  3SR2 C;  3MD0 A;  3H1L H;  3OUS A;  4IGG A;  2KQX A;  3OGC C;  3D3I A;  4QPJ A;  3I55 V;  2IH1 C;  3BA9 A;  4P30 A;  1W59 A;  4JI3 B;  2EIN C;  2DYS C;  3FD9 A;  3K9S A;  1GH6 A;  4KP4 A;  3CSX A;  4QIW F;  1TUE B;  3ASO B;  1US6 A;  2GBO A;  1FJG B;  4LNU A;  2HVK C;  4X1K B;  2C2A A;  1IUR A;  5DM6 V;  5EBM C;  1YZB A;  1K5Q A;  2ZM6 B;  1DTO A;  4E4E A;  2UUC B;  1RPR A;  4LR3 A;  3T4Z A;  2DQ3 A;  2H94 A;  3H1J H;  4FLX A;  4K35 A;  2YEV B;  4FZ1 A;  1HR0 B;  2BTQ A;  3CJH B;  3ABT A;  3IFX A;  1DLB A;  2Q8V A;  4LF7 O;  3OR7 C;  3ML0 A;  2X6B A;  2Q7E A;  1SZT A;  1N36 O;  3OR6 C;  4MW8 A;  4B3T O;  4CH6 A;  1KC8 W;  1Y74 A;  2JGD A;  4X62 B;  1WB7 A;  1H2L A;  4K8X A;  2PF4 E;  4HYO A;  3Q4H A;  3LNN A;  5IDJ A;  3JAK A;  4ZKI A;  2F1M A;  4FLZ A;  1ENV A;  1SQF A;  4K8Z A;  4EEQ A;  1VQK V;  4X66 B;  1AR5 A;  5L3D A;  5KUM A;  3UO3 A;  5L3F A;  4I9Q A;  2OWO A;  4UVC A;  4QE9 A;  5BZB A;  5IYZ B;  3TGU H;  1K34 A;  1FXK B;  2OTL V;  1OCR B;  3SGI A;  1WP7 A;  3MHS C;  3O65 A;  2QTS A;  2QEX V;  2LFS A;  4JI6 O;  4DK1 A;  4JAS A;  1WB8 A;  4DR3 O;  5H2F Z;  1NH2 B;  5CA0 B;  1Z5W A;  4LF4 O;  4J80 A;  5EIB D;  2RMK B;  2IM9 A;  2IJI A;  3IJ4 A;  4MVS A;  3W7U A;  5EYP B;  3PN1 A;  5DN6 G;  1QR8 A;  3RT3 C;  4DV4 O;  1JFF B;  1OHH G;  3CYO A;  2QKS A;  1AJQ A;  4WFF A;  1IXB A;  3MHH C;  3N2G A;  1Q6I A;  2LP7 A;  3A0B Z;  3D36 A;  1JOY A;  3T2M A;  3HKD A;  5KA6 A;  3SJC C;  4DV0 B;  4B3M O;  3NXS A;  1MMM A;  1XNR O;  2KB1 A;  2P6J A;  4I0X B;  4LWS B;  5EK0 A;  2CH7 A;  2CTW A;  3OAA G;  4MSW C;  3T1Y O;  2HEP A;  3SPC A;  3D36 C;  4TQF A;  2CTR A;  3EVK A;  3A8T A;  4XDL A;  1I5X A;  2QTO A;  2VQE B;  3B4S A;  2XND G;  1G1X B;  1XI1 A;  3WB2 A;  1EZJ A;  4MVR A;  4CS4 A;  1PM9 A;  3TXS A;  2WSS G;  1JFF A;  1SA0 B;  3ZHQ A;  1I7F A;  4J11 A;  3JAT A;  4DR5 O;  1KYO F;  1SA0 A;  3L71 H;  3IAY A;  3ETE A;  4DR4 B;  2PY5 A;  4N21 A;  1IZ3 A;  2ATK C;  4X64 O;  3FYE B;  4X8A A;  2Y4T A;  4BR6 A;  1Q43 A;  4UCS A;  5D5P A;  3AEI A;  3K5N A;  3B09 A;  4BIO A;  5IWA O;  4PDL A;  1IBL B;  1ZX3 A;  3JD3 A;  2X0L A;  1R6N A;  3JAK B;  5DED A;  3ZHT A;  3WG7 B;  5BMV A;  4UCU A;  1HWY A;  4G28 B;  2CAZ C;  1IBK O;  3RYF B;  2YS8 A;  1BZK A;  3OT7 A;  4DV2 B;  2OIE A;  5CBF A;  2DOS A;  2QGN A;  4DV6 O;  2ZNI A;  3GWO A;  2IJJ A;  3F7Y C;  4YHH O;  2CE4 A;  4QGP A;  3CS5 A;  1WNS A;  5IYD O;  4UB8 Z;  2Q67 A;  2W6I G;  4O4L A;  1YI2 V;  1R3L C;  4DW0 A;  1S5H C;  2UXB O;  3K0G A;  3BEH A;  1SZX A;  2QKA A;  1ROP A;  3ZRX A;  3T1Y B;  2F66 C;  4UCO A;  3WB1 A;  4DV7 O;  2YI9 A;  5BR8 O;  4LFB B;  2R9R B;  3P30 A;  2OYQ A;  3T1H B;  3CRA A;  1HNZ O;  2HHH B;  1UFI A;  4MVM A;  4E2L A;  1HP8 A;  1URF A;  4QNH B;  1B04 A;  3GVM A;  1RFY A;  1VQ8 V;  3CRC A;  1NKD A;  1TVK A;  2YID A;  4PI2 A;  4LF8 O;  1HDJ A;  3ZRW A;  2JDI G;  3N27 A;  2Y69 C;  1YCI A;  4D7T A;  4ZBM A;  1SQB H;  1QVF U;  2BSK B;  3LDC A;  3OM3 B;  1I94 O;  5IY5 B;  3A2F A;  1RP3 B;  1SQV H;  1TA8 A;  1VQ5 V;  3MDS A;  2LGW A;  3LSU A;  1D2D A;  2PYJ A;  4UB6 Z;  4TUY A;  3JAT B;  2V7Q G;  2V4D A;  3GB7 C;  4PI0 A;  1WA8 B;  1XIL A;  1B06 A;  1XMQ O;  1ZSP A;  1P84 F;  1SET A;  4OGQ B;  5CBH A;  3JD0 A;  4DV5 B;  3K9A A;  5K1X A;  4LH7 A;  4IT5 A;  1XOU A;  1XMO O;  4I0X A;  2NNU A;  1MG1 A;  2Z5U A;  4LF5 O;  1F4N A;  4JI4 B;  2KG7 B;  4B3T B;  1AI5 A;  1K73 W;  1AP6 A;  1J5E B;  4FLY A;  3DXR A;  4BAY A;  2ZIN A;  2LO1 A;  1PPJ H;  5KHG A;  4TV8 B;  2AGA A;  3BFR A;  2F95 B;  3SYC A;  4B3S O;  1VQ7 V;  1SQX H;  4H13 B;  4FIP C;  2H3O A;  3ZMZ A;  2QR4 A;  1N34 O;  4FM2 A;  1YIJ V;  2ZIM A;  3KCY A;  3QO7 A;  1HW7 A;  2OT5 A;  3KZI Z;  3ETD A;  4LCU C;  4X20 A;  1WJZ A;  4ZI7 A;  4LNU B;  2EZP A;  3CE2 A;  4DV0 O;  4B3M B;  5IWA B;  3AG3 B;  3ZMU A;  5B1B B;  5CN0 A;  2R9I A;  4J7K A;  4AQY O;  1JX9 A;  1XNQ O;  5GON B;  1KKC A;  3ZHS A;  3OTF A;  3RYI B;  3N2K B;  5LA6 B;  5JQG A;  3AG2 B;  1Y66 A;  4X9Q A;  1M1K W;  1CPY A;  2QWP B;  4QE7 A;  2QA4 V;  1GN2 A;  3E89 A;  1GM9 A;  2Q0O C;  3OMI B;  4JI7 O;  4RUF A;  3U11 A;  3BHP A;  3JYC A;  3M8A A;  3G71 V;  1M90 W;  4JI4 O;  2HJD A;  2YIB A;  1MZF A;  4YY3 O;  3B77 A;  4NVP A;  1EN6 A;  2YI8 A;  3HKE A;  2Z0A A;  2WLI B;  4DV5 O;  4MW3 A;  4UXN A;  4I4T B;  4PDM A;  3JAL A;  4JF3 A;  1KKD A;  3OMA B;  1IBM O;  3VOU A;  1RPO A;  2RNB A;  2HG5 C;  1OZ0 A;  1ZWI C;  1R6T A;  1S77 D;  4CC5 A;  2V1D A;  1FXV A;  1FXK C;  3L75 H;  3U0Z A;  1QNM A;  1QCE A;  2A0L A;  1VQ6 V;  4DR2 O;  3G4S V;  1FFX A;  1D5N A;  5EC1 C;  1FYJ A;  3AG7 A;  1F23 A;  1R3I C;  1ZLZ A;  4U7O A;  4B7K A;  2A3Q A;  2WLI A;  5B1A B;  1TUB B;  5LMN O;  4GX0 A;  4WFE A;  3EHB B;  4ZHQ A;  5BMV B;  1OCZ C;  3BY6 A;  4LF8 B;  1PL0 A;  2IBZ H;  4X65 O;  3JCU Z;  3SYQ A;  3ZS8 C; 
#chains in the Genus database with same CATH homology
 4LR3 A;  5K1P A;  4FLX A;  1HR0 B;  2BTQ A;  1N34 B;  5IJ0 B;  4JYA B;  2ZNJ A;  3RYI A;  4FFB B;  3RWR D;  5JVD A;  2EX3 A;  2Q7E A;  4ZOL B;  4DV1 B;  3JAS B;  4CH6 A;  4IHJ A;  4X62 B;  4K8X A;  5CB4 A;  2QJ1 A;  3RYH A;  4JI1 B;  3LNN A;  4TV9 B;  3JAK A;  4FM1 A;  1IBK B;  4HNA A;  2F1M A;  5ITZ A;  5LA6 A;  5JH7 A;  4FLZ A;  1SQF A;  5LXT B;  4EFE A;  2R9A A;  4EEQ A;  4K8Z A;  3HKB A;  4AIL C;  4X66 B;  2R70 A;  5LOV B;  3E22 B;  2KKW A;  2YXL A;  4I9Q A;  2OWO A;  2F93 B;  4O4H B;  4B3S B;  4JI6 B;  5IYZ B;  5LYJ B;  3BAB A;  4UCT A;  3SGI A;  4NXN B;  1WN7 A;  5C8Y A;  1X4T A;  4YJ3 A;  4DK1 A;  1N32 B;  4U3J A;  3SJB C;  4FVM A;  4O2B A;  1RSO A;  5JCO C;  1ZAU A;  4CS3 A;  3UT5 B;  3DSQ A;  5CA0 B;  2JVD A;  1Z5W A;  5LMN B;  4O4I B;  5JQG B;  1M93 A;  2QM4 A;  1SKV A;  2RJZ A;  5EIB D;  1XHZ A;  4ZIB A;  2IM9 A;  3JAR B;  2PGG A;  2VQF B;  4GLX A;  5LP6 A;  2GV9 A;  5EYP B;  3PN1 A;  4AHC A;  3HKD B;  4WBN B;  1JFF B;  5KMG A;  3QF7 A;  3ZED A;  1G6U A;  3VQX A;  1XMQ B;  3QTC A;  5KX5 B;  3N2G A;  4ZI7 B;  1O9H A;  3RYC A;  3HKD A;  4LF5 B;  3SJC C;  4DV0 B;  2XHB A;  4JI8 B;  5EYP A;  4DV7 B;  4TUY B;  4O2A B;  2P22 C;  5LOV A;  2HEP A;  4TQF A;  4I55 A;  4JI5 B;  3ETQ A;  2VQE B;  5D5Q A;  3FFQ A;  1XI1 A;  3BAA A;  3WB2 A;  2Q0A A;  3JSN A;  3K5L A;  4CS4 A;  4X1Y B;  3RYH B;  4EFB A;  4HBN A;  1Z5V A;  1JFF A;  1SA0 B;  5JJE B;  1I7F A;  1HNX B;  3JAT A;  1SA0 A;  3IAY A;  4DR4 B;  2PY5 A;  2JS5 A;  4CH3 A;  4X1Y A;  4O4I A;  4FM0 A;  3VQW A;  3CHX A;  1Q43 A;  4UCS A;  2UU9 B;  5D5P A;  4DRX B;  3K5N A;  4O2B B;  1HNW B;  2PTM A;  3HKB B;  3M7M X;  4NXM B;  1IBL B;  5ITZ B;  5EIB C;  5C8Y B;  3JAK B;  5CA1 B;  4LFC B;  5BMV A;  4UCU A;  5KX5 A;  4JI2 B;  4JV5 B;  4GKJ B;  2CAZ C;  3RYF B;  3WB0 A;  1XNR B;  4LF9 B;  4DV2 B;  3JAS A;  2ZNI A;  1HNZ B;  4F6R A;  1DGS A;  5FNV B;  4KHP B;  4LF4 B;  1WNS A;  4O4L B;  3UQ8 A;  3THO A;  4CS2 A;  4O4L A;  3U10 A;  4B08 A;  5IJ0 A;  1O9G A;  4YHH B;  4F6R B;  5KHJ A;  4TV9 A;  1D5A A;  5KHK A;  3MAQ A;  1P49 A;  4DUY B;  4FLW A;  2UXC B;  5LP6 C;  4DUZ B;  3T1Y B;  4LFA B;  4CH4 A;  2F66 C;  2Q7G A;  4UCO A;  4ZOL A;  5CA1 A;  4UFZ A;  3WB1 A;  4DK0 A;  4UCR A;  2YI9 A;  4DR1 B;  4LFB B;  1KU9 A;  2OYQ A;  4FFB A;  3T1H B;  1H2S B;  4I50 B;  2HHH B;  1SQG A;  2PUS A;  3E22 A;  4CH5 A;  5IJ9 B;  4X64 B;  2PZS A;  1B04 A;  1FFX B;  3N2G B;  3VQV A;  4BWA A;  1TVK A;  4PI2 A;  3JSL A;  3SJA C;  4TOI A;  4GKK B;  2E3C A;  4D7T A;  3N2K A;  1TUB A;  3CB2 A;  4DRX A;  3JAL B;  4I4T A;  4DV6 B;  3A2F A;  5JVD B;  5CA0 A;  3UT5 A;  4DR6 B;  4DR2 B;  4TQD A;  3OTO B;  1TA8 A;  4KL1 A;  1XNQ B;  3BA8 A;  5FNV A;  2PYJ A;  4O2A A;  2YIA A;  4TUY A;  3JAT B;  2V4D A;  4DR3 B;  4PI0 A;  4YJ3 B;  1WPB A;  4L8J A;  4YJ2 B;  1JJO A;  3K5O A;  1XMO B;  2ZIO A;  4WBN A;  5KMG B;  4GYC B;  4OX9 B;  4DV5 B;  5K1X A;  1JMK C;  4I55 B;  4LH7 A;  3HKE B;  5JJJ B;  2E5L B;  4YY3 B;  1I94 B;  4Q6G A;  4JI4 B;  4TV8 A;  2UXB B;  5JH7 B;  4B3T B;  3RYC B;  5J2T A;  1QHT A;  2BTO A;  1KMI Z;  4DV4 B;  2YIB D;  5EZY A;  1J5E B;  4LF7 B;  3HKC A;  4FLY A;  3B2E E;  3ICX A;  5EZY B;  3K57 A;  4D7S A;  3K58 A;  1N33 B;  2ZIN A;  5LP6 B;  5J2T B;  1Q8I A;  4EB6 A;  5KHG A;  1M4U A;  4TV8 B;  4FLV A;  4DR5 B;  4O4J B;  5GON A;  2UUA B;  2F95 B;  5LYJ A;  5IYZ A;  1TGO A;  2JGU A;  3JAW A;  1XQ8 A;  4B3R B;  3BPZ A;  4FLU A;  4BW9 A;  2UXD B;  5FPO A;  5J2U A;  1YEW A;  4X1I B;  4FM2 A;  3K5M A;  2ZIM A;  4DV3 B;  1VF7 A;  4JI0 B;  1HW7 A;  4EB6 B;  3BRC A;  4X20 A;  4ZI7 A;  4LNU B;  2ZCE A;  4B3M B;  4X1I A;  3HKC B;  5IWA B;  1TAE A;  4O4H A;  5BR8 B;  5JJN B;  3JAR A;  2R72 A;  1V9P A;  5GON B;  4K0K B;  3OTF A;  3RYI B;  5LXT A;  3N2K B;  5LA6 B;  5JQG A;  1IBM B;  2RQ6 A;  2BTQ B;  1NT2 B;  4LF6 B;  2VWK A;  1Q5O A;  2VWJ A;  5CB4 B;  1QQC A;  4IHJ B;  1Q3E A;  1N36 B;  4AQY B;  4U3J B;  4X65 B;  4X20 B;  1S5J A;  4X1K A;  2PYL A;  3U11 A;  3BHP A;  5KHH A;  5IJ9 A;  5FPR A;  1M5I A;  2YIB A;  4PHZ A;  4ZHQ B;  1XHX A;  4NVP A;  5J2U B;  2YI8 A;  3HKE A;  4I50 A;  4LH6 A;  3K59 A;  3JAW B;  4FLT A;  4I4T B;  3JAL A;  3RGB A;  5KHI A;  4YJ2 A;  4IIJ B;  4O4J A;  5LMU B;  2P5O A;  2F4V B;  4UCV A;  4HNA B;  2UUB B;  4CC6 A;  4JI7 B;  4CC5 A;  2Q7H A;  3SR2 C;  3U0Z A;  3QG5 A;  4IIJ A;  1FFX A;  5JCO A;  1T5E A;  3BA9 A;  4JI3 B;  1TUB B;  3RYF A;  3RFR A;  4ZHQ A;  3CSX A;  5BMV B;  4DR7 B;  4LF8 B;  1FJG B;  4LNU A;  4X1K B;  3VQY A;  1TVK B;  2ZM6 B;  1L8D A;  2UUC B;  3ZS8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...