3SJAC

Crystal structure of s. cerevisiae get3 in the open state in complex with get1 cytosolic domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
MNELSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
total genus 24
structure length 61
sequence length 61
chains with identical sequence D, G, H, J
ec nomenclature
pdb deposition date 2011-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3sjaC00
3CSXA 3SJAC 1NT2B 3THOA 3ICXA 3QG5A 3B2EE 3SJBC 1SKVA 2JS5A 3SJCC 2F66C 3QF7A 2CAZC 1X4TA 2P22C 3ZS8C
chains in the Genus database with same CATH superfamily
3THOA 1Y66A 2IJJA 2DMXA 1K8AW 1XOUA 1VMGA 3ZCCA 1NI8A 3K03A 3OFNG 3JSLA 2GSMB 1MNGA 2BOBC 1IVSA 3ABKC 2JGDA 4MW3A 1P4RA 1JFFA 3K5OA 4WBNA 3B4SA 3E83A 4L8JA 4UCTA 1I0HA 3OEEG 4LBEC 4F6EA 4Z1MG 2A79B 4P9OA 4J11A 1G4YB 1IBMO 2YI9A 2HKOA 4RWUA 5B5EZ 4JI6B 1P7BA 4N23A 5KHIA 1WB8A 2F4VB 1PPJH 2WLLB 4JYAO 5KMGA 2YXHA 3AG1B 1FKAO 2DYSB 4X1KB 2ZM6B 3H1KH 3G6BA 4B3RB 1SZTA 3ZHTA 4NXNO 4K35A 1SQPH 2UUAB 4H37A 4ZBMA 4UUJC 3OGIB 1GRJA 1GN6A 2Q69A 1Q6HA 3QO7A 4XDKA 2LW1A 2KG7B 1THZA 1I94B 4K0KO 3OM3B 4DO2A 2P6JA 2KQXA 1DLBA 2ZINA 4DK1A 2XASA 4WFBV 4X64B 3Q4HB 4FZ1A 4YHHO 4TQFA 2AXTZ 4A5UB 4JI6O 4PI2A 3Q4HA 2P67A 2MW2B 1KKDA 4UCOA 1S76D 3ABLC 5J9PC 1K97A 2F4VO 5CBFA 3UM7A 4P9PA 1SQFA 2V7QG 4OX9O 5LXTA 2OCHA 3CD6V 5B1AC 2ZXWC 3FYIB 3CPWU 2HJFC 4NXMO 2WLMA 5EIBC 3CCJV 5KA6A 3HKDB 1ORQC 4JGSA 4BW5A 3WFVA 3E8BA 2GUZA 4CC5A 1Q3EA 1DK1A 2ITDC 2ZQMA 3UO3A 2LJ2A 5IYZB 3GWKC 4JI2B 3N27A 4JI7O 3ZHUA 1E1QG 5H2FZ 1SA0A 5LYJA 1GTOA 1D5AA 3ZBHA 1N0JA 1VQ6V 3SPCA 3AG3C 3DXRB 3L75H 1SS3A 3L70H 5EBMC 5LMUB 4TV9B 4JI3O 3AG4B 4I50A 4YIPA 2ZNJA 4X1YB 4LF9B 3JASB 4OPAA 1FFXA 1PL0A 3QVNA 4GUNA 4W4LA 2BOCC 2QKSA 1P7GA 1H2SB 1FXKB 3ETDA 1SQVH 1U96A 4LP8A 4LF8O 3BA9A 2B1IA 2XAGA 3CCUV 2YSUB 5JQGB 1EBOA 1H2GA 1NR7A 1FAFA 3I5DA 4IL6Z 4DUZB 2A7WA 1ZLZA 1M4UA 5EC1C 3GB7C 4MSWC 5JCOC 1Y67A 2H8PC 4PV1B 2EZPA 5EYPA 4ZHQB 2EIKB 4AQYB 4C7UA 4UXNA 3IC9A 3JARA 4O4JA 4H44B 1OCRB 3T1YB 2JS3A 4E2LA 2IJIA 2NN4A 3K3WA 1GH6A 2GBOA 5H5NA 2ZCEA 4QJFB 3ABTA 5LMNB 5LMNO 1ZL8A 1MABG 3K06A 2ILMA 2GDSA 2UXBO 2V4DA 4O2AB 3A0RA 1K9MW 4DV2O 1KB9F 2VS0A 4QGPA 4WBNB 4FK5C 3BRCA 1S5LZ 2N04A 3UT5B 1SESA 4B3SO 2B9ZA 2YXYA 2WLHA 1Q6UA 5FNVA 4LFCB 5GTHZ 2E75B 3FB5C 1TA8A 1JX9A 1S3JA 1V9PA 3WU2Z 3K5LA 1AI7A 2LFRA 2RCVA 1XNRO 1M90W 4LCUC 1UJWB 1QLEC 4DR3O 3BPZA 1G1XB 2ARHA 3ZIAG 1LUWA 2YIBA 2A9HA 2ETNA 1D2DA 4NTYA 2LP7A 1SQBH 4EFEA 4FLWA 3CJHA 3F5WC 4PJ0Z 1NVPB 1VF6A 1AJNA 3P3NA 3QTCA 4LF5B 1XREA 3RYHA 1TGOA 2JGDB 4MVQA 3SGIA 2FB5A 4F4LA 5LMUO 4PD4F 2X0LA 4PA9A 3OTOO 1X59A 1BZKA 3CRCA 5KX5B 2XAJA 2R70A 4NXMB 2VQFO 1AR5A 4RQEA 5JVDA 5LGUA 4MTXA 4GX0A 4X20A 5AG2A 3G4SV 3JD4A 2FL4A 1FS0G 2IH1C 2PF4E 3D36C 5BMVB 1B04A 4GYCB 4B3RO 4I4TB 4J41A 1SA0B 3QNEA 4D7SA 1ROPA 1WN7A 2FKXA 1DGSA 3ZHQA 1P84F 1UFIA 1V55C 3RGBA 2R72A 5HFMA 2YIDA 3BA8A 4J42A 3C3SA 1AI6A 2OTLV 3K04A 4LNUB 3LDDA 5JWPA 5CB4B 2W6IG 2DYSC 2Q7HA 5LA6B 1LNQA 1WPXA 5LHIA 2QSAA 1J95A 4JI0O 2QM7A 3SJCC 1WP8A 1HR0B 2C2AA 1BGYH 4GLXA 1PD3A 3ML0A 3X2QC 5BR8O 2HVKC 1QU7A 3FB6C 3JAWB 2E74B 3OEHG 4NB5A 2PY5A 3CCQV 5CMUA 4LFBB 1Y4MA 1GO3F 1NU1H 1YHQV 3AG2C 4I7ZB 4FVMA 5K1PA 1OZ0A 1Q7YW 3JD1A 1K7DA 3CC7V 2FTKA 4H13B 4NXNB 3JATA 3IC7A 4IT5A 3SDLA 4DV4O 5LYJB 4DV1B 1DF5A 1EZJA 1N8RW 4DR4B 3R66A 1XMQB 4TQDA 4B08A 2HR3A 1XHZA 4DW0A 5GTIZ 3VQXA 4EEQA 3MD0A 1NQTA 2BSKA 4QPJA 4KXRA 3RYIA 4I0XA 1B06A 5B1OA 4BIOA 4TT3G 2CAZC 1H38A 2UXXA 3P32A 4O4HB 2WLJA 1JJOA 2CH7B 1M57B 4ZHQA 2PZSA 4JI1O 3FKSG 4JPRA 4FLVA 1YCIA 4HNAA 3OD4A 3OMAB 1I5YA 2DJVA 3C3TA 1H2MA 3G71V 3BVOA 4PDMA 2Y69B 3HKCB 5FPOA 3OUFA 2ADQB 5CA0A 5GONB 1HNZB 2PYLA 1R3IC 3HKCA 5IJ9A 5B3SB 5IJ0A 2P22C 3H01A 3LSQA 4NKGB 4JI3B 3FD9A 4G2KA 2DWEC 3RT3C 3D3IA 2ZR3A 2VWKA 3TETA 4MVZA 2V1DA 3F7YC 1E79G 4CH4A 4I55A 4ZIBA 1YJNV 4JAVA 1OCZB 5K1XA 3W7SA 4FLTA 1WP7A 3T4ZA 1BT8A 4UVAA 4ZOLB 3U10A 3ZX6A 3E35A 1N34B 2AHZA 4FJCC 4MS2A 3AK1A 2DOSA 4CC6A 3X2QB 4LFAO 1VQ4V 1O9GA 2P7TC 3UCSC 1PV0A 4X66O 1PP9H 4LH6A 4QE7A 4FM2A 1MZFA 2E76B 4Z1VA 4MVRA 2EJ7A 4DR7O 4YJ3A 1HNZO 4OXSA 4BAYA 3STLC 4WFEA 1OHHG 3SJAC 1QVFU 1Y76A 3AEIA 4GKJO 4HAMA 3FB7C 1ZX3A 3ASNC 1K34A 1HW7A 4LF6B 3F7VC 3CEIA 3VQWA 4DV4B 2DYRB 3LNMB 4JYBA 3ETEA 4JI7B 2XAHA 4LF5O 1GM7A 5KAFZ 5LGTA 1US6A 4JYYA 3AK3A 2N05A 1I5XA 5IYBO 3KZIZ 4HZ3A 1K4CC 1K5SA 1F4MA 3A0HZ 1DF4A 2PYJA 1XBLA 4O4HA 1KP3A 1M57C 1NS1A 1OCCB 4ZOLA 3L74H 2YXLA 5LA6A 1AILA 4JI5O 4X62B 1Q8IA 1S77D 2WLLA 1S5HC 3AG3B 4JI0B 1PNMA 2IW5A 1IBMB 4B7EA 5E79Z 1NR1A 1YIJV 2OCCC 3LSUA 4UV9A 4DV1O 2WA4A 2E3CA 2KB1A 3JD3A 1A32A 4JYAB 5KA5A 2LW7A 3ABLB 2CTPA 2Y0IA 5BZBA 3QO8A 1TAEA 2XTAA 3E8GA 1Y74B 3N2KA 3SPGA 3UQ8A 2BTQB 1KYOF 3JASA 3ZRVA 3CCSV 4LF8B 3ZMVA 2YS8A 4JTDB 4H0LB 1NVPD 1VQ5V 1XUQA 3ASOB 3ASOC 4K0KB 2M6YA 3AG1C 4X8AA 3RW0A 1X4TA 2CGNA 2ZDIC 4GX1A 4X1YA 3TXQA 2CH7A 1YTFD 5EBLC 3ZMSA 2QGNA 4N21A 1MG1A 1XILA 4EB6B 3SYAA 5LP6A 2Y0PA 1AI5A 1K33A 4F6RB 2P5OA 1TVKB 3K9SA 5LHHA 2L6LA 2QWOB 4R7CA 2F23A 3HB3B 4R8CA 2YIAA 4DUYO 3DSQA 3JAKA 2Z5UA 2X6AA 1FD9A 2E5LB 1GM8A 1Y76B 2IU0A 1J5EO 4FFBB 1UPGA 1BMFG 2QA4V 5FLXN 2JK5C 3JCZA 1Q86W 1FFXB 3ZRWA 2AHYA 2N74A 3AG7A 3IJ4A 3CCLV 3SPJA 1AJQA 4DV6B 2HLDG 1YITV 5IY5B 5HFLA 3K58A 4DV0B 1HR0O 1L0LH 3ABMB 3OTFA 4O2AA 4F6RA 3DGEA 2WSSG 3OGCC 3AK2A 4DR5B 4UVBA 2HP8A 1N32O 3C90A 3GWOA 5EBWC 2UUCB 2GV9A 2OYQA 3CRMA 2IM9A 4J10A 1QQCA 3NR7A 4B3SB 4DV3O 1GN4A 1R3KC 1HWYA 1URFA 2YC0A 2EINB 3QF7A 1BL8A 5EK0A 1RP3B 3ZMZA 3PN1A 2VQEO 2FYUH 3CXCU 5GONA 1LUVA 3EFFK 3HPLC 2ZNIA 4PDVA 5BMVA 5D5PA 1IURA 1M93A 4PA3A 5J2TB 4E4EA 3K59A 2AZ2A 1F4NA 5CA0B 1W2BU 1GAXA 3GVMA 1NT2B 1YDXA 3ASNB 3KKYA 1MMMA 5CN0A 1FXHA 3ZMTA 3ZJZA 3CP1A 3CSXA 1YZBA 2CE4A 2IH3C 3WG7C 2YDEA 2Q4PA 4GCZA 4DR1B 4LC1A 2IU3A 4DRXA 1YSCA 4QNHB 4G28B 1IBKO 3QG5A 4J9YB 4I9QA 3RN4A 4IHJB 5BY1A 3OW2U 3APOA 3ZMUA 2PUSA 3R65A 3VQVA 3IFXA 4L87A 1N34O 4B3MB 1BHAA 4CBCA 5EZYB 4BWAA 4IGGA 3HKBB 3NXSA 4G27B 1ENVA 3O65A 4LF7O 3ZHRA 2GUZB 4CH5A 2DN9A 4JI4O 3LDCA 4R6ZA 1EN6A 3HKEB 2UXCO 2P06A 2EIMB 1AB3A 1NTMH 1AROP 1Q43A 1XMQO 2Y48A 1GKFA 4FLZA 3A2FA 3M99B 3CCMV 4X65B 4X65O 3ZRXA 1L8DA 3N2KB 2HJDA 5GW7A 2OCCB 3M8AA 2QEXV 2ZT9B 2LFSA 3OMIB 5IYDO 4O4IB 3RYCA 3LSSA 1T5EA 1VQPV 1MA1A 4UCVA 2Q7EA 4ZKIA 4X66B 5JJNB 1TVKA 2P4KA 1HNXO 3K9AA 3UO2A 1RSOA 5TISZ 4X62O 1SQGA 5EZYA 3K79A 2VRZA 1VF5B 4JASA 4PA4A 2ZKOA 1XQ8A 2WLKA 1PM9A 4O4LB 2BTOA 1SRYA 1HP8A 3FAVA 4WFFA 2XOKG 2Y69C 4LF6O 1GMGA 4FLYA 4QE9A 5J2UA 4PDLA 3ZRWB 5IYCO 4WCEV 2UXDO 2K1EA 3EHBB 1BS3A 3W7UA 3M7MX 2BTQA 4CH6A 5FPRA 3CE2A 4TUYA 1H8HG 2AZ0A 1B3QA 1P49A 1W0JG 3BFRA 4DV7O 2R9AA 1XNRB 4LWSB 1D5NA 4RUEA 2JGUA 5C93A 2CTQA 3RYFA 2EINC 2HG5C 4WFAV 4DR7B 4DK0A 1Z5VA 1Q5OA 1MOFA 1VQ9V 4HNAB 3KCXA 4JTAB 1CP9A 2IJHA 4TV8A 1RM1B 1FPOA 4DUYB 3B77A 2P90A 1KUQA 2UU9O 2UXBB 1R3LC 3B8NA 4RAIA 3RVZA 2UU9B 4U7NA 5H6QA 2LGQA 3CCVV 2O57A 4U3JA 5C8YB 4DV6O 1VQLV 3T1HB 3T1HO 3ABUA 5LL6Y 4YXWG 2Q68A 5IJ0B 4PDRA 4UB6Z 3CRAA 1JMKC 1RPRA 1SERA 2ZR2A 1R73A 2IBZH 3B2EE 2NNUA 2EJRA 1FXKA 1WNSA 4PELA 2WPDG 3ICXA 2DWDC 1JFFB 5BR8B 4DV3B 3CX5F 1WJZA 1N32B 1KU9A 1WLEA 2QWNB 4NVPA 2ODMA 2Q5ZA 2YEVA 2XT9A 3MHHC 3H1IH 1QBZA 1ZSPA 3VBBA 2EZOA 2X6BA 3OT7A 4GKKO 3JAKB 1WAZA 1AP5A 2GTAA 5DN6G 1M56B 1HNXB 5L3FA 2PTMA 3K57A 3U11A 4AQYO 4CS2A 2Q0AA 3TK1A 3WB1A 2B5UA 4J7KA 1Y74A 1EFRG 2WLIA 2P4VA 4CS3A 4UFZA 2EULA 5H9CA 2YI8A 1NJIW 4DYLA 1YVWA 2Y4TA 4FIPC 1K3EA 1WB7A 2VQFB 3CC4V 2H3OA 2QM4A 1Y6XA 1N33B 5LXTB 1COWG 2JEXA 2JIZG 3SYCA 3JAWA 3I55V 2F66C 1N4CA 4JI2O 1N36O 1M9NA 4FM0A 3K0DA 4FFKA 3CCEV 5B1BC 4KHPB 3OAAG 2A0LA 3L72H 2JVDA 1W59A 2HHHO 2CTWA 5KMGB 2DQ3A 1K4DC 2W0XA 2OIEA 3HKEA 3JD0A 4LF7B 4JI8O 3SYPA 1ZL8B 2D3OW 3N2GA 4LH7A 4I4TA 4X1IB 2RJZA 5D5QA 4WFHA 1NZ6A 3DC5A 3N2GB 1BHBA 3FX7A 2EIJB 2L35A 4CZZA 1WPBA 2JJ1G 4CS4A 1OCOC 3W7WA 1CEZA 1EM1A 5L3BA 3CS5A 1IBKB 2Q67A 4D6TH 5IY5C 1RPOA 3ZS8C 3OMNB 4DRXB 2UUBO 2ATKC 1GN2A 5KX5A 1NH2B 1SETA 1OCZC 5L3CA 5JQGA 4O4IA 2UXNA 5L3EA 1RFYA 3WB0A 4KUMA 3HR0A 4JZ2A 3SPHA 5IWAO 4R50A 4JI4B 2EIJC 2BCCH 3AG2B 3H9VA 4LFAB 2WLNA 2DE0X 1KP2A 4KHPO 3CHXA 4ABMA 4YJ2A 1KECA 2ZE6A 4K8XA 4XDJA 2FMLA 4MVSA 3FAVB 4RUFA 2QWRB 4U3JB 2QKAA 4X1IA 2UXCB 4UCUA 1KD1W 2CUGA 2KSDA 3PJSK 4K8ZA 2G38A 1K92A 2CTRA 2OT5A 3P30A 1SKVA 3SYOA 3W7XA 4GX2A 1QLEB 2PGGA 1E1RG 1M56C 4DV5O 3L9DA 1YJWV 3OR7C 4TUYB 4GX5A 5FNVB 1JOYA 4DR1O 1Q90D 1AVMA 4CH3A 4DR6O 1BCCH 4LWSA 5IWAB 4LFBO 1S72V 3T2MA 1ZWIC 3ZHVA 3DTUB 1QR8A 1VIBA 1CXZB 5B66Z 2B1GA 1IXBA 5DECA 2Q6AA 1J5EB 2QDOA 3E86A 3L71H 2BE3A 5ITZB 5JJJB 4NTXA 3IGAC 3CWBH 3TJTA 5LBQA 1S0VA 2PI5A 1VP7A 4X9QA 3B40A 3G80A 3T4DA 1F23A 4U3FH 1ZTEA 2LQTA 2W0FC 2WLIB 5EC2C 1PKXA 4IYIA 5J2UB 4GKJB 3CXHF 4B7KA 5FL7G 4UVCA 2MK3A 4EKWA 1NTKH 1BQ0A 2D2CB 3D3QA 1VQ8V 1U97A 3BAAA 3JALA 5KUMA 2XNDG 5CB4A 1JVMA 2ZIOA 3ABMC 3CRRA 4YY3O 5L3GA 4KP4A 2Q73A 1OJHA 4I9WA 5B1NA 2DQ0A 4IHJA 4DV0O 3H1LH 3OR6C 2F93B 3ZN1A 4DR5O 2XUMA 5KAIZ 4JTCB 4K3AA 5KHGA 4BIUA 3J80N 4X20B 1L0NH 4NYKA 3A0BZ 5EYPB 1Z5WA 4GT1A 4DUZO 5J2TA 4IIJA 3MAQA 1XNQO 1OCCC 1AR4A 5LOVB 5KHJA 4PI0A 1G8MA 1YTFB 1RM1C 2OWOA 4J9ZB 2NR5A 2EILB 1XHXA 2X7RB 3LNNA 3CCRV 3K5NA 1NBMG 2ADPA 2F1MA 1I94O 3B09A 4OGQB 1VQ7V 3BY6A 1SQQH 3QO5A 3FB8C 2UUBB 4JZGA 4I55B 1R3JC 1I08A 5CA1B 3E8FA 1KQSU 2YIBD 4OX9B 3WB2A 4HBNA 4MVOA 4AILC 2JEUA 2RQ6A 1N0NA 1Q6IA 2GHYA 2LGWA 3ETQA 1R6NA 3MHSC 2WWWA 1MSDA 1XEQA 4PHZA 2JDIG 4KFMA 4Q6GA 5BXZA 2GTSA 1H2LA 1F7YA 1FFTB 1H2KA 4ICGA 1Z2GA 4KL1A 4DR2O 1EZVH 4GKKB 2DW4A 2IJKA 4ZI7A 1R1BA 3TXSA 2KG7A 4DR4O 2WA3A 4J7ZA 4QIWF 5DEDA 2ZXWB 5B1AB 3BCCH 3JD2A 4FZ0A 4XBFA 2Q7GA 4LF4O 4LF4B 2LO1A 3CMEV 2UXDB 3RVYA 4YY3B 4HYOA 3H1JH 1PNLA 4JAUA 5A9GA 3BABA 2Z3YA 3CRQA 4Q20A 3WG7B 1SC5B 2Q8VA 4BR6A 4EB6A 5LP6B 5KLVH 1HDJA 4DXWA 1FJGB 3J7AU 1H2NA 4I0XB 4GZRB 2QR4A 2NLJC 3EVKA 3RYCB 2CDYA 1R6KA 2QWPB 1S5JA 3JSNA 1AJPA 5H6RA 4FMTA 3G6EV 4DR2B 1SQXH 3JARB 4O4JB 1O9HA 2PI4A 4WFGA 1VF7A 5JVDB 5KHHA 1YJ9V 1JJ2U 5ITZA 3CYOA 3D36A 2QE7G 3T1CA 1K5QA 2EX3A 4NR1A 3K0GA 1VEWA 2Q9LA 3BHPA 4YJ3B 1XMOO 2ZE8A 2QTSA 1CPYA 3VQYA 4QPKA 2XAFA 3B8MA 1YXBA 1VQMV 5F2VO 4X88A 1W0KG 2QM8A 3OUSA 2EIKC 4D7TA 3DC6A 1F51A 3EXAA 3VOUA 2OTJV 3JALB 2R9RB 4RO2A 1QVGU 1V54B 3G67A 3DXRA 5KUKA 2ZE5A 5CA3A 2H94A 3OE7G 1SZXA 1FJGO 1B6QA 4IYHA 2F43G 2M7WA 1QNMA 3TCUA 2ZD9A 5CA1A 4JI1B 4UCRA 3K5MA 4LFCO 3E8HA 3JCUZ 4O2BA 2A3QA 2ITCC 4JF3A 1ZUQA 4DV7B 1NKDA 1BQZA 3H1HH 3HKBA 4X89A 1XI1A 4J7JA 4DR3B 4JAAA 1VQNV 2Y4UA 1JA8A 3S3WA 2ZDIA 1LR1A 2VQEB 3CC2V 3ETGA 4TOIA 3KCYA 1K73W 1N36B 2E5LO 1BSMA 1FYJA 2XAQA 4B3TB 2X6CA 3E22B 3KG2A 1VQKV 5L3DA 2JJ2G 1QCEA 4U7OA 2HFEC 2F95B 3SR2C 3E22A 1OCOB 3AG4C 5B1BB 4LNUA 4I50B 3P3PA 4TV9A 4MT8A 3RYHB 1XL4A 2QWQB 3U0ZA 3ZHSA 1PNKA 5LGNA 4YHHB 3ZEDA 4DR6B 4DV2B 5JH7B 1AP6A 5B3SC 4O2BB 4AHCA 4YIOA 2AGAA 3SJQC 1VF6C 4B3TO 1GK9A 1MZEA 1RSOB 3HKDA 1FXVA 4MTFA 1KKCA 1IBLB 2UUCO 1Q82W 1IXMA 3ABKB 4P30A 1XDCA 4IIJB 2K9PA 3TGUH 1AR1B 3E89A 3O9OA 1KMIZ 4LF9O 1L1FA 4TSFG 5C8YA 2DYRC 2HEPA 5EIBD 5LHGA 2EBOA 4MTOA 4WF9V 4XDLA 3RYIB 2YICA 4FM1A 3J81N 1QHTA 2ZE7A 2XHBA 3UT5A 4FPPA 4DW1A 3JAMN 5A2QN 1NTZH 1IBLO 2CK3G 3FYEB 2KKWA 2R9IA 3W7TA 2EILC 5JH7A 3ZN0A 2WAMA 1EN5A 1TUBA 5IE9A 3IAYA 3ZRSA 3SPIA 5CBGA 1IDSA 4TV8B 3LUTB 1R6TA 1M1KW 1TUEB 2QKCA 4TWKA 1M5IA 5E1AC 4BIZA 2ZM6O 2Q0OC 4B3MO 2RMKB 1EN4A 1XNQB 1GN3A 4LR3A 3JATB 3K08A 2RN9A 2A06H 1IX9A 1V55B 3D8CA 1YI2V 1XMOB 4FFBA 2W6JG 4MW8A 5DM6V 1JPXA 1QLNA 2RNBA 1V54C 2JS5A 2VWJA 5IDJA 4X64O 1QR9A 4PA7A 1HNWO 1YEWA 1FXKC 4OPHA 2BSKB 4J80A 4RQFA 4JI5B 1N33O 5IT9N 3OTOB 2HVJC 3LDEA 2YUAA 1VQOV 1ZAUA 1JQ0A 1H8EG 1IZ3A 4JYCA 1SF9A 3STZC 1TUBB 5CBHA 2AW9A 1KBHA 3JYCA 4PA6A 2UUAO 1OV9A 4X1KA 4JI8B 5LOVA 4NTWA 2EIMC 3E2EA 1JR9A 5KHKA 5IYZA 3F5TA 3MDSA 3I56V 4Z2WA 1PL4A 4MTGA 3FFQA 3RBZA 2CGOA 1G6UA 3SJBC 3S3XA 5JCOA 3BEHA 4UV8A 5IJ9B 4BW9A 1MSWD 2Z0AA 4H33A 3A8TA 3APQA 1KC8W 4ASUG 1OCRC 4W4KA 1HNWB 2OIGA 4DV5B 3SYQA 1DTOA 4UCSA 4P2ZA 3T1YO 1I7FA 5LP6C 1BE3H 2ZIMA 3RWRD 1GM9A 4MVUA 4FLUA 3CMAV 3RFRA 4EFBA 4MVMA 1JCHA 3L73H 1WA8B 4AI8A 1AI4A 2QTOA 4FLXA 3CB2A 2QJ1A 4UB8Z 3RYFB 1WA8A 3UKMA 4I5SA 2YEVB 4O4LA 1Q81W 5JJEB 4YJ2B 4JV5B 2HHHB 4JV5O 2RDCA 1NH2D 1VARA 2JRIA 4ZI7B 1YF2A 3CJHB 1XL6A
chains in the Genus database with same CATH topology
3THOA 5J2UA 2RQ6A 4FLVA 3ETQA 4HNAA 3JSLA 3M7MX 2BTQA 4PHZA 4CH6A 4Q6GA 5FPRA 4TUYA 1JFFA 3K5OA 3HKCB 5FPOA 4WBNA 5CA0A 4KL1A 5GONB 1P49A 4L8JA 1HNZB 4UCTA 4GKKB 2R9AA 2PYLA 4ZI7A 1XNRB 3HKCA 5IJ9A 5IJ0A 2P22C 4JI3B 2YI9A 2JGUA 2Q7GA 4JI6B 4LF4B 2VWKA 3RYFA 2UXDB 4DR7B 4DK0A 1Z5VA 1Q5OA 4YY3B 5KHIA 4HNAB 4CH4A 2F4VB 3BABA 4I55A 4ZIBA 5KMGA 4X1KB 4TV8A 5K1XA 2ZM6B 4FLTA 4EB6A 5LP6B 4ZOLB 3U10A 4B3RB 1FJGB 4DUYB 1N34B 2UXBB 2UUAB 2UU9B 3RYCB 4U3JA 4CC6A 5C8YB 1S5JA 3JSNA 1O9GA 3T1HB 4DR2B 5IJ0B 3JARB 4O4JB 1I94B 1O9HA 2ZINA 1VF7A 1JMKC 4LH6A 5JVDB 5KHHA 4DK1A 4FM2A 4X64B 3B2EE 4TQFA 5ITZA 4YJ3A 2EX3A 3BHPA 4YJ3B 1WNSA 4PI2A 3SJAC 4UCOA 3VQYA 3ICXA 1JFFB 5BR8B 4DV3B 1SQFA 1HW7A 4LF6B 5LXTA 4D7TA 3VQWA 4DV4B 1KU9A 1N32B 4NVPA 4JI7B 3JALB 5EIBC 3HKDB 3JAKB 4CC5A 1HNXB 2PYJA 1Q3EA 2PTMA 4O4HA 3K57A 5IYZB 3U11A 4JI2B 5CA1A 4JI1B 4CS2A 4UCRA 3K5MA 4ZOLA 2YXLA 2Q0AA 5LA6A 4O2BA 1SA0A 3WB1A 5LYJA 4X62B 1D5AA 4DV7B 1Q8IA 4JI0B 4CS3A 3HKBA 4UFZA 1IBMB 5LMUB 4TV9B 1XI1A 4I50A 2YI8A 4DR3B 2ZNJA 4X1YB 4LF9B 3JASB 1FFXA 1H2SB 2VQEB 4TOIA 1N36B 2E3CA 3BA9A 2VQFB 4JYAB 4B3TB 2QM4A 5JQGB 1N33B 3E22B 4DUZB 5LXTB 1M4UA 1TAEA 2F95B 3JAWA 3N2KA 3SR2C 3E22A 5JCOC 3UQ8A 2F66C 2BTQB 5EYPA 4ZHQB 4AQYB 3JASA 4LF8B 4FM0A 4LNUA 4I50B 3JARA 4O4JA 4TV9A 3T1YB 3RYHB 4KHPB 4K0KB 3U0ZA 2JVDA 1X4TA 4X1YA 2ZCEA 5LMNB 5KMGB 4YHHB 3ZEDA 4DR6B 3HKEA 4LF7B 4DV2B 4EB6B 5LP6A 3N2GA 4LH7A 5JH7B 4I4TA 4F6RB 4X1IB 2P5OA 2RJZA 5D5QA 4O2BB 1TVKB 4AHCA 3N2GB 1WPBA 3HKDA 4CS4A 2V4DA 4O2AB 1IBLB 2YIAA 3DSQA 3JAKA 4WBNB 1IBKB 3ZS8C 3BRCA 4DRXB 4IIJB 5KX5A 2E5LB 3UT5B 5JQGA 4O4IA 4FFBB 5FNVA 3WB0A 1KMIZ 4LFCB 5C8YA 2HEPA 1FFXB 1TA8A 5EIBD 1V9PA 4JI4B 3K5LA 4DV6B 4LFAB 3CHXA 3K58A 4DV0B 4YJ2A 4K8XA 3BPZA 3OTFA 3RYIB 4FM1A 4O2AA 4F6RA 1QHTA 2YIBA 2XHBA 3UT5A 4DR5B 2UUCB 2GV9A 2OYQA 2KKWA 2IM9A 4U3JB 1QQCA 4B3SB 4X1IA 2UXCB 4EFEA 4UCUA 4FLWA 5JH7A 1TUBA 3QF7A 4K8ZA 3IAYA 3PN1A 1SKVA 4TV8B 2PGGA 5GONA 3QTCA 2ZNIA 5BMVA 4LF5B 1M5IA 5D5PA 3RYHA 1TGOA 1M93A 3SGIA 4TUYB 5J2TB 5FNVB 1XNQB 4LR3A 3K59A 5CA0B 3JATB 4CH3A 5KX5B 5IWAB 1NT2B 2R70A 4NXMB 1XMOB 4FFBA 5JVDA 3CSXA 4X20A 2JS5A 2VWJA 4DR1B 1J5EB 4DRXA 5BMVB 5ITZB 5JJJB 1B04A 1YEWA 4GYCB 4I4TB 1SA0B 3QG5A 4I9QA 4IHJB 4D7SA 2PUSA 4JI5B 3VQVA 1WN7A 3OTOB 5J2UB 4GKJB 1DGSA 4B3MB 1ZAUA 3RGBA 2R72A 5EZYB 4BWAA 3BA8A 3HKBB 1TUBB 4LNUB 3BAAA 3JALA 5CB4A 2ZIOA 4X1KA 4JI8B 5CB4B 4CH5A 5LOVA 2Q7HA 5LA6B 3SJCC 5KHKA 3HKEB 4IHJA 1HR0B 5IYZA 1Q43A 2F93B 4GLXA 3FFQA 3SJBC 1G6UA 4FLZA 3A2FA 3JAWB 5JCOA 5KHGA 2PY5A 4LFBB 5IJ9B 4X65B 4X20B 4BW9A 1L8DA 5EYPB 4FVMA 1Z5WA 5K1PA 3N2KB 5J2TA 4IIJA 3MAQA 4NXNB 3JATA 2PZSA 5LOVB 1HNWB 5KHJA 5LYJB 4DV1B 4O4IB 4PI0A 3RYCA 4DV5B 1T5EA 2OWOA 4UCSA 1XHXA 3LNNA 4UCVA 1I7FA 5LP6C 2Q7EA 2ZIMA 4DR4B 3RWRD 3K5NA 4X66B 4FLUA 2F1MA 5JJNB 3RFRA 1TVKA 1XMQB 4TQDA 4EFBA 4B08A 1XHZA 1RSOA 3VQXA 4EEQA 4FLXA 3CB2A 1SQGA 5EZYA 2QJ1A 3RYFB 1XQ8A 4O4LA 4O4LB 2BTOA 3RYIA 2UUBB 4I55B 5JJEB 4YJ2B 4JV5B 2HHHB 2CAZC 5CA1B 2YIBD 4O4HB 4OX9B 3WB2A 1JJOA 4HBNA 4ZI7B 4AILC 4ZHQA 4FLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSX A;  3SJA C;  1NT2 B;  3THO A;  3ICX A;  3QG5 A;  3B2E E;  3SJB C;  1SKV A;  2JS5 A;  3SJC C;  2F66 C;  3QF7 A;  2CAZ C;  1X4T A;  2P22 C;  3ZS8 C; 
#chains in the Genus database with same CATH topology
 3THO A;  1Y66 A;  2IJJ A;  2DMX A;  1K8A W;  1XOU A;  1VMG A;  3ZCC A;  1NI8 A;  3K03 A;  3OFN G;  3JSL A;  2GSM B;  1MNG A;  2BOB C;  1IVS A;  3ABK C;  2JGD A;  4MW3 A;  1P4R A;  1JFF A;  3K5O A;  4WBN A;  3B4S A;  3E83 A;  4L8J A;  4UCT A;  1I0H A;  3OEE G;  4LBE C;  4F6E A;  4Z1M G;  2A79 B;  4P9O A;  4J11 A;  1G4Y B;  1IBM O;  2YI9 A;  2HKO A;  4RWU A;  5B5E Z;  4JI6 B;  1P7B A;  4N23 A;  5KHI A;  1WB8 A;  2F4V B;  1PPJ H;  2WLL B;  4JYA O;  5KMG A;  2YXH A;  3AG1 B;  1FKA O;  2DYS B;  4X1K B;  2ZM6 B;  3H1K H;  3G6B A;  4B3R B;  1SZT A;  3ZHT A;  4NXN O;  4K35 A;  1SQP H;  2UUA B;  4H37 A;  4ZBM A;  4UUJ C;  3OGI B;  1GRJ A;  1GN6 A;  2Q69 A;  1Q6H A;  3QO7 A;  4XDK A;  2LW1 A;  2KG7 B;  1THZ A;  1I94 B;  4K0K O;  3OM3 B;  4DO2 A;  2P6J A;  2KQX A;  1DLB A;  2ZIN A;  4DK1 A;  2XAS A;  4WFB V;  4X64 B;  3Q4H B;  4FZ1 A;  4YHH O;  4TQF A;  2AXT Z;  4A5U B;  4JI6 O;  4PI2 A;  3Q4H A;  2P67 A;  2MW2 B;  1KKD A;  4UCO A;  1S76 D;  3ABL C;  5J9P C;  1K97 A;  2F4V O;  5CBF A;  3UM7 A;  4P9P A;  1SQF A;  2V7Q G;  4OX9 O;  5LXT A;  2OCH A;  3CD6 V;  5B1A C;  2ZXW C;  3FYI B;  3CPW U;  2HJF C;  4NXM O;  2WLM A;  5EIB C;  3CCJ V;  5KA6 A;  3HKD B;  1ORQ C;  4JGS A;  4BW5 A;  3WFV A;  3E8B A;  2GUZ A;  4CC5 A;  1Q3E A;  1DK1 A;  2ITD C;  2ZQM A;  3UO3 A;  2LJ2 A;  5IYZ B;  3GWK C;  4JI2 B;  3N27 A;  4JI7 O;  3ZHU A;  1E1Q G;  5H2F Z;  1SA0 A;  5LYJ A;  1GTO A;  1D5A A;  3ZBH A;  1N0J A;  1VQ6 V;  3SPC A;  3AG3 C;  3DXR B;  3L75 H;  1SS3 A;  3L70 H;  5EBM C;  5LMU B;  4TV9 B;  4JI3 O;  3AG4 B;  4I50 A;  4YIP A;  2ZNJ A;  4X1Y B;  4LF9 B;  3JAS B;  4OPA A;  1FFX A;  1PL0 A;  3QVN A;  4GUN A;  4W4L A;  2BOC C;  2QKS A;  1P7G A;  1H2S B;  1FXK B;  3ETD A;  1SQV H;  1U96 A;  4LP8 A;  4LF8 O;  3BA9 A;  2B1I A;  2XAG A;  3CCU V;  2YSU B;  5JQG B;  1EBO A;  1H2G A;  1NR7 A;  1FAF A;  3I5D A;  4IL6 Z;  4DUZ B;  2A7W A;  1ZLZ A;  1M4U A;  5EC1 C;  3GB7 C;  4MSW C;  5JCO C;  1Y67 A;  2H8P C;  4PV1 B;  2EZP A;  5EYP A;  4ZHQ B;  2EIK B;  4AQY B;  4C7U A;  4UXN A;  3IC9 A;  3JAR A;  4O4J A;  4H44 B;  1OCR B;  3T1Y B;  2JS3 A;  4E2L A;  2IJI A;  2NN4 A;  3K3W A;  1GH6 A;  2GBO A;  5H5N A;  2ZCE A;  4QJF B;  3ABT A;  5LMN B;  5LMN O;  1ZL8 A;  1MAB G;  3K06 A;  2ILM A;  2GDS A;  2UXB O;  2V4D A;  4O2A B;  3A0R A;  1K9M W;  4DV2 O;  1KB9 F;  2VS0 A;  4QGP A;  4WBN B;  4FK5 C;  3BRC A;  1S5L Z;  2N04 A;  3UT5 B;  1SES A;  4B3S O;  2B9Z A;  2YXY A;  2WLH A;  1Q6U A;  5FNV A;  4LFC B;  5GTH Z;  2E75 B;  3FB5 C;  1TA8 A;  1JX9 A;  1S3J A;  1V9P A;  3WU2 Z;  3K5L A;  1AI7 A;  2LFR A;  2RCV A;  1XNR O;  1M90 W;  4LCU C;  1UJW B;  1QLE C;  4DR3 O;  3BPZ A;  1G1X B;  2ARH A;  3ZIA G;  1LUW A;  2YIB A;  2A9H A;  2ETN A;  1D2D A;  4NTY A;  2LP7 A;  1SQB H;  4EFE A;  4FLW A;  3CJH A;  3F5W C;  4PJ0 Z;  1NVP B;  1VF6 A;  1AJN A;  3P3N A;  3QTC A;  4LF5 B;  1XRE A;  3RYH A;  1TGO A;  2JGD B;  4MVQ A;  3SGI A;  2FB5 A;  4F4L A;  5LMU O;  4PD4 F;  2X0L A;  4PA9 A;  3OTO O;  1X59 A;  1BZK A;  3CRC A;  5KX5 B;  2XAJ A;  2R70 A;  4NXM B;  2VQF O;  1AR5 A;  4RQE A;  5JVD A;  5LGU A;  4MTX A;  4GX0 A;  4X20 A;  5AG2 A;  3G4S V;  3JD4 A;  2FL4 A;  1FS0 G;  2IH1 C;  2PF4 E;  3D36 C;  5BMV B;  1B04 A;  4GYC B;  4B3R O;  4I4T B;  4J41 A;  1SA0 B;  3QNE A;  4D7S A;  1ROP A;  1WN7 A;  2FKX A;  1DGS A;  3ZHQ A;  1P84 F;  1UFI A;  1V55 C;  3RGB A;  2R72 A;  5HFM A;  2YID A;  3BA8 A;  4J42 A;  3C3S A;  1AI6 A;  2OTL V;  3K04 A;  4LNU B;  3LDD A;  5JWP A;  5CB4 B;  2W6I G;  2DYS C;  2Q7H A;  5LA6 B;  1LNQ A;  1WPX A;  5LHI A;  2QSA A;  1J95 A;  4JI0 O;  2QM7 A;  3SJC C;  1WP8 A;  1HR0 B;  2C2A A;  1BGY H;  4GLX A;  1PD3 A;  3ML0 A;  3X2Q C;  5BR8 O;  2HVK C;  1QU7 A;  3FB6 C;  3JAW B;  2E74 B;  3OEH G;  4NB5 A;  2PY5 A;  3CCQ V;  5CMU A;  4LFB B;  1Y4M A;  1GO3 F;  1NU1 H;  1YHQ V;  3AG2 C;  4I7Z B;  4FVM A;  5K1P A;  1OZ0 A;  1Q7Y W;  3JD1 A;  1K7D A;  3CC7 V;  2FTK A;  4H13 B;  4NXN B;  3JAT A;  3IC7 A;  4IT5 A;  3SDL A;  4DV4 O;  5LYJ B;  4DV1 B;  1DF5 A;  1EZJ A;  1N8R W;  4DR4 B;  3R66 A;  1XMQ B;  4TQD A;  4B08 A;  2HR3 A;  1XHZ A;  4DW0 A;  5GTI Z;  3VQX A;  4EEQ A;  3MD0 A;  1NQT A;  2BSK A;  4QPJ A;  4KXR A;  3RYI A;  4I0X A;  1B06 A;  5B1O A;  4BIO A;  4TT3 G;  2CAZ C;  1H38 A;  2UXX A;  3P32 A;  4O4H B;  2WLJ A;  1JJO A;  2CH7 B;  1M57 B;  4ZHQ A;  2PZS A;  4JI1 O;  3FKS G;  4JPR A;  4FLV A;  1YCI A;  4HNA A;  3OD4 A;  3OMA B;  1I5Y A;  2DJV A;  3C3T A;  1H2M A;  3G71 V;  3BVO A;  4PDM A;  2Y69 B;  3HKC B;  5FPO A;  3OUF A;  2ADQ B;  5CA0 A;  5GON B;  1HNZ B;  2PYL A;  1R3I C;  3HKC A;  5IJ9 A;  5B3S B;  5IJ0 A;  2P22 C;  3H01 A;  3LSQ A;  4NKG B;  4JI3 B;  3FD9 A;  4G2K A;  2DWE C;  3RT3 C;  3D3I A;  2ZR3 A;  2VWK A;  3TET A;  4MVZ A;  2V1D A;  3F7Y C;  1E79 G;  4CH4 A;  4I55 A;  4ZIB A;  1YJN V;  4JAV A;  1OCZ B;  5K1X A;  3W7S A;  4FLT A;  1WP7 A;  3T4Z A;  1BT8 A;  4UVA A;  4ZOL B;  3U10 A;  3ZX6 A;  3E35 A;  1N34 B;  2AHZ A;  4FJC C;  4MS2 A;  3AK1 A;  2DOS A;  4CC6 A;  3X2Q B;  4LFA O;  1VQ4 V;  1O9G A;  2P7T C;  3UCS C;  1PV0 A;  4X66 O;  1PP9 H;  4LH6 A;  4QE7 A;  4FM2 A;  1MZF A;  2E76 B;  4Z1V A;  4MVR A;  2EJ7 A;  4DR7 O;  4YJ3 A;  1HNZ O;  4OXS A;  4BAY A;  3STL C;  4WFE A;  1OHH G;  3SJA C;  1QVF U;  1Y76 A;  3AEI A;  4GKJ O;  4HAM A;  3FB7 C;  1ZX3 A;  3ASN C;  1K34 A;  1HW7 A;  4LF6 B;  3F7V C;  3CEI A;  3VQW A;  4DV4 B;  2DYR B;  3LNM B;  4JYB A;  3ETE A;  4JI7 B;  2XAH A;  4LF5 O;  1GM7 A;  5KAF Z;  5LGT A;  1US6 A;  4JYY A;  3AK3 A;  2N05 A;  1I5X A;  5IYB O;  3KZI Z;  4HZ3 A;  1K4C C;  1K5S A;  1F4M A;  3A0H Z;  1DF4 A;  2PYJ A;  1XBL A;  4O4H A;  1KP3 A;  1M57 C;  1NS1 A;  1OCC B;  4ZOL A;  3L74 H;  2YXL A;  5LA6 A;  1AIL A;  4JI5 O;  4X62 B;  1Q8I A;  1S77 D;  2WLL A;  1S5H C;  3AG3 B;  4JI0 B;  1PNM A;  2IW5 A;  1IBM B;  4B7E A;  5E79 Z;  1NR1 A;  1YIJ V;  2OCC C;  3LSU A;  4UV9 A;  4DV1 O;  2WA4 A;  2E3C A;  2KB1 A;  3JD3 A;  1A32 A;  4JYA B;  5KA5 A;  2LW7 A;  3ABL B;  2CTP A;  2Y0I A;  5BZB A;  3QO8 A;  1TAE A;  2XTA A;  3E8G A;  1Y74 B;  3N2K A;  3SPG A;  3UQ8 A;  2BTQ B;  1KYO F;  3JAS A;  3ZRV A;  3CCS V;  4LF8 B;  3ZMV A;  2YS8 A;  4JTD B;  4H0L B;  1NVP D;  1VQ5 V;  1XUQ A;  3ASO B;  3ASO C;  4K0K B;  2M6Y A;  3AG1 C;  4X8A A;  3RW0 A;  1X4T A;  2CGN A;  2ZDI C;  4GX1 A;  4X1Y A;  3TXQ A;  2CH7 A;  1YTF D;  5EBL C;  3ZMS A;  2QGN A;  4N21 A;  1MG1 A;  1XIL A;  4EB6 B;  3SYA A;  5LP6 A;  2Y0P A;  1AI5 A;  1K33 A;  4F6R B;  2P5O A;  1TVK B;  3K9S A;  5LHH A;  2L6L A;  2QWO B;  4R7C A;  2F23 A;  3HB3 B;  4R8C A;  2YIA A;  4DUY O;  3DSQ A;  3JAK A;  2Z5U A;  2X6A A;  1FD9 A;  2E5L B;  1GM8 A;  1Y76 B;  2IU0 A;  1J5E O;  4FFB B;  1UPG A;  1BMF G;  2QA4 V;  5FLX N;  2JK5 C;  3JCZ A;  1Q86 W;  1FFX B;  3ZRW A;  2AHY A;  2N74 A;  3AG7 A;  3IJ4 A;  3CCL V;  3SPJ A;  1AJQ A;  4DV6 B;  2HLD G;  1YIT V;  5IY5 B;  5HFL A;  3K58 A;  4DV0 B;  1HR0 O;  1L0L H;  3ABM B;  3OTF A;  4O2A A;  4F6R A;  3DGE A;  2WSS G;  3OGC C;  3AK2 A;  4DR5 B;  4UVB A;  2HP8 A;  1N32 O;  3C90 A;  3GWO A;  5EBW C;  2UUC B;  2GV9 A;  2OYQ A;  3CRM A;  2IM9 A;  4J10 A;  1QQC A;  3NR7 A;  4B3S B;  4DV3 O;  1GN4 A;  1R3K C;  1HWY A;  1URF A;  2YC0 A;  2EIN B;  3QF7 A;  1BL8 A;  5EK0 A;  1RP3 B;  3ZMZ A;  3PN1 A;  2VQE O;  2FYU H;  3CXC U;  5GON A;  1LUV A;  3EFF K;  3HPL C;  2ZNI A;  4PDV A;  5BMV A;  5D5P A;  1IUR A;  1M93 A;  4PA3 A;  5J2T B;  4E4E A;  3K59 A;  2AZ2 A;  1F4N A;  5CA0 B;  1W2B U;  1GAX A;  3GVM A;  1NT2 B;  1YDX A;  3ASN B;  3KKY A;  1MMM A;  5CN0 A;  1FXH A;  3ZMT A;  3ZJZ A;  3CP1 A;  3CSX A;  1YZB A;  2CE4 A;  2IH3 C;  3WG7 C;  2YDE A;  2Q4P A;  4GCZ A;  4DR1 B;  4LC1 A;  2IU3 A;  4DRX A;  1YSC A;  4QNH B;  4G28 B;  1IBK O;  3QG5 A;  4J9Y B;  4I9Q A;  3RN4 A;  4IHJ B;  5BY1 A;  3OW2 U;  3APO A;  3ZMU A;  2PUS A;  3R65 A;  3VQV A;  3IFX A;  4L87 A;  1N34 O;  4B3M B;  1BHA A;  4CBC A;  5EZY B;  4BWA A;  4IGG A;  3HKB B;  3NXS A;  4G27 B;  1ENV A;  3O65 A;  4LF7 O;  3ZHR A;  2GUZ B;  4CH5 A;  2DN9 A;  4JI4 O;  3LDC A;  4R6Z A;  1EN6 A;  3HKE B;  2UXC O;  2P06 A;  2EIM B;  1AB3 A;  1NTM H;  1ARO P;  1Q43 A;  1XMQ O;  2Y48 A;  1GKF A;  4FLZ A;  3A2F A;  3M99 B;  3CCM V;  4X65 B;  4X65 O;  3ZRX A;  1L8D A;  3N2K B;  2HJD A;  5GW7 A;  2OCC B;  3M8A A;  2QEX V;  2ZT9 B;  2LFS A;  3OMI B;  5IYD O;  4O4I B;  3RYC A;  3LSS A;  1T5E A;  1VQP V;  1MA1 A;  4UCV A;  2Q7E A;  4ZKI A;  4X66 B;  5JJN B;  1TVK A;  2P4K A;  1HNX O;  3K9A A;  3UO2 A;  1RSO A;  5TIS Z;  4X62 O;  1SQG A;  5EZY A;  3K79 A;  2VRZ A;  1VF5 B;  4JAS A;  4PA4 A;  2ZKO A;  1XQ8 A;  2WLK A;  1PM9 A;  4O4L B;  2BTO A;  1SRY A;  1HP8 A;  3FAV A;  4WFF A;  2XOK G;  2Y69 C;  4LF6 O;  1GMG A;  4FLY A;  4QE9 A;  5J2U A;  4PDL A;  3ZRW B;  5IYC O;  4WCE V;  2UXD O;  2K1E A;  3EHB B;  1BS3 A;  3W7U A;  3M7M X;  2BTQ A;  4CH6 A;  5FPR A;  3CE2 A;  4TUY A;  1H8H G;  2AZ0 A;  1B3Q A;  1P49 A;  1W0J G;  3BFR A;  4DV7 O;  2R9A A;  1XNR B;  4LWS B;  1D5N A;  4RUE A;  2JGU A;  5C93 A;  2CTQ A;  3RYF A;  2EIN C;  2HG5 C;  4WFA V;  4DR7 B;  4DK0 A;  1Z5V A;  1Q5O A;  1MOF A;  1VQ9 V;  4HNA B;  3KCX A;  4JTA B;  1CP9 A;  2IJH A;  4TV8 A;  1RM1 B;  1FPO A;  4DUY B;  3B77 A;  2P90 A;  1KUQ A;  2UU9 O;  2UXB B;  1R3L C;  3B8N A;  4RAI A;  3RVZ A;  2UU9 B;  4U7N A;  5H6Q A;  2LGQ A;  3CCV V;  2O57 A;  4U3J A;  5C8Y B;  4DV6 O;  1VQL V;  3T1H B;  3T1H O;  3ABU A;  5LL6 Y;  4YXW G;  2Q68 A;  5IJ0 B;  4PDR A;  4UB6 Z;  3CRA A;  1JMK C;  1RPR A;  1SER A;  2ZR2 A;  1R73 A;  2IBZ H;  3B2E E;  2NNU A;  2EJR A;  1FXK A;  1WNS A;  4PEL A;  2WPD G;  3ICX A;  2DWD C;  1JFF B;  5BR8 B;  4DV3 B;  3CX5 F;  1WJZ A;  1N32 B;  1KU9 A;  1WLE A;  2QWN B;  4NVP A;  2ODM A;  2Q5Z A;  2YEV A;  2XT9 A;  3MHH C;  3H1I H;  1QBZ A;  1ZSP A;  3VBB A;  2EZO A;  2X6B A;  3OT7 A;  4GKK O;  3JAK B;  1WAZ A;  1AP5 A;  2GTA A;  5DN6 G;  1M56 B;  1HNX B;  5L3F A;  2PTM A;  3K57 A;  3U11 A;  4AQY O;  4CS2 A;  2Q0A A;  3TK1 A;  3WB1 A;  2B5U A;  4J7K A;  1Y74 A;  1EFR G;  2WLI A;  2P4V A;  4CS3 A;  4UFZ A;  2EUL A;  5H9C A;  2YI8 A;  1NJI W;  4DYL A;  1YVW A;  2Y4T A;  4FIP C;  1K3E A;  1WB7 A;  2VQF B;  3CC4 V;  2H3O A;  2QM4 A;  1Y6X A;  1N33 B;  5LXT B;  1COW G;  2JEX A;  2JIZ G;  3SYC A;  3JAW A;  3I55 V;  2F66 C;  1N4C A;  4JI2 O;  1N36 O;  1M9N A;  4FM0 A;  3K0D A;  4FFK A;  3CCE V;  5B1B C;  4KHP B;  3OAA G;  2A0L A;  3L72 H;  2JVD A;  1W59 A;  2HHH O;  2CTW A;  5KMG B;  2DQ3 A;  1K4D C;  2W0X A;  2OIE A;  3HKE A;  3JD0 A;  4LF7 B;  4JI8 O;  3SYP A;  1ZL8 B;  2D3O W;  3N2G A;  4LH7 A;  4I4T A;  4X1I B;  2RJZ A;  5D5Q A;  4WFH A;  1NZ6 A;  3DC5 A;  3N2G B;  1BHB A;  3FX7 A;  2EIJ B;  2L35 A;  4CZZ A;  1WPB A;  2JJ1 G;  4CS4 A;  1OCO C;  3W7W A;  1CEZ A;  1EM1 A;  5L3B A;  3CS5 A;  1IBK B;  2Q67 A;  4D6T H;  5IY5 C;  1RPO A;  3ZS8 C;  3OMN B;  4DRX B;  2UUB O;  2ATK C;  1GN2 A;  5KX5 A;  1NH2 B;  1SET A;  1OCZ C;  5L3C A;  5JQG A;  4O4I A;  2UXN A;  5L3E A;  1RFY A;  3WB0 A;  4KUM A;  3HR0 A;  4JZ2 A;  3SPH A;  5IWA O;  4R50 A;  4JI4 B;  2EIJ C;  2BCC H;  3AG2 B;  3H9V A;  4LFA B;  2WLN A;  2DE0 X;  1KP2 A;  4KHP O;  3CHX A;  4ABM A;  4YJ2 A;  1KEC A;  2ZE6 A;  4K8X A;  4XDJ A;  2FML A;  4MVS A;  3FAV B;  4RUF A;  2QWR B;  4U3J B;  2QKA A;  4X1I A;  2UXC B;  4UCU A;  1KD1 W;  2CUG A;  2KSD A;  3PJS K;  4K8Z A;  2G38 A;  1K92 A;  2CTR A;  2OT5 A;  3P30 A;  1SKV A;  3SYO A;  3W7X A;  4GX2 A;  1QLE B;  2PGG A;  1E1R G;  1M56 C;  4DV5 O;  3L9D A;  1YJW V;  3OR7 C;  4TUY B;  4GX5 A;  5FNV B;  1JOY A;  4DR1 O;  1Q90 D;  1AVM A;  4CH3 A;  4DR6 O;  1BCC H;  4LWS A;  5IWA B;  4LFB O;  1S72 V;  3T2M A;  1ZWI C;  3ZHV A;  3DTU B;  1QR8 A;  1VIB A;  1CXZ B;  5B66 Z;  2B1G A;  1IXB A;  5DEC A;  2Q6A A;  1J5E B;  2QDO A;  3E86 A;  3L71 H;  2BE3 A;  5ITZ B;  5JJJ B;  4NTX A;  3IGA C;  3CWB H;  3TJT A;  5LBQ A;  1S0V A;  2PI5 A;  1VP7 A;  4X9Q A;  3B40 A;  3G80 A;  3T4D A;  1F23 A;  4U3F H;  1ZTE A;  2LQT A;  2W0F C;  2WLI B;  5EC2 C;  1PKX A;  4IYI A;  5J2U B;  4GKJ B;  3CXH F;  4B7K A;  5FL7 G;  4UVC A;  2MK3 A;  4EKW A;  1NTK H;  1BQ0 A;  2D2C B;  3D3Q A;  1VQ8 V;  1U97 A;  3BAA A;  3JAL A;  5KUM A;  2XND G;  5CB4 A;  1JVM A;  2ZIO A;  3ABM C;  3CRR A;  4YY3 O;  5L3G A;  4KP4 A;  2Q73 A;  1OJH A;  4I9W A;  5B1N A;  2DQ0 A;  4IHJ A;  4DV0 O;  3H1L H;  3OR6 C;  2F93 B;  3ZN1 A;  4DR5 O;  2XUM A;  5KAI Z;  4JTC B;  4K3A A;  5KHG A;  4BIU A;  3J80 N;  4X20 B;  1L0N H;  4NYK A;  3A0B Z;  5EYP B;  1Z5W A;  4GT1 A;  4DUZ O;  5J2T A;  4IIJ A;  3MAQ A;  1XNQ O;  1OCC C;  1AR4 A;  5LOV B;  5KHJ A;  4PI0 A;  1G8M A;  1YTF B;  1RM1 C;  2OWO A;  4J9Z B;  2NR5 A;  2EIL B;  1XHX A;  2X7R B;  3LNN A;  3CCR V;  3K5N A;  1NBM G;  2ADP A;  2F1M A;  1I94 O;  3B09 A;  4OGQ B;  1VQ7 V;  3BY6 A;  1SQQ H;  3QO5 A;  3FB8 C;  2UUB B;  4JZG A;  4I55 B;  1R3J C;  1I08 A;  5CA1 B;  3E8F A;  1KQS U;  2YIB D;  4OX9 B;  3WB2 A;  4HBN A;  4MVO A;  4AIL C;  2JEU A;  2RQ6 A;  1N0N A;  1Q6I A;  2GHY A;  2LGW A;  3ETQ A;  1R6N A;  3MHS C;  2WWW A;  1MSD A;  1XEQ A;  4PHZ A;  2JDI G;  4KFM A;  4Q6G A;  5BXZ A;  2GTS A;  1H2L A;  1F7Y A;  1FFT B;  1H2K A;  4ICG A;  1Z2G A;  4KL1 A;  4DR2 O;  1EZV H;  4GKK B;  2DW4 A;  2IJK A;  4ZI7 A;  1R1B A;  3TXS A;  2KG7 A;  4DR4 O;  2WA3 A;  4J7Z A;  4QIW F;  5DED A;  2ZXW B;  5B1A B;  3BCC H;  3JD2 A;  4FZ0 A;  4XBF A;  2Q7G A;  4LF4 O;  4LF4 B;  2LO1 A;  3CME V;  2UXD B;  3RVY A;  4YY3 B;  4HYO A;  3H1J H;  1PNL A;  4JAU A;  5A9G A;  3BAB A;  2Z3Y A;  3CRQ A;  4Q20 A;  3WG7 B;  1SC5 B;  2Q8V A;  4BR6 A;  4EB6 A;  5LP6 B;  5KLV H;  1HDJ A;  4DXW A;  1FJG B;  3J7A U;  1H2N A;  4I0X B;  4GZR B;  2QR4 A;  2NLJ C;  3EVK A;  3RYC B;  2CDY A;  1R6K A;  2QWP B;  1S5J A;  3JSN A;  1AJP A;  5H6R A;  4FMT A;  3G6E V;  4DR2 B;  1SQX H;  3JAR B;  4O4J B;  1O9H A;  2PI4 A;  4WFG A;  1VF7 A;  5JVD B;  5KHH A;  1YJ9 V;  1JJ2 U;  5ITZ A;  3CYO A;  3D36 A;  2QE7 G;  3T1C A;  1K5Q A;  2EX3 A;  4NR1 A;  3K0G A;  1VEW A;  2Q9L A;  3BHP A;  4YJ3 B;  1XMO O;  2ZE8 A;  2QTS A;  1CPY A;  3VQY A;  4QPK A;  2XAF A;  3B8M A;  1YXB A;  1VQM V;  5F2V O;  4X88 A;  1W0K G;  2QM8 A;  3OUS A;  2EIK C;  4D7T A;  3DC6 A;  1F51 A;  3EXA A;  3VOU A;  2OTJ V;  3JAL B;  2R9R B;  4RO2 A;  1QVG U;  1V54 B;  3G67 A;  3DXR A;  5KUK A;  2ZE5 A;  5CA3 A;  2H94 A;  3OE7 G;  1SZX A;  1FJG O;  1B6Q A;  4IYH A;  2F43 G;  2M7W A;  1QNM A;  3TCU A;  2ZD9 A;  5CA1 A;  4JI1 B;  4UCR A;  3K5M A;  4LFC O;  3E8H A;  3JCU Z;  4O2B A;  2A3Q A;  2ITC C;  4JF3 A;  1ZUQ A;  4DV7 B;  1NKD A;  1BQZ A;  3H1H H;  3HKB A;  4X89 A;  1XI1 A;  4J7J A;  4DR3 B;  4JAA A;  1VQN V;  2Y4U A;  1JA8 A;  3S3W A;  2ZDI A;  1LR1 A;  2VQE B;  3CC2 V;  3ETG A;  4TOI A;  3KCY A;  1K73 W;  1N36 B;  2E5L O;  1BSM A;  1FYJ A;  2XAQ A;  4B3T B;  2X6C A;  3E22 B;  3KG2 A;  1VQK V;  5L3D A;  2JJ2 G;  1QCE A;  4U7O A;  2HFE C;  2F95 B;  3SR2 C;  3E22 A;  1OCO B;  3AG4 C;  5B1B B;  4LNU A;  4I50 B;  3P3P A;  4TV9 A;  4MT8 A;  3RYH B;  1XL4 A;  2QWQ B;  3U0Z A;  3ZHS A;  1PNK A;  5LGN A;  4YHH B;  3ZED A;  4DR6 B;  4DV2 B;  5JH7 B;  1AP6 A;  5B3S C;  4O2B B;  4AHC A;  4YIO A;  2AGA A;  3SJQ C;  1VF6 C;  4B3T O;  1GK9 A;  1MZE A;  1RSO B;  3HKD A;  1FXV A;  4MTF A;  1KKC A;  1IBL B;  2UUC O;  1Q82 W;  1IXM A;  3ABK B;  4P30 A;  1XDC A;  4IIJ B;  2K9P A;  3TGU H;  1AR1 B;  3E89 A;  3O9O A;  1KMI Z;  4LF9 O;  1L1F A;  4TSF G;  5C8Y A;  2DYR C;  2HEP A;  5EIB D;  5LHG A;  2EBO A;  4MTO A;  4WF9 V;  4XDL A;  3RYI B;  2YIC A;  4FM1 A;  3J81 N;  1QHT A;  2ZE7 A;  2XHB A;  3UT5 A;  4FPP A;  4DW1 A;  3JAM N;  5A2Q N;  1NTZ H;  1IBL O;  2CK3 G;  3FYE B;  2KKW A;  2R9I A;  3W7T A;  2EIL C;  5JH7 A;  3ZN0 A;  2WAM A;  1EN5 A;  1TUB A;  5IE9 A;  3IAY A;  3ZRS A;  3SPI A;  5CBG A;  1IDS A;  4TV8 B;  3LUT B;  1R6T A;  1M1K W;  1TUE B;  2QKC A;  4TWK A;  1M5I A;  5E1A C;  4BIZ A;  2ZM6 O;  2Q0O C;  4B3M O;  2RMK B;  1EN4 A;  1XNQ B;  1GN3 A;  4LR3 A;  3JAT B;  3K08 A;  2RN9 A;  2A06 H;  1IX9 A;  1V55 B;  3D8C A;  1YI2 V;  1XMO B;  4FFB A;  2W6J G;  4MW8 A;  5DM6 V;  1JPX A;  1QLN A;  2RNB A;  1V54 C;  2JS5 A;  2VWJ A;  5IDJ A;  4X64 O;  1QR9 A;  4PA7 A;  1HNW O;  1YEW A;  1FXK C;  4OPH A;  2BSK B;  4J80 A;  4RQF A;  4JI5 B;  1N33 O;  5IT9 N;  3OTO B;  2HVJ C;  3LDE A;  2YUA A;  1VQO V;  1ZAU A;  1JQ0 A;  1H8E G;  1IZ3 A;  4JYC A;  1SF9 A;  3STZ C;  1TUB B;  5CBH A;  2AW9 A;  1KBH A;  3JYC A;  4PA6 A;  2UUA O;  1OV9 A;  4X1K A;  4JI8 B;  5LOV A;  4NTW A;  2EIM C;  3E2E A;  1JR9 A;  5KHK A;  5IYZ A;  3F5T A;  3MDS A;  3I56 V;  4Z2W A;  1PL4 A;  4MTG A;  3FFQ A;  3RBZ A;  2CGO A;  1G6U A;  3SJB C;  3S3X A;  5JCO A;  3BEH A;  4UV8 A;  5IJ9 B;  4BW9 A;  1MSW D;  2Z0A A;  4H33 A;  3A8T A;  3APQ A;  1KC8 W;  4ASU G;  1OCR C;  4W4K A;  1HNW B;  2OIG A;  4DV5 B;  3SYQ A;  1DTO A;  4UCS A;  4P2Z A;  3T1Y O;  1I7F A;  5LP6 C;  1BE3 H;  2ZIM A;  3RWR D;  1GM9 A;  4MVU A;  4FLU A;  3CMA V;  3RFR A;  4EFB A;  4MVM A;  1JCH A;  3L73 H;  1WA8 B;  4AI8 A;  1AI4 A;  2QTO A;  4FLX A;  3CB2 A;  2QJ1 A;  4UB8 Z;  3RYF B;  1WA8 A;  3UKM A;  4I5S A;  2YEV B;  4O4L A;  1Q81 W;  5JJE B;  4YJ2 B;  4JV5 B;  2HHH B;  4JV5 O;  2RDC A;  1NH2 D;  1VAR A;  2JRI A;  4ZI7 B;  1YF2 A;  3CJH B;  1XL6 A; 
#chains in the Genus database with same CATH homology
 3THO A;  5J2U A;  2RQ6 A;  4FLV A;  3ETQ A;  4HNA A;  3JSL A;  3M7M X;  2BTQ A;  4PHZ A;  4CH6 A;  4Q6G A;  5FPR A;  4TUY A;  1JFF A;  3K5O A;  3HKC B;  5FPO A;  4WBN A;  5CA0 A;  4KL1 A;  5GON B;  1P49 A;  4L8J A;  1HNZ B;  4UCT A;  4GKK B;  2R9A A;  2PYL A;  4ZI7 A;  1XNR B;  3HKC A;  5IJ9 A;  5IJ0 A;  2P22 C;  4JI3 B;  2YI9 A;  2JGU A;  2Q7G A;  4JI6 B;  4LF4 B;  2VWK A;  3RYF A;  2UXD B;  4DR7 B;  4DK0 A;  1Z5V A;  1Q5O A;  4YY3 B;  5KHI A;  4HNA B;  4CH4 A;  2F4V B;  3BAB A;  4I55 A;  4ZIB A;  5KMG A;  4X1K B;  4TV8 A;  5K1X A;  2ZM6 B;  4FLT A;  4EB6 A;  5LP6 B;  4ZOL B;  3U10 A;  4B3R B;  1FJG B;  4DUY B;  1N34 B;  2UXB B;  2UUA B;  2UU9 B;  3RYC B;  4U3J A;  4CC6 A;  5C8Y B;  1S5J A;  3JSN A;  1O9G A;  3T1H B;  4DR2 B;  5IJ0 B;  3JAR B;  4O4J B;  1I94 B;  1O9H A;  2ZIN A;  1VF7 A;  1JMK C;  4LH6 A;  5JVD B;  5KHH A;  4DK1 A;  4FM2 A;  4X64 B;  3B2E E;  4TQF A;  5ITZ A;  4YJ3 A;  2EX3 A;  3BHP A;  4YJ3 B;  1WNS A;  4PI2 A;  3SJA C;  4UCO A;  3VQY A;  3ICX A;  1JFF B;  5BR8 B;  4DV3 B;  1SQF A;  1HW7 A;  4LF6 B;  5LXT A;  4D7T A;  3VQW A;  4DV4 B;  1KU9 A;  1N32 B;  4NVP A;  4JI7 B;  3JAL B;  5EIB C;  3HKD B;  3JAK B;  4CC5 A;  1HNX B;  2PYJ A;  1Q3E A;  2PTM A;  4O4H A;  3K57 A;  5IYZ B;  3U11 A;  4JI2 B;  5CA1 A;  4JI1 B;  4CS2 A;  4UCR A;  3K5M A;  4ZOL A;  2YXL A;  2Q0A A;  5LA6 A;  4O2B A;  1SA0 A;  3WB1 A;  5LYJ A;  4X62 B;  1D5A A;  4DV7 B;  1Q8I A;  4JI0 B;  4CS3 A;  3HKB A;  4UFZ A;  1IBM B;  5LMU B;  4TV9 B;  1XI1 A;  4I50 A;  2YI8 A;  4DR3 B;  2ZNJ A;  4X1Y B;  4LF9 B;  3JAS B;  1FFX A;  1H2S B;  2VQE B;  4TOI A;  1N36 B;  2E3C A;  3BA9 A;  2VQF B;  4JYA B;  4B3T B;  2QM4 A;  5JQG B;  1N33 B;  3E22 B;  4DUZ B;  5LXT B;  1M4U A;  1TAE A;  2F95 B;  3JAW A;  3N2K A;  3SR2 C;  3E22 A;  5JCO C;  3UQ8 A;  2F66 C;  2BTQ B;  5EYP A;  4ZHQ B;  4AQY B;  3JAS A;  4LF8 B;  4FM0 A;  4LNU A;  4I50 B;  3JAR A;  4O4J A;  4TV9 A;  3T1Y B;  3RYH B;  4KHP B;  4K0K B;  3U0Z A;  2JVD A;  1X4T A;  4X1Y A;  2ZCE A;  5LMN B;  5KMG B;  4YHH B;  3ZED A;  4DR6 B;  3HKE A;  4LF7 B;  4DV2 B;  4EB6 B;  5LP6 A;  3N2G A;  4LH7 A;  5JH7 B;  4I4T A;  4F6R B;  4X1I B;  2P5O A;  2RJZ A;  5D5Q A;  4O2B B;  1TVK B;  4AHC A;  3N2G B;  1WPB A;  3HKD A;  4CS4 A;  2V4D A;  4O2A B;  1IBL B;  2YIA A;  3DSQ A;  3JAK A;  4WBN B;  1IBK B;  3ZS8 C;  3BRC A;  4DRX B;  4IIJ B;  5KX5 A;  2E5L B;  3UT5 B;  5JQG A;  4O4I A;  4FFB B;  5FNV A;  3WB0 A;  1KMI Z;  4LFC B;  5C8Y A;  2HEP A;  1FFX B;  1TA8 A;  5EIB D;  1V9P A;  4JI4 B;  3K5L A;  4DV6 B;  4LFA B;  3CHX A;  3K58 A;  4DV0 B;  4YJ2 A;  4K8X A;  3BPZ A;  3OTF A;  3RYI B;  4FM1 A;  4O2A A;  4F6R A;  1QHT A;  2YIB A;  2XHB A;  3UT5 A;  4DR5 B;  2UUC B;  2GV9 A;  2OYQ A;  2KKW A;  2IM9 A;  4U3J B;  1QQC A;  4B3S B;  4X1I A;  2UXC B;  4EFE A;  4UCU A;  4FLW A;  5JH7 A;  1TUB A;  3QF7 A;  4K8Z A;  3IAY A;  3PN1 A;  1SKV A;  4TV8 B;  2PGG A;  5GON A;  3QTC A;  2ZNI A;  5BMV A;  4LF5 B;  1M5I A;  5D5P A;  3RYH A;  1TGO A;  1M93 A;  3SGI A;  4TUY B;  5J2T B;  5FNV B;  1XNQ B;  4LR3 A;  3K59 A;  5CA0 B;  3JAT B;  4CH3 A;  5KX5 B;  5IWA B;  1NT2 B;  2R70 A;  4NXM B;  1XMO B;  4FFB A;  5JVD A;  3CSX A;  4X20 A;  2JS5 A;  2VWJ A;  4DR1 B;  1J5E B;  4DRX A;  5BMV B;  5ITZ B;  5JJJ B;  1B04 A;  1YEW A;  4GYC B;  4I4T B;  1SA0 B;  3QG5 A;  4I9Q A;  4IHJ B;  4D7S A;  2PUS A;  4JI5 B;  3VQV A;  1WN7 A;  3OTO B;  5J2U B;  4GKJ B;  1DGS A;  4B3M B;  1ZAU A;  3RGB A;  2R72 A;  5EZY B;  4BWA A;  3BA8 A;  3HKB B;  1TUB B;  4LNU B;  3BAA A;  3JAL A;  5CB4 A;  2ZIO A;  4X1K A;  4JI8 B;  5CB4 B;  4CH5 A;  5LOV A;  2Q7H A;  5LA6 B;  3SJC C;  5KHK A;  3HKE B;  4IHJ A;  1HR0 B;  5IYZ A;  1Q43 A;  2F93 B;  4GLX A;  3FFQ A;  3SJB C;  1G6U A;  4FLZ A;  3A2F A;  3JAW B;  5JCO A;  5KHG A;  2PY5 A;  4LFB B;  5IJ9 B;  4X65 B;  4X20 B;  4BW9 A;  1L8D A;  5EYP B;  4FVM A;  1Z5W A;  5K1P A;  3N2K B;  5J2T A;  4IIJ A;  3MAQ A;  4NXN B;  3JAT A;  2PZS A;  5LOV B;  1HNW B;  5KHJ A;  5LYJ B;  4DV1 B;  4O4I B;  4PI0 A;  3RYC A;  4DV5 B;  1T5E A;  2OWO A;  4UCS A;  1XHX A;  3LNN A;  4UCV A;  1I7F A;  5LP6 C;  2Q7E A;  2ZIM A;  4DR4 B;  3RWR D;  3K5N A;  4X66 B;  4FLU A;  2F1M A;  5JJN B;  3RFR A;  1TVK A;  1XMQ B;  4TQD A;  4EFB A;  4B08 A;  1XHZ A;  1RSO A;  3VQX A;  4EEQ A;  4FLX A;  3CB2 A;  1SQG A;  5EZY A;  2QJ1 A;  3RYF B;  1XQ8 A;  4O4L A;  4O4L B;  2BTO A;  3RYI A;  2UUB B;  4I55 B;  5JJE B;  4YJ2 B;  4JV5 B;  2HHH B;  2CAZ C;  5CA1 B;  2YIB D;  4O4H B;  4OX9 B;  3WB2 A;  1JJO A;  4HBN A;  4ZI7 B;  4AIL C;  4ZHQ A;  4FLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...