3SJAC

Crystal structure of s. cerevisiae get3 in the open state in complex with get1 cytosolic domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
MNELSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 24
structure length 61
sequence length 61
chains with identical sequence D, G, H, J
ec nomenclature
pdb deposition date 2011-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3sjaC00
2JS5A 2F66C 3B2EE 3QG5A 2P22C 3SJBC 3SJCC 3ZS8C 3ICXA 2CAZC 1SKVA 3THOA 1X4TA 3CSXA 3QF7A 1NT2B 3SJAC
chains in the Genus database with same CATH superfamily
4LFBO 4OX9B 3IC7A 1M56B 3CCQV 2QKCA 4JI6O 1NVPB 4LF8B 1GN3A 5L3FA 1OCZC 2A3QA 4O4HB 1IBKB 4TT3G 4JI7B 4RUFA 5LGUA 4DR3B 1Y67A 4P9PA 1GN4A 3E86A 2YEVA 2ZM6O 1M9NA 2PI4A 4DV7O 2CAZC 3U11A 1HNWB 3CXHF 1VARA 1X59A 1WPXA 2XOKG 3HKEB 3ABKC 3HKDB 5LOVA 2IJIA 2Q9LA 1D2DA 1JPXA 3K9AA 2ZE5A 4O4JB 1E1QG 3IGAC 2GDSA 1SQFA 5LBQA 3L72H 4TV9A 2QE7G 1VQLV 3NR7A 2MW2B 4B3RO 3H9VA 2FL4A 1LUVA 3JATB 2IM9A 4LNUA 3ZRXA 1KC8W 3K0GA 3ZMSA 1PM9A 4QGPA 1JJOA 1B04A 2Q0OC 2EILC 4YHHB 2JVDA 4DR1O 3SPGA 4FLUA 2VWKA 4DR2B 4H37A 3DSQA 1BCCH 1NTZH 3JD2A 3H1LH 3OMAB 4J7KA 4ZBMA 3ZHRA 2QEXV 2F4VB 4TWKA 4RO2A 4UCOA 2F66C 1YZBA 1IVSA 3AK1A 4X1IB 5JJNB 2YXLA 2EULA 4J41A 4YJ2A 1AROP 4O2BA 2EINB 4JI2B 1XNQO 4GX5A 3I56V 3DTUB 3IAYA 2OIEA 1JA8A 3TJTA 2HJFC 2YXHA 4X1YB 4GX1A 4MVRA 1IURA 3CRCA 5C93A 4YY3O 3B2EE 3W7UA 4DV1B 3TGUH 1GN2A 4J9ZB 4J7JA 4YJ3A 5FPOA 2KB1A 4QPKA 3K5OA 2ADPA 2P6JA 1MMMA 3L70H 1I5YA 2XAJA 3OR7C 4B7KA 5LP6B 2VQEO 2K9PA 1MZEA 1QHTA 4BIOA 1P49A 3OTFA 4TQDA 2RDCA 4MSWC 2ZIOA 4XDJA 5IYDO 4AQYO 4D6TH 3G6EV 5JH7A 3JSLA 1SQVH 3OFNG 2P5OA 4I0XA 4U3JB 4HBNA 4WBNB 4MVUA 4LFBB 5IJ9B 4IHJB 2ZE6A 2DYRB 4FVMA 2IJJA 2PYJA 2OT5A 3CHXA 4K8ZA 3RBZA 3DC6A 3JARB 3K58A 1OCRB 5KMGA 2ZM6B 1MNGA 3CCSV 4FLYA 5LXTA 2Y69C 3ICXA 5BR8B 3ZBHA 3HKBB 2WLIB 3ZCCA 5IE9A 3CMAV 4ZHQB 4JPRA 4GX0A 4JV5B 1HWYA 1PPJH 3N2GA 5ITZA 4B3MB 1SQGA 4AHCA 3T4DA 1D5NA 3K5NA 3LNMB 5EIBD 2O57A 4LH7A 2ARHA 3FFQA 3B77A 1KYOF 1COWG 1R3JC 1K97A 4MW8A 3AG1C 1RM1B 1AI7A 1HNZO 1J5EO 1YF2A 1Y6XA 4HZ3A 2FKXA 4ZOLA 2Z3YA 1GMGA 1VF6A 2NLJC 3CRQA 5J2UA 3P32A 3MHSC 3ABLB 3ZRVA 4LWSB 3RYCB 3DXRA 1EZJA 2KG7B 4DV0O 4JZGA 4ASUG 4TV8A 2YIDA 5IYBO 4RQFA 5BZBA 3LSUA 1OCCB 1WP7A 1GRJA 2Q5ZA 4RWUA 4JI3B 4PHZA 3J81N 3ZS8C 2ZE7A 4D7TA 4TSFG 4B3SO 3K57A 4MVSA 1F7YA 4O4HA 1YSCA 3LSSA 4YIPA 1E79G 4DUYO 1H2NA 1QLEB 2ILMA 1N32B 4O4IB 4J10A 1SQQH 4CC5A 4FIPC 2QA4V 4X62B 1M93A 4GKJO 2OCHA 3M7MX 2FB5A 3X2QB 2X6BA 4EB6B 4JAAA 3UQ8A 3TETA 4UUJC 3HKEA 5LA6B 2WLKA 3HKDA 1JR9A 2QJ1A 4PDMA 4U7NA 5LMNO 3B4SA 4DV4O 1TUBB 1YEWA 4DYLA 3RVYA 4QIWF 1Q6HA 4X65O 1YDXA 3E8FA 4LP8A 4I55B 4K0KO 5A9GA 2VQEB 2XAHA 4UV9A 3AK2A 3NXSA 1XDCA 4NB5A 3O9OA 3CJHB 1VQ6V 3JATA 1QBZA 4UVAA 4AQYB 3SJCC 4HYOA 1SS3A 1ZUQA 1P7BA 5L3BA 2HKOA 2A9HA 4GYCB 4L8JA 2Q4PA 5BMVB 1PKXA 3S3WA 4GT1A 1PL0A 4K35A 2ZR3A 3T1HO 1NTMH 3ABMB 2WSSG 4FMTA 3G6BA 1KECA 2K1EA 3W7SA 2WPDG 3GWKC 1NU1H 3S3XA 4FPPA 5L3DA 1HNXO 1F4MA 2F23A 3IJ4A 4KHPB 4X1IA 1BZKA 2EIKC 4KL1A 3FKSG 3OUFA 4QE7A 2F95B 4LFCB 5EK0A 1IBLB 1ORQC 3ETGA 3CXCU 4NXNO 1SETA 2LW1A 4NKGB 1VP7A 5IY5C 2VWJA 3MHHC 5LYJB 4X1YA 1ZAUA 5C8YB 2GBOA 1XMOO 4XDLA 1N4CA 1J5EB 3SYCA 1BL8A 5BXZA 2GTAA 2D2CB 3LDCA 2X6CA 3ML0A 3TCUA 3VQWA 1VQ5V 3DGEA 3E22B 5DN6G 4FZ1A 5LP6A 3CCJV 1Q82W 1V54B 1R6NA 2HG5C 4LH6A 2WLJA 1HP8A 1HR0B 4U3FH 4O2BB 1R73A 4NTXA 5CBHA 3UCSC 3UO2A 1XNRO 3AG7A 1WN7A 4LR3A 1VQMV 1AI4A 2HFEC 3UO3A 3LUTB 1G8MA 4MTXA 4U3JA 4WBNA 5IJ9A 4IHJA 1JVMA 1NJIW 1H2KA 4CC6A 3ETQA 2CDYA 4KUMA 3CC2V 5CA0B 4DUYB 3UKMA 3OEEG 4Z2WA 3K5LA 3CP1A 2DN9A 3JD1A 3JARA 1L1FA 5LGNA 4LF4O 4B3TB 1V55B 3U0ZA 2QM7A 2QWOB 3MAQA 2DQ0A 5CMUA 2CTPA 2ZXWB 3L73H 3R65A 3HKBA 2WLIA 1AI6A 2GHYA 2KSDA 4ZHQA 1VQKV 2RJZA 4X89A 5H2FZ 2WWWA 5B3SC 4OXSA 1T5EA 1KD1W 5EIBC 4GZRB 5B1AB 1Z5VA 5B5EZ 4DV2B 1H2MA 2QWQB 1VQPV 4K0KB 2OCCC 1RP3B 1ZTEA 4R50A 3BRCA 2A7WA 3APOA 2XNDG 4X64B 3FYEB 5CA1B 3E2EA 2Q68A 4JI0B 1VF6C 1I08A 4X66B 4CS2A 3H1IH 1UJWB 3VBBA 1YIJV 1ZSPA 3AG3B 4CS3A 1IX9A 1HDJA 4LWSA 3RYCA 1Q81W 2KG7A 1OJHA 4D7SA 2ETNA 1CEZA 2DWDC 5IDJA 1NQTA 1MOFA 1YJ9V 4FM0A 4UB6Z 4YXWG 4J42A 1N0NA 2P90A 4DR7B 4LF7B 3T1HB 1B3QA 2Z0AA 1GTOA 1FYJA 1M57B 3ASOB 5EC2C 4CH4A 1W0JG 1BQ0A 2Z5UA 4Q6GA 3KCXA 1UPGA 5KHGA 5LMUO 3OW2U 3Q4HB 3JCUZ 1XEQA 1P4RA 3ZX6A 2QTOA 4UCSA 4QE9A 2EIMB 4MW3A 4IGGA 4MTGA 3STLC 2LO1A 4O4IA 5H5NA 3D3IA 4UV8A 3G80A 1X4TA 3FYIB 1AJQA 4CBCA 4G2KA 1KMIZ 4WFGA 1AR4A 5EBLC 2BE3A 1WNSA 2QGNA 5LA6A 4JYAO 1XMOB 3LDDA 1K7DA 1NH2B 1NT2B 1Q5OA 4QPJA 2RQ6A 1TUBA 1WA8B 3PN1A 2W0XA 2ZCEA 4J11A 4JYYA 2YXYA 3W7WA 3KCYA 1JMKC 3LSQA 4I55A 1VF7A 5EZYB 3A0RA 3E8HA 5DEDA 3CJHA 2FTKA 3G71V 3ABUA 2F1MA 4OPHA 3KG2A 3A8TA 3N2KB 4I4TB 3CCUV 2ZKOA 4O4LB 3ASNB 4G27B 1GH6A 5BMVA 4WCEV 1IBMB 3M8AA 3D36A 1GM9A 4DXWA 4DR6O 3OR6C 4BW9A 4JI1O 4BIUA 1EN6A 4I9QA 1SESA 3BCCH 5LGTA 4LF4B 3MDSA 4OGQB 3TXQA 2UUAO 3KZIZ 5K1XA 5GTHZ 3AG4B 4LC1A 1BE3H 2EINC 3WFVA 4P9OA 5AG2A 4H44B 3ABTA 5LYJA 3ZJZA 1AP6A 4RQEA 1Z2GA 5C8YA 1XREA 2V4DA 3B8MA 1Q7YW 5J9PC 4R8CA 2IU3A 3ZHTA 3R66A 2HLDG 4DV5O 2UUCB 1G4YB 2X6AA 3E22A 5JCOA 2UU9B 4DV3O 3FB5C 5LP6C 3BABA 2X7RB 2UXDO 2VRZA 2M7WA 4X1KB 4FM1A 5B1NA 4E4EA 2OTJV 2ODMA 3OT7A 3QO5A 2X0LA 4RUEA 1DF4A 3F5TA 3SJBC 4F4LA 3KKYA 1H2LA 5H9CA 2E3CA 4FK5C 2Y0PA 4MTOA 1ZWIC 2DYRC 1M1KW 2UUBO 4IYHA 5CA0A 4MVOA 5FNVB 1M4UA 1JX9A 2OWOA 1OCRC 3OTOO 3JD4A 3K5MA 4DUZB 2P7TC 2Q67A 2VQFB 2IW5A 2RN9A 3U10A 1EZVH 1EN5A 3O65A 3N27A 4HAMA 5IYZB 3CB2A 3CWBH 3CRRA 4PD4F 1N33O 3SR2C 1YJWV 1MSWD 4A5UB 4CH6A 3ZHSA 5FPRA 4JI6B 5F2VO 2EJ7A 5KUMA 5CBFA 1RM1C 1XILA 5CA1A 2QM8A 4NXMO 4IIJB 4JTAB 3UM7A 1N0JA 3ABLC 4DV7B 5E79Z 4MS2A 1DLBA 4PI0A 2IBZH 1ENVA 4PA4A 2P06A 2XUMA 4LF9O 3VQYA 2JJ2G 1AJNA 2QWPB 2JEUA 5J2TB 2YIAA 1OCCC 4GKKO 1K33A 1KP2A 1SRYA 4UCUA 1FXHA 2KQXA 2GTSA 2R9IA 1PNLA 3RGBA 1XL4A 3Q4HA 4B3RB 1F23A 2CGNA 1I94O 4IT5A 1SZTA 1QLEC 3ZEDA 3F7YC 4H13B 1Y66A 3DC5A 1FJGO 3B40A 4K3AA 4DK0A 1NTKH 1MZFA 3SPHA 3QO7A 4JZ2A 3P30A 4FFKA 1YTFB 2Q8VA 4UXNA 1SA0B 1K5SA 4DR1B 2QM4A 4JGSA 4DR5O 4H33A 2Y69B 1WA8A 5KAIZ 1PP9H 3PJSK 3ZMZA 3QO8A 1Y4MA 1EBOA 1QNMA 2ZD9A 1NVPD 5EZYA 1V9PA 3WG7B 3D8CA 1N36O 1JCHA 3QF7A 2DQ3A 1L0LH 2R9RB 2P4KA 5K1PA 1S5HC 2AZ2A 3N2KA 4DV6O 1YI2V 1BHAA 1N34O 2GV9A 4JI8O 4I4TA 1XNQB 4MT8A 4DR4O 4HNAB 4PJ0Z 5JWPA 3BA9A 2ITCC 4O4LA 4WFHA 1RPRA 2PF4E 2Y4UA 2E5LO 4UCVA 4PA3A 4DRXB 3OE7G 4LF5O 4YY3B 3AK3A 3D36C 3CE2A 5CN0A 3L74H 3ABMC 3F7VC 4W4KA 3E8BA 3EXAA 3TXSA 3A2FA 2EZOA 3CS5A 1QLNA 2CTWA 2ADQB 4FLZA 4K8XA 4EKWA 1OCOB 2AGAA 2M6YA 1WP8A 4MVZA 2Q69A 1K8AW 3ZHQA 2ZIMA 1D5AA 5GONB 1XL6A 4XBFA 3GWOA 2R70A 5KUKA 4Z1VA 1VQOV 3K79A 1WJZA 1SF9A 3JAKB 4I50B 1TUEB 1Q6IA 1ZL8B 1U97A 3BY6A 2IH1C 2UXXA 2Y4TA 2HP8A 1G6UA 1QQCA 3CEIA 1NS1A 2CE4A 2F43G 3A0BZ 3SYAA 1Q8IA 4BIZA 4AI8A 5JCOC 4JYBA 4NTYA 1K92A 2PUSA 4TUYB 1E1RG 4JYCA 4EEQA 1V54C 4DK1A 2Q7HA 5H6QA 4LF9B 4ZIBA 4X1KA 2H94A 3HB3B 2WLLA 4IL6Z 4X20B 4GKKB 2Y0IA 1ROPA 4BAYA 3SPJA 1GKFA 4PDVA 2A0LA 1Y76A 4WFFA 3CCRV 1HNZB 3QG5A 2GUZB 2PI5A 2H3OA 4E2LA 1FPOA 5FNVA 4PELA 4XDKA 3GB7C 4CS4A 4LFAO 1ZLZA 2DOSA 3SGIA 1LUWA 4DV0B 1GO3F 5KHKA 3JAWB 2XAGA 2ZXWC 3ZN1A 3I55V 2PZSA 1S5LZ 3VOUA 1GAXA 3H1HH 3J7AU 1AVMA 2CTRA 1VMGA 5IYZA 3JALB 4OX9O 1VF5B 3CRAA 3C3TA 4GUNA 4LF8O 3K59A 2NNUA 5LHGA 1IBKO 4Z1MG 4PV1B 5B1AC 4B3SB 2QTSA 1EN4A 4G28B 1VQNV 5L3GA 1FKAO 4N21A 5JVDB 2EIJB 3RT3C 2IJKA 1W2BU 3H1JH 1FFXB 4GX2A 4IIJA 1RFYA 5IY5B 1HNWO 2W6IG 1H38A 2P22C 4JI8B 4GKJB 2B5UA 3J80N 3AG3C 4FFBB 4DR4B 2BTQB 1SERA 2BTOA 2OYQA 3C90A 4UB8Z 3OUSA 2VS0A 1L8DA 3VQVA 3JASB 4RAIA 1R6TA 5J2TA 5LMNB 2DJVA 4DV4B 4BR6A 1Y74B 4CH3A 2ZINA 1NI8A 2FYUH 2B1GA 1M57C 3ASOC 1AJPA 3THOA 4X65B 1R3IC 3P3PA 2DYSB 1YVWA 1B6QA 1Q86W 2JGUA 1K34A 3T1YO 2EIMC 4ZI7B 2L6LA 4YHHO 3EVKA 4DR2O 1BGYH 3OGCC 1SA0A 4BW5A 2B9ZA 2ZQMA 1S3JA 1XUQA 2LFSA 1P7GA 3IFXA 2F4VO 2G38A 3RWRD 4JTDB 2PYLA 3EFFK 1O9GA 3JCZA 1K3EA 4O2AB 1HNXB 5GW7A 2BSKB 2ZNJA 1M56C 1SKVA 1KKCA 3SYOA 2CUGA 2WLMA 3T2MA 4OPAA 4JI2O 2ZR2A 4B08A 4JTCB 4NXNB 2Q73A 2ZDIA 4HNAA 1VQ4V 2YI8A 2QDOA 4DV1O 5B1BB 3ASNC 2AHYA 3STZC 4DW0A 4DRXA 4UCRA 2HR3A 1AILA 1FFTB 4J9YB 4YIOA 1FXKB 4JAUA 5KX5B 3K08A 1RSOB 4MVMA 2GSMB 1VEWA 2E75B 2QKAA 1TA8A 1WPBA 5A2QN 1U96A 2BOBC 5FLXN 1PNMA 2EX3A 3ZMTA 5KA5A 5GONA 1MABG 1Q43A 2R72A 3OD4A 3AG4C 1VQ9V 2NR5A 1XNRB 1XI1A 4CH5A 2JGDB 3JAKA 4I50A 1XMQO 3FAVB 1JJ2U 1ZL8A 3K06A 1SQXH 2XASA 1SZXA 3I5DA 3SYPA 1B06A 5BR8O 2JIZG 4F6EA 1TVKB 2JS3A 2Q7EA 4JV5O 1GM8A 5EYPB 5CB4B 3AG2B 1R3KC 4B3MO 4TUYA 2RNBA 1PV0A 2AXTZ 2JEXA 3CCVV 1THZA 1OZ0A 2HHHO 4X20A 3BEHA 3H1KH 3QNEA 1OCZB 3WU2Z 2YS8A 3ETEA 5GTIZ 2OIGA 2DWEC 1S72V 5BY1A 1H2GA 4FLWA 1XBLA 2ATKC 3SDLA 2GUZA 4CZZA 4NR1A 4FLVA 2N74A 2UXNA 2LGWA 3T1YB 4WF9V 3CSXA 2AHZA 3APQA 3ABKB 5JJEB 4GCZA 2OTLV 4IYIA 3JAWA 3BA8A 1AR1B 1R1BA 3CC4V 5EBWC 4JI3O 2WLLB 4B7EA 4LF6O 1JFFB 4PA6A 3JALA 3WB0A 1CXZB 3CC7V 3FB7C 1DTOA 1YJNV 3ZHVA 5JQGB 3D3QA 2B1IA 1Y76B 5LMUB 1N32O 1YCIA 3CRMA 5DM6V 2QWNB 5JVDA 4X62O 1FFXA 2EILB 2YSUB 2CH7A 3SYQA 3BVOA 2D3OW 3HR0A 3ZRWB 4FFBA 2BTQA 1XHZA 4QNHB 1K4DC 4H0LB 5DECA 1GN6A 1URFA 3CPWU 3JASA 4JYAB 4F6RB 3UT5B 5HFMA 1KKDA 2E76B 1Y74A 3RN4A 2MK3A 1YITV 3RW0A 1NBMG 2HJDA 5FL7G 2L35A 1Q6UA 1BHBA 1W59A 4I7ZB 2XHBA 3SJAC 3CD6V 2N04A 3E35A 1K5QA 5HFLA 2UXCO 3OEHG 5IT9N 2XAQA 4ZI7A 2CK3G 3K9SA 4P30A 3E8GA 1K9MW 2UXBO 1XMQB 3VQXA 4ICGA 2PTMA 1SC5B 1Q90D 4DR6B 1IZ3A 3ZHUA 4JI1B 3CX5F 1M5IA 4KXRA 4JI5O 2CGOA 3W7TA 4KHPO 2JK5C 1L0NH 1QU7A 3W7XA 4O2AA 3H01A 2BSKA 3L9DA 2JS5A 5CBGA 2UUAB 2IH3C 4LFCO 1KP3A 3BFRA 2H8PC 1IBLO 3BPZA 3RYHB 3K04A 2V7QG 4N23A 1FD9A 3FD9A 3WG7C 4FM2A 1I7FA 3BAAA 1S0VA 2LP7A 4KFMA 3SPCA 5EC1C 4UVBA 2HHHB 4R7CA 1PD3A 2ZDIC 1MSDA 3C3SA 4JI4O 2LJ2A 2YC0A 1I0HA 3X2QC 3HKCA 3B09A 5LL6Y 4J80A 1NH2D 2LW7A 5CA3A 1F4NA 1FXKA 5KX5A 1LR1A 1RSOA 3JAMN 3T1CA 2BCCH 2LFRA 4DV5B 1K73W 1H8HG 1H2SB 4DV3B 3RYFB 4EFEA 1HR0O 1QCEA 1OCOC 2E74B 2UXDB 4I9WA 5IJ0B 2EBOA 3CCLV 2WA3A 1S5JA 1BSMA 2QSAA 3LDEA 4LF6B 1Z5WA 4Q20A 2W0FC 1K4CC 3AG1B 3OM3B 2DMXA 2JGDA 1R3LC 3FAVA 2QR4A 1IXBA 3JD3A 4GLXA 4AILC 1BS3A 2UUBB 1ZX3A 3ZIAG 1QR8A 4B3TO 1F51A 4I5SA 2JDIG 4J7ZA 4BWAA 2HVKC 3MD0A 3G67A 2WLNA 3OTOB 1TVKA 4LBEC 5KHIA 5EYPA 5CB4A 2QKSA 1MG1A 4FZ0A 5H6RA 2YI9A 1Q3EA 2RCVA 4O4JA 3RYIB 1CPYA 1J95A 1NKDA 4NYKA 4DV2O 1N33B 1XHXA 1WB8A 1NR1A 2EJRA 5D5QA 3RFRA 5IYCO 4MTFA 4X64O 2BOCC 1VIBA 4ZKIA 3ETDA 4JI0O 4X66O 3ZRSA 2V1DA 2YEVB 2WAMA 3IC9A 2Q7GA 4NXMB 2ZT9B 2UXCB 2EZPA 3ZN0A 1S77D 3GVMA 1BQZA 1MA1A 3FB6C 1PL4A 1LNQA 5LOVB 4DR7O 2UXBB 4LF7O 4QJFB 2A06H 1SQBH 1FAFA 1DK1A 1P84F 4TV9B 1S76D 4X8AA 1JFFA 2AW9A 5IWAO 2DW4A 4JI5B 2KKWA 3SPIA 3K3WA 1EM1A 2XAFA 5JQGA 2ITDC 2LQTA 4PA9A 3CYOA 3CCMV 4U7OA 1BT8A 4LNUB 1XQ8A 1M90W 3FX7A 3OMIB 1I94B 3AEIA 1IDSA 2EIJC 5KHJA 2LGQA 3B8NA 1JOYA 2IU0A 4PDLA 4PI2A 4EFBA 1FJGB 1V55C 2YDEA 5LHIA 5KLVH 3SJQC 3ZRWA 4JI4B 2PGGA 5LHHA 1YHQV 2IJHA 1OV9A 4DR5B 1TGOA 4F6RA 1DGSA 4UVCA 3UT5A 1JQ0A 2HVJC 5L3EA 4TQFA 1IXMA 2CTQA 2EIKB 3JD0A 4C7UA 1HW7A 1QVFU 1VQ7V 1EFRG 5L3CA 3RVZA 4TOIA 3JSNA 1WAZA 4JI7O 5KHHA 4DR3O 4YJ2B 2DYSC 4WFAV 1N36B 2JRIA 3T4ZA 3K0DA 1KU9A 1NR7A 2NN4A 2CH7B 3JYCA 4DV6B 3M99B 4WFBV 1N34B 5B1OA 1CP9A 2XT9A 1IBMO 3CMEV 2QWRB 4KP4A 1YXBA 2RMKB 2E5LB 5B66Z 4YJ3B 1KUQA 4LF5B 4LCUC 3L75H 4ABMA 1AB3A 2DE0X 4DO2A 1R6KA 1QVGU 2N05A 4FLTA 4P2ZA 4L87A 1O9HA 1VQ8V 4R6ZA 1KB9F 3HPLC 4UCTA 2A79B 3RYHA 4X9QA 5E1AC 4PDRA 5JH7B 2ZNIA 3QTCA 4JASA 4PA7A 2WA4A 4I0XB 4NVPA 1RPOA 1NZ6A 2WLHA 3WB1A 2C2AA 2PY5A 2W6JG 1QR9A 3WB2A 3ZMVA 3LNNA 1US6A 1YTFD 2P67A 1AP5A 1PNKA 4UFZA 2F93B 4JAVA 5B1BC 4JF3A 4WFEA 1XOUA 2YUAA 5KMGB 1GM7A 1UFIA 3F5WC 2UUCO 1KBHA 2YIBA 5LXTB 2UU9O 2YIBD 1FXKC 5EBMC 3CCEV 3OGIB 3QVNA 3BHPA 3TK1A 2XTAA 1H8EG 1AI5A 3RYFA 2Q6AA 3N2GB 5B3SB 3A0HZ 4MVQA 5ITZB 2R9AA 2FMLA 3K03A 2YICA 3OAAG 1W0KG 1OHHG 5IJ0A 1BMFG 3FB8C 2P4VA 1KQSU 1FS0G 1WLEA 1G1XB 2OCCB 3OMNB 3L71H 5IWAB 1I5XA 3G4SV 1N8RW 3HKCB 1FXVA 4ZOLB 5J2UB 5D5PA 5JJJB 1AR5A 1TAEA 4NTWA 3E83A 5KA6A 3EHBB 4W4LA 3DXRB 2Q0AA 2JJ1G 2ZE8A 5KAFZ 4FLXA 4LFAB 2AZ0A 4DUZO 4TV8B 4FJCC 4DW1A 4EB6A 1GK9A 2VQFO 1SQPH 2HEPA 1WB7A 1DF5A 3E89A 3AG2C 5TISZ 1A32A 4X88A 3P3NA 3ZMUA 2Y48A 3RYIA
chains in the Genus database with same CATH topology
3UT5B 5IJ9A 4IHJA 4YY3B 4OX9B 4CC6A 4LF8B 3ETQA 4O4HB 5CA0B 3A2FA 1IBKB 4DUYB 3K5LA 4FLZA 4JI7B 3JARA 2XHBA 4K8XA 4DR3B 4B3TB 3U0ZA 3SJAC 3MAQA 2ZIMA 2CAZC 1D5AA 3U11A 3HKBA 5GONB 1HNWB 2R70A 4ZI7A 4ZHQA 2RJZA 3HKEB 3HKDB 5LOVA 1T5EA 3JAKB 4I50B 3VQXA 1XMQB 5EIBC 4O4JB 2PTMA 1SQFA 1Z5VA 4DR6B 4TV9A 4DV2B 4K0KB 4JI1B 1M5IA 3BRCA 1G6UA 1QQCA 4X64B 1Q8IA 5CA1B 3JATB 4O2AA 4JI0B 2JS5A 4X66B 4CS2A 2UUAB 2IM9A 4LNUA 4CS3A 5JCOC 3BPZA 3RYHB 3RYCA 4D7SA 1B04A 1JJOA 2PUSA 4TUYB 4EEQA 4FM2A 4DK1A 1I7FA 2Q7HA 4LF9B 3BAAA 4ZIBA 4X1KA 4FM0A 4YHHB 4DR7B 2JVDA 4FLUA 2VWKA 4DR2B 3T1HB 2HHHB 4LF7B 4X20B 3DSQA 4GKKB 3HKCA 4CH4A 4Q6GA 2F4VB 5KHGA 1HNZB 4UCOA 2F66C 3QG5A 5KX5A 4X1IB 4UCSA 1RSOA 5JJNB 2YXLA 4DV5B 5FNVA 4CS4A 4O4IA 1H2SB 4DV3B 3RYFB 4EFEA 4YJ2A 1X4TA 3SGIA 4DV0B 4O2BA 2UXDB 4JI2B 5KHKA 3JAWB 3IAYA 1KMIZ 5IJ0B 2PZSA 1S5JA 4LF6B 4X1YB 1Z5WA 1WNSA 5LA6A 1XMOB 1NT2B 1Q5OA 5IYZA 3JALB 3B2EE 2RQ6A 4DV1B 1TUBA 3PN1A 2ZCEA 3K59A 4YJ3A 4GLXA 5FPOA 3K5OA 4B3SB 1JMKC 4AILC 2UUBB 4I55A 1VF7A 5EZYB 5LP6B 5JVDB 1FFXB 4BWAA 1QHTA 4IIJA 1P49A 2F1MA 3OTFA 4TQDA 3OTOB 1TVKA 2ZIOA 3N2KB 2P22C 4JI8B 4GKJB 4I4TB 5KHIA 4FFBB 4DR4B 2BTQB 5EYPA 5CB4A 2BTOA 2OYQA 5JH7A 4O4LB 2YI9A 1Q3EA 3JSLA 5BMVA 4O4JA 1L8DA 3VQVA 2P5OA 3JASB 1IBMB 4U3JB 3RYIB 4HBNA 4WBNB 4LFBB 5IJ9B 4IHJB 5J2TA 5LMNB 4DV4B 1N33B 4BW9A 1XHXA 4FVMA 4CH3A 2ZINA 5D5QA 3RFRA 2PYJA 3CHXA 4I9QA 3THOA 4X65B 4K8ZA 3JARB 4LF4B 3K58A 5KMGA 2ZM6B 4FLYA 5LXTA 2Q7GA 3ICXA 5BR8B 4NXMB 2UXCB 5K1XA 3HKBB 2JGUA 4ZI7B 4ZHQB 4JV5B 3N2GA 5LOVB 2UXBB 5ITZA 4B3MB 1SQGA 4AHCA 3K5NA 5EIBD 4LH7A 3FFQA 1SA0A 5LYJA 4TV9B 5C8YA 1JFFA 3RWRD 2PYLA 4JI5B 2V4DA 2KKWA 5JQGA 4ZOLA 1O9GA 4O2AB 1HNXB 5J2UA 2ZNJA 2UUCB 3E22A 4LNUB 1SKVA 5JCOA 2UU9B 1XQ8A 3RYCB 1I94B 5LP6C 3BABA 5KHJA 4B08A 4TV8A 4X1KB 4FM1A 4PI2A 4EFBA 1FJGB 4NXNB 4JI4B 4HNAA 2PGGA 2YI8A 4JI3B 3SJBC 4PHZA 3ZS8C 4DRXA 4UCRA 2E3CA 4DR5B 1TGOA 4D7TA 4F6RA 1DGSA 3UT5A 3K57A 4TQFA 5KX5B 4O4HA 5CA0A 1HW7A 5FNVB 4TOIA 1N32B 1M4UA 3JSNA 4O4IB 5KHHA 4CC5A 2OWOA 1TA8A 1WPBA 4YJ2B 1N36B 4X62B 1M93A 3K5MA 2EX3A 4DUZB 1KU9A 3M7MX 5GONA 4EB6B 2VQFB 1Q43A 2R72A 4DV6B 3U10A 3UQ8A 1N34B 3HKEA 5LA6B 3HKDA 1XNRB 2QJ1A 5IYZB 3CB2A 1XI1A 4CH5A 3JAKA 4I50A 3SR2C 1TUBB 1YEWA 2E5LB 4CH6A 4YJ3B 4LF5B 5FPRA 4JI6B 4I55B 2VQEB 4FLTA 1O9HA 5CA1A 4IIJB 3JATA 1TVKB 4UCTA 2Q7EA 4AQYB 3SJCC 3RYHA 4DV7B 5EYPB 5CB4B 4PI0A 4TUYA 5JH7B 2ZNIA 3QTCA 4GYCB 4L8JA 5BMVB 3VQYA 4NVPA 3WB1A 5J2TB 2PY5A 4X20A 2YIAA 3WB2A 3LNNA 4UFZA 4UCUA 2F93B 4FLWA 3RGBA 5KMGB 4B3RB 2YIBA 5LXTB 4KHPB 2YIBD 4X1IA 4FLVA 4KL1A 3BHPA 3T1YB 4LFCB 2F95B 3ZEDA 3CSXA 1IBLB 3RYFA 5JJEB 3N2GB 5ITZB 2R9AA 4DK0A 3JAWA 3BA8A 5IJ0A 1SA0B 4DR1B 2VWJA 2QM4A 5LYJB 4X1YA 1ZAUA 5C8YB 1JFFB 5IWAB 3JALA 3WB0A 1J5EB 3HKCB 5JQGB 4ZOLB 3VQWA 5J2UB 5LMUB 5D5PA 5JJJB 1TAEA 3E22B 5EZYA 1V9PA 5LP6A 5JVDA 3QF7A 2Q0AA 4FLXA 4LH6A 1FFXA 4LFAB 4TV8B 5K1PA 1HR0B 4EB6A 2HEPA 3N2KA 2GV9A 4O2BB 4I4TA 1XNQB 4FFBA 2BTQA 4HNAB 1XHZA 1WN7A 4LR3A 3BA9A 4O4LA 4UCVA 3JASA 4DRXB 4U3JA 4JYAB 3RYIA 4WBNA 4F6RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JS5 A;  2F66 C;  3B2E E;  3QG5 A;  2P22 C;  3SJB C;  3SJC C;  3ZS8 C;  3ICX A;  2CAZ C;  1SKV A;  3THO A;  1X4T A;  3CSX A;  3QF7 A;  1NT2 B;  3SJA C; 
#chains in the Genus database with same CATH topology
 4LFB O;  4OX9 B;  3IC7 A;  1M56 B;  3CCQ V;  2QKC A;  4JI6 O;  1NVP B;  4LF8 B;  1GN3 A;  5L3F A;  1OCZ C;  2A3Q A;  4O4H B;  1IBK B;  4TT3 G;  4JI7 B;  4RUF A;  5LGU A;  4DR3 B;  1Y67 A;  4P9P A;  1GN4 A;  3E86 A;  2YEV A;  2ZM6 O;  1M9N A;  2PI4 A;  4DV7 O;  2CAZ C;  3U11 A;  1HNW B;  3CXH F;  1VAR A;  1X59 A;  1WPX A;  2XOK G;  3HKE B;  3ABK C;  3HKD B;  5LOV A;  2IJI A;  2Q9L A;  1D2D A;  1JPX A;  3K9A A;  2ZE5 A;  4O4J B;  1E1Q G;  3IGA C;  2GDS A;  1SQF A;  5LBQ A;  3L72 H;  4TV9 A;  2QE7 G;  1VQL V;  3NR7 A;  2MW2 B;  4B3R O;  3H9V A;  2FL4 A;  1LUV A;  3JAT B;  2IM9 A;  4LNU A;  3ZRX A;  1KC8 W;  3K0G A;  3ZMS A;  1PM9 A;  4QGP A;  1JJO A;  1B04 A;  2Q0O C;  2EIL C;  4YHH B;  2JVD A;  4DR1 O;  3SPG A;  4FLU A;  2VWK A;  4DR2 B;  4H37 A;  3DSQ A;  1BCC H;  1NTZ H;  3JD2 A;  3H1L H;  3OMA B;  4J7K A;  4ZBM A;  3ZHR A;  2QEX V;  2F4V B;  4TWK A;  4RO2 A;  4UCO A;  2F66 C;  1YZB A;  1IVS A;  3AK1 A;  4X1I B;  5JJN B;  2YXL A;  2EUL A;  4J41 A;  4YJ2 A;  1ARO P;  4O2B A;  2EIN B;  4JI2 B;  1XNQ O;  4GX5 A;  3I56 V;  3DTU B;  3IAY A;  2OIE A;  1JA8 A;  3TJT A;  2HJF C;  2YXH A;  4X1Y B;  4GX1 A;  4MVR A;  1IUR A;  3CRC A;  5C93 A;  4YY3 O;  3B2E E;  3W7U A;  4DV1 B;  3TGU H;  1GN2 A;  4J9Z B;  4J7J A;  4YJ3 A;  5FPO A;  2KB1 A;  4QPK A;  3K5O A;  2ADP A;  2P6J A;  1MMM A;  3L70 H;  1I5Y A;  2XAJ A;  3OR7 C;  4B7K A;  5LP6 B;  2VQE O;  2K9P A;  1MZE A;  1QHT A;  4BIO A;  1P49 A;  3OTF A;  4TQD A;  2RDC A;  4MSW C;  2ZIO A;  4XDJ A;  5IYD O;  4AQY O;  4D6T H;  3G6E V;  5JH7 A;  3JSL A;  1SQV H;  3OFN G;  2P5O A;  4I0X A;  4U3J B;  4HBN A;  4WBN B;  4MVU A;  4LFB B;  5IJ9 B;  4IHJ B;  2ZE6 A;  2DYR B;  4FVM A;  2IJJ A;  2PYJ A;  2OT5 A;  3CHX A;  4K8Z A;  3RBZ A;  3DC6 A;  3JAR B;  3K58 A;  1OCR B;  5KMG A;  2ZM6 B;  1MNG A;  3CCS V;  4FLY A;  5LXT A;  2Y69 C;  3ICX A;  5BR8 B;  3ZBH A;  3HKB B;  2WLI B;  3ZCC A;  5IE9 A;  3CMA V;  4ZHQ B;  4JPR A;  4GX0 A;  4JV5 B;  1HWY A;  1PPJ H;  3N2G A;  5ITZ A;  4B3M B;  1SQG A;  4AHC A;  3T4D A;  1D5N A;  3K5N A;  3LNM B;  5EIB D;  2O57 A;  4LH7 A;  2ARH A;  3FFQ A;  3B77 A;  1KYO F;  1COW G;  1R3J C;  1K97 A;  4MW8 A;  3AG1 C;  1RM1 B;  1AI7 A;  1HNZ O;  1J5E O;  1YF2 A;  1Y6X A;  4HZ3 A;  2FKX A;  4ZOL A;  2Z3Y A;  1GMG A;  1VF6 A;  2NLJ C;  3CRQ A;  5J2U A;  3P32 A;  3MHS C;  3ABL B;  3ZRV A;  4LWS B;  3RYC B;  3DXR A;  1EZJ A;  2KG7 B;  4DV0 O;  4JZG A;  4ASU G;  4TV8 A;  2YID A;  5IYB O;  4RQF A;  5BZB A;  3LSU A;  1OCC B;  1WP7 A;  1GRJ A;  2Q5Z A;  4RWU A;  4JI3 B;  4PHZ A;  3J81 N;  3ZS8 C;  2ZE7 A;  4D7T A;  4TSF G;  4B3S O;  3K57 A;  4MVS A;  1F7Y A;  4O4H A;  1YSC A;  3LSS A;  4YIP A;  1E79 G;  4DUY O;  1H2N A;  1QLE B;  2ILM A;  1N32 B;  4O4I B;  4J10 A;  1SQQ H;  4CC5 A;  4FIP C;  2QA4 V;  4X62 B;  1M93 A;  4GKJ O;  2OCH A;  3M7M X;  2FB5 A;  3X2Q B;  2X6B A;  4EB6 B;  4JAA A;  3UQ8 A;  3TET A;  4UUJ C;  3HKE A;  5LA6 B;  2WLK A;  3HKD A;  1JR9 A;  2QJ1 A;  4PDM A;  4U7N A;  5LMN O;  3B4S A;  4DV4 O;  1TUB B;  1YEW A;  4DYL A;  3RVY A;  4QIW F;  1Q6H A;  4X65 O;  1YDX A;  3E8F A;  4LP8 A;  4I55 B;  4K0K O;  5A9G A;  2VQE B;  2XAH A;  4UV9 A;  3AK2 A;  3NXS A;  1XDC A;  4NB5 A;  3O9O A;  3CJH B;  1VQ6 V;  3JAT A;  1QBZ A;  4UVA A;  4AQY B;  3SJC C;  4HYO A;  1SS3 A;  1ZUQ A;  1P7B A;  5L3B A;  2HKO A;  2A9H A;  4GYC B;  4L8J A;  2Q4P A;  5BMV B;  1PKX A;  3S3W A;  4GT1 A;  1PL0 A;  4K35 A;  2ZR3 A;  3T1H O;  1NTM H;  3ABM B;  2WSS G;  4FMT A;  3G6B A;  1KEC A;  2K1E A;  3W7S A;  2WPD G;  3GWK C;  1NU1 H;  3S3X A;  4FPP A;  5L3D A;  1HNX O;  1F4M A;  2F23 A;  3IJ4 A;  4KHP B;  4X1I A;  1BZK A;  2EIK C;  4KL1 A;  3FKS G;  3OUF A;  4QE7 A;  2F95 B;  4LFC B;  5EK0 A;  1IBL B;  1ORQ C;  3ETG A;  3CXC U;  4NXN O;  1SET A;  2LW1 A;  4NKG B;  1VP7 A;  5IY5 C;  2VWJ A;  3MHH C;  5LYJ B;  4X1Y A;  1ZAU A;  5C8Y B;  2GBO A;  1XMO O;  4XDL A;  1N4C A;  1J5E B;  3SYC A;  1BL8 A;  5BXZ A;  2GTA A;  2D2C B;  3LDC A;  2X6C A;  3ML0 A;  3TCU A;  3VQW A;  1VQ5 V;  3DGE A;  3E22 B;  5DN6 G;  4FZ1 A;  5LP6 A;  3CCJ V;  1Q82 W;  1V54 B;  1R6N A;  2HG5 C;  4LH6 A;  2WLJ A;  1HP8 A;  1HR0 B;  4U3F H;  4O2B B;  1R73 A;  4NTX A;  5CBH A;  3UCS C;  3UO2 A;  1XNR O;  3AG7 A;  1WN7 A;  4LR3 A;  1VQM V;  1AI4 A;  2HFE C;  3UO3 A;  3LUT B;  1G8M A;  4MTX A;  4U3J A;  4WBN A;  5IJ9 A;  4IHJ A;  1JVM A;  1NJI W;  1H2K A;  4CC6 A;  3ETQ A;  2CDY A;  4KUM A;  3CC2 V;  5CA0 B;  4DUY B;  3UKM A;  3OEE G;  4Z2W A;  3K5L A;  3CP1 A;  2DN9 A;  3JD1 A;  3JAR A;  1L1F A;  5LGN A;  4LF4 O;  4B3T B;  1V55 B;  3U0Z A;  2QM7 A;  2QWO B;  3MAQ A;  2DQ0 A;  5CMU A;  2CTP A;  2ZXW B;  3L73 H;  3R65 A;  3HKB A;  2WLI A;  1AI6 A;  2GHY A;  2KSD A;  4ZHQ A;  1VQK V;  2RJZ A;  4X89 A;  5H2F Z;  2WWW A;  5B3S C;  4OXS A;  1T5E A;  1KD1 W;  5EIB C;  4GZR B;  5B1A B;  1Z5V A;  5B5E Z;  4DV2 B;  1H2M A;  2QWQ B;  1VQP V;  4K0K B;  2OCC C;  1RP3 B;  1ZTE A;  4R50 A;  3BRC A;  2A7W A;  3APO A;  2XND G;  4X64 B;  3FYE B;  5CA1 B;  3E2E A;  2Q68 A;  4JI0 B;  1VF6 C;  1I08 A;  4X66 B;  4CS2 A;  3H1I H;  1UJW B;  3VBB A;  1YIJ V;  1ZSP A;  3AG3 B;  4CS3 A;  1IX9 A;  1HDJ A;  4LWS A;  3RYC A;  1Q81 W;  2KG7 A;  1OJH A;  4D7S A;  2ETN A;  1CEZ A;  2DWD C;  5IDJ A;  1NQT A;  1MOF A;  1YJ9 V;  4FM0 A;  4UB6 Z;  4YXW G;  4J42 A;  1N0N A;  2P90 A;  4DR7 B;  4LF7 B;  3T1H B;  1B3Q A;  2Z0A A;  1GTO A;  1FYJ A;  1M57 B;  3ASO B;  5EC2 C;  4CH4 A;  1W0J G;  1BQ0 A;  2Z5U A;  4Q6G A;  3KCX A;  1UPG A;  5KHG A;  5LMU O;  3OW2 U;  3Q4H B;  3JCU Z;  1XEQ A;  1P4R A;  3ZX6 A;  2QTO A;  4UCS A;  4QE9 A;  2EIM B;  4MW3 A;  4IGG A;  4MTG A;  3STL C;  2LO1 A;  4O4I A;  5H5N A;  3D3I A;  4UV8 A;  3G80 A;  1X4T A;  3FYI B;  1AJQ A;  4CBC A;  4G2K A;  1KMI Z;  4WFG A;  1AR4 A;  5EBL C;  2BE3 A;  1WNS A;  2QGN A;  5LA6 A;  4JYA O;  1XMO B;  3LDD A;  1K7D A;  1NH2 B;  1NT2 B;  1Q5O A;  4QPJ A;  2RQ6 A;  1TUB A;  1WA8 B;  3PN1 A;  2W0X A;  2ZCE A;  4J11 A;  4JYY A;  2YXY A;  3W7W A;  3KCY A;  1JMK C;  3LSQ A;  4I55 A;  1VF7 A;  5EZY B;  3A0R A;  3E8H A;  5DED A;  3CJH A;  2FTK A;  3G71 V;  3ABU A;  2F1M A;  4OPH A;  3KG2 A;  3A8T A;  3N2K B;  4I4T B;  3CCU V;  2ZKO A;  4O4L B;  3ASN B;  4G27 B;  1GH6 A;  5BMV A;  4WCE V;  1IBM B;  3M8A A;  3D36 A;  1GM9 A;  4DXW A;  4DR6 O;  3OR6 C;  4BW9 A;  4JI1 O;  4BIU A;  1EN6 A;  4I9Q A;  1SES A;  3BCC H;  5LGT A;  4LF4 B;  3MDS A;  4OGQ B;  3TXQ A;  2UUA O;  3KZI Z;  5K1X A;  5GTH Z;  3AG4 B;  4LC1 A;  1BE3 H;  2EIN C;  3WFV A;  4P9O A;  5AG2 A;  4H44 B;  3ABT A;  5LYJ A;  3ZJZ A;  1AP6 A;  4RQE A;  1Z2G A;  5C8Y A;  1XRE A;  2V4D A;  3B8M A;  1Q7Y W;  5J9P C;  4R8C A;  2IU3 A;  3ZHT A;  3R66 A;  2HLD G;  4DV5 O;  2UUC B;  1G4Y B;  2X6A A;  3E22 A;  5JCO A;  2UU9 B;  4DV3 O;  3FB5 C;  5LP6 C;  3BAB A;  2X7R B;  2UXD O;  2VRZ A;  2M7W A;  4X1K B;  4FM1 A;  5B1N A;  4E4E A;  2OTJ V;  2ODM A;  3OT7 A;  3QO5 A;  2X0L A;  4RUE A;  1DF4 A;  3F5T A;  3SJB C;  4F4L A;  3KKY A;  1H2L A;  5H9C A;  2E3C A;  4FK5 C;  2Y0P A;  4MTO A;  1ZWI C;  2DYR C;  1M1K W;  2UUB O;  4IYH A;  5CA0 A;  4MVO A;  5FNV B;  1M4U A;  1JX9 A;  2OWO A;  1OCR C;  3OTO O;  3JD4 A;  3K5M A;  4DUZ B;  2P7T C;  2Q67 A;  2VQF B;  2IW5 A;  2RN9 A;  3U10 A;  1EZV H;  1EN5 A;  3O65 A;  3N27 A;  4HAM A;  5IYZ B;  3CB2 A;  3CWB H;  3CRR A;  4PD4 F;  1N33 O;  3SR2 C;  1YJW V;  1MSW D;  4A5U B;  4CH6 A;  3ZHS A;  5FPR A;  4JI6 B;  5F2V O;  2EJ7 A;  5KUM A;  5CBF A;  1RM1 C;  1XIL A;  5CA1 A;  2QM8 A;  4NXM O;  4IIJ B;  4JTA B;  3UM7 A;  1N0J A;  3ABL C;  4DV7 B;  5E79 Z;  4MS2 A;  1DLB A;  4PI0 A;  2IBZ H;  1ENV A;  4PA4 A;  2P06 A;  2XUM A;  4LF9 O;  3VQY A;  2JJ2 G;  1AJN A;  2QWP B;  2JEU A;  5J2T B;  2YIA A;  1OCC C;  4GKK O;  1K33 A;  1KP2 A;  1SRY A;  4UCU A;  1FXH A;  2KQX A;  2GTS A;  2R9I A;  1PNL A;  3RGB A;  1XL4 A;  3Q4H A;  4B3R B;  1F23 A;  2CGN A;  1I94 O;  4IT5 A;  1SZT A;  1QLE C;  3ZED A;  3F7Y C;  4H13 B;  1Y66 A;  3DC5 A;  1FJG O;  3B40 A;  4K3A A;  4DK0 A;  1NTK H;  1MZF A;  3SPH A;  3QO7 A;  4JZ2 A;  3P30 A;  4FFK A;  1YTF B;  2Q8V A;  4UXN A;  1SA0 B;  1K5S A;  4DR1 B;  2QM4 A;  4JGS A;  4DR5 O;  4H33 A;  2Y69 B;  1WA8 A;  5KAI Z;  1PP9 H;  3PJS K;  3ZMZ A;  3QO8 A;  1Y4M A;  1EBO A;  1QNM A;  2ZD9 A;  1NVP D;  5EZY A;  1V9P A;  3WG7 B;  3D8C A;  1N36 O;  1JCH A;  3QF7 A;  2DQ3 A;  1L0L H;  2R9R B;  2P4K A;  5K1P A;  1S5H C;  2AZ2 A;  3N2K A;  4DV6 O;  1YI2 V;  1BHA A;  1N34 O;  2GV9 A;  4JI8 O;  4I4T A;  1XNQ B;  4MT8 A;  4DR4 O;  4HNA B;  4PJ0 Z;  5JWP A;  3BA9 A;  2ITC C;  4O4L A;  4WFH A;  1RPR A;  2PF4 E;  2Y4U A;  2E5L O;  4UCV A;  4PA3 A;  4DRX B;  3OE7 G;  4LF5 O;  4YY3 B;  3AK3 A;  3D36 C;  3CE2 A;  5CN0 A;  3L74 H;  3ABM C;  3F7V C;  4W4K A;  3E8B A;  3EXA A;  3TXS A;  3A2F A;  2EZO A;  3CS5 A;  1QLN A;  2CTW A;  2ADQ B;  4FLZ A;  4K8X A;  4EKW A;  1OCO B;  2AGA A;  2M6Y A;  1WP8 A;  4MVZ A;  2Q69 A;  1K8A W;  3ZHQ A;  2ZIM A;  1D5A A;  5GON B;  1XL6 A;  4XBF A;  3GWO A;  2R70 A;  5KUK A;  4Z1V A;  1VQO V;  3K79 A;  1WJZ A;  1SF9 A;  3JAK B;  4I50 B;  1TUE B;  1Q6I A;  1ZL8 B;  1U97 A;  3BY6 A;  2IH1 C;  2UXX A;  2Y4T A;  2HP8 A;  1G6U A;  1QQC A;  3CEI A;  1NS1 A;  2CE4 A;  2F43 G;  3A0B Z;  3SYA A;  1Q8I A;  4BIZ A;  4AI8 A;  5JCO C;  4JYB A;  4NTY A;  1K92 A;  2PUS A;  4TUY B;  1E1R G;  4JYC A;  4EEQ A;  1V54 C;  4DK1 A;  2Q7H A;  5H6Q A;  4LF9 B;  4ZIB A;  4X1K A;  2H94 A;  3HB3 B;  2WLL A;  4IL6 Z;  4X20 B;  4GKK B;  2Y0I A;  1ROP A;  4BAY A;  3SPJ A;  1GKF A;  4PDV A;  2A0L A;  1Y76 A;  4WFF A;  3CCR V;  1HNZ B;  3QG5 A;  2GUZ B;  2PI5 A;  2H3O A;  4E2L A;  1FPO A;  5FNV A;  4PEL A;  4XDK A;  3GB7 C;  4CS4 A;  4LFA O;  1ZLZ A;  2DOS A;  3SGI A;  1LUW A;  4DV0 B;  1GO3 F;  5KHK A;  3JAW B;  2XAG A;  2ZXW C;  3ZN1 A;  3I55 V;  2PZS A;  1S5L Z;  3VOU A;  1GAX A;  3H1H H;  3J7A U;  1AVM A;  2CTR A;  1VMG A;  5IYZ A;  3JAL B;  4OX9 O;  1VF5 B;  3CRA A;  3C3T A;  4GUN A;  4LF8 O;  3K59 A;  2NNU A;  5LHG A;  1IBK O;  4Z1M G;  4PV1 B;  5B1A C;  4B3S B;  2QTS A;  1EN4 A;  4G28 B;  1VQN V;  5L3G A;  1FKA O;  4N21 A;  5JVD B;  2EIJ B;  3RT3 C;  2IJK A;  1W2B U;  3H1J H;  1FFX B;  4GX2 A;  4IIJ A;  1RFY A;  5IY5 B;  1HNW O;  2W6I G;  1H38 A;  2P22 C;  4JI8 B;  4GKJ B;  2B5U A;  3J80 N;  3AG3 C;  4FFB B;  4DR4 B;  2BTQ B;  1SER A;  2BTO A;  2OYQ A;  3C90 A;  4UB8 Z;  3OUS A;  2VS0 A;  1L8D A;  3VQV A;  3JAS B;  4RAI A;  1R6T A;  5J2T A;  5LMN B;  2DJV A;  4DV4 B;  4BR6 A;  1Y74 B;  4CH3 A;  2ZIN A;  1NI8 A;  2FYU H;  2B1G A;  1M57 C;  3ASO C;  1AJP A;  3THO A;  4X65 B;  1R3I C;  3P3P A;  2DYS B;  1YVW A;  1B6Q A;  1Q86 W;  2JGU A;  1K34 A;  3T1Y O;  2EIM C;  4ZI7 B;  2L6L A;  4YHH O;  3EVK A;  4DR2 O;  1BGY H;  3OGC C;  1SA0 A;  4BW5 A;  2B9Z A;  2ZQM A;  1S3J A;  1XUQ A;  2LFS A;  1P7G A;  3IFX A;  2F4V O;  2G38 A;  3RWR D;  4JTD B;  2PYL A;  3EFF K;  1O9G A;  3JCZ A;  1K3E A;  4O2A B;  1HNX B;  5GW7 A;  2BSK B;  2ZNJ A;  1M56 C;  1SKV A;  1KKC A;  3SYO A;  2CUG A;  2WLM A;  3T2M A;  4OPA A;  4JI2 O;  2ZR2 A;  4B08 A;  4JTC B;  4NXN B;  2Q73 A;  2ZDI A;  4HNA A;  1VQ4 V;  2YI8 A;  2QDO A;  4DV1 O;  5B1B B;  3ASN C;  2AHY A;  3STZ C;  4DW0 A;  4DRX A;  4UCR A;  2HR3 A;  1AIL A;  1FFT B;  4J9Y B;  4YIO A;  1FXK B;  4JAU A;  5KX5 B;  3K08 A;  1RSO B;  4MVM A;  2GSM B;  1VEW A;  2E75 B;  2QKA A;  1TA8 A;  1WPB A;  5A2Q N;  1U96 A;  2BOB C;  5FLX N;  1PNM A;  2EX3 A;  3ZMT A;  5KA5 A;  5GON A;  1MAB G;  1Q43 A;  2R72 A;  3OD4 A;  3AG4 C;  1VQ9 V;  2NR5 A;  1XNR B;  1XI1 A;  4CH5 A;  2JGD B;  3JAK A;  4I50 A;  1XMQ O;  3FAV B;  1JJ2 U;  1ZL8 A;  3K06 A;  1SQX H;  2XAS A;  1SZX A;  3I5D A;  3SYP A;  1B06 A;  5BR8 O;  2JIZ G;  4F6E A;  1TVK B;  2JS3 A;  2Q7E A;  4JV5 O;  1GM8 A;  5EYP B;  5CB4 B;  3AG2 B;  1R3K C;  4B3M O;  4TUY A;  2RNB A;  1PV0 A;  2AXT Z;  2JEX A;  3CCV V;  1THZ A;  1OZ0 A;  2HHH O;  4X20 A;  3BEH A;  3H1K H;  3QNE A;  1OCZ B;  3WU2 Z;  2YS8 A;  3ETE A;  5GTI Z;  2OIG A;  2DWE C;  1S72 V;  5BY1 A;  1H2G A;  4FLW A;  1XBL A;  2ATK C;  3SDL A;  2GUZ A;  4CZZ A;  4NR1 A;  4FLV A;  2N74 A;  2UXN A;  2LGW A;  3T1Y B;  4WF9 V;  3CSX A;  2AHZ A;  3APQ A;  3ABK B;  5JJE B;  4GCZ A;  2OTL V;  4IYI A;  3JAW A;  3BA8 A;  1AR1 B;  1R1B A;  3CC4 V;  5EBW C;  4JI3 O;  2WLL B;  4B7E A;  4LF6 O;  1JFF B;  4PA6 A;  3JAL A;  3WB0 A;  1CXZ B;  3CC7 V;  3FB7 C;  1DTO A;  1YJN V;  3ZHV A;  5JQG B;  3D3Q A;  2B1I A;  1Y76 B;  5LMU B;  1N32 O;  1YCI A;  3CRM A;  5DM6 V;  2QWN B;  5JVD A;  4X62 O;  1FFX A;  2EIL B;  2YSU B;  2CH7 A;  3SYQ A;  3BVO A;  2D3O W;  3HR0 A;  3ZRW B;  4FFB A;  2BTQ A;  1XHZ A;  4QNH B;  1K4D C;  4H0L B;  5DEC A;  1GN6 A;  1URF A;  3CPW U;  3JAS A;  4JYA B;  4F6R B;  3UT5 B;  5HFM A;  1KKD A;  2E76 B;  1Y74 A;  3RN4 A;  2MK3 A;  1YIT V;  3RW0 A;  1NBM G;  2HJD A;  5FL7 G;  2L35 A;  1Q6U A;  1BHB A;  1W59 A;  4I7Z B;  2XHB A;  3SJA C;  3CD6 V;  2N04 A;  3E35 A;  1K5Q A;  5HFL A;  2UXC O;  3OEH G;  5IT9 N;  2XAQ A;  4ZI7 A;  2CK3 G;  3K9S A;  4P30 A;  3E8G A;  1K9M W;  2UXB O;  1XMQ B;  3VQX A;  4ICG A;  2PTM A;  1SC5 B;  1Q90 D;  4DR6 B;  1IZ3 A;  3ZHU A;  4JI1 B;  3CX5 F;  1M5I A;  4KXR A;  4JI5 O;  2CGO A;  3W7T A;  4KHP O;  2JK5 C;  1L0N H;  1QU7 A;  3W7X A;  4O2A A;  3H01 A;  2BSK A;  3L9D A;  2JS5 A;  5CBG A;  2UUA B;  2IH3 C;  4LFC O;  1KP3 A;  3BFR A;  2H8P C;  1IBL O;  3BPZ A;  3RYH B;  3K04 A;  2V7Q G;  4N23 A;  1FD9 A;  3FD9 A;  3WG7 C;  4FM2 A;  1I7F A;  3BAA A;  1S0V A;  2LP7 A;  4KFM A;  3SPC A;  5EC1 C;  4UVB A;  2HHH B;  4R7C A;  1PD3 A;  2ZDI C;  1MSD A;  3C3S A;  4JI4 O;  2LJ2 A;  2YC0 A;  1I0H A;  3X2Q C;  3HKC A;  3B09 A;  5LL6 Y;  4J80 A;  1NH2 D;  2LW7 A;  5CA3 A;  1F4N A;  1FXK A;  5KX5 A;  1LR1 A;  1RSO A;  3JAM N;  3T1C A;  2BCC H;  2LFR A;  4DV5 B;  1K73 W;  1H8H G;  1H2S B;  4DV3 B;  3RYF B;  4EFE A;  1HR0 O;  1QCE A;  1OCO C;  2E74 B;  2UXD B;  4I9W A;  5IJ0 B;  2EBO A;  3CCL V;  2WA3 A;  1S5J A;  1BSM A;  2QSA A;  3LDE A;  4LF6 B;  1Z5W A;  4Q20 A;  2W0F C;  1K4C C;  3AG1 B;  3OM3 B;  2DMX A;  2JGD A;  1R3L C;  3FAV A;  2QR4 A;  1IXB A;  3JD3 A;  4GLX A;  4AIL C;  1BS3 A;  2UUB B;  1ZX3 A;  3ZIA G;  1QR8 A;  4B3T O;  1F51 A;  4I5S A;  2JDI G;  4J7Z A;  4BWA A;  2HVK C;  3MD0 A;  3G67 A;  2WLN A;  3OTO B;  1TVK A;  4LBE C;  5KHI A;  5EYP A;  5CB4 A;  2QKS A;  1MG1 A;  4FZ0 A;  5H6R A;  2YI9 A;  1Q3E A;  2RCV A;  4O4J A;  3RYI B;  1CPY A;  1J95 A;  1NKD A;  4NYK A;  4DV2 O;  1N33 B;  1XHX A;  1WB8 A;  1NR1 A;  2EJR A;  5D5Q A;  3RFR A;  5IYC O;  4MTF A;  4X64 O;  2BOC C;  1VIB A;  4ZKI A;  3ETD A;  4JI0 O;  4X66 O;  3ZRS A;  2V1D A;  2YEV B;  2WAM A;  3IC9 A;  2Q7G A;  4NXM B;  2ZT9 B;  2UXC B;  2EZP A;  3ZN0 A;  1S77 D;  3GVM A;  1BQZ A;  1MA1 A;  3FB6 C;  1PL4 A;  1LNQ A;  5LOV B;  4DR7 O;  2UXB B;  4LF7 O;  4QJF B;  2A06 H;  1SQB H;  1FAF A;  1DK1 A;  1P84 F;  4TV9 B;  1S76 D;  4X8A A;  1JFF A;  2AW9 A;  5IWA O;  2DW4 A;  4JI5 B;  2KKW A;  3SPI A;  3K3W A;  1EM1 A;  2XAF A;  5JQG A;  2ITD C;  2LQT A;  4PA9 A;  3CYO A;  3CCM V;  4U7O A;  1BT8 A;  4LNU B;  1XQ8 A;  1M90 W;  3FX7 A;  3OMI B;  1I94 B;  3AEI A;  1IDS A;  2EIJ C;  5KHJ A;  2LGQ A;  3B8N A;  1JOY A;  2IU0 A;  4PDL A;  4PI2 A;  4EFB A;  1FJG B;  1V55 C;  2YDE A;  5LHI A;  5KLV H;  3SJQ C;  3ZRW A;  4JI4 B;  2PGG A;  5LHH A;  1YHQ V;  2IJH A;  1OV9 A;  4DR5 B;  1TGO A;  4F6R A;  1DGS A;  4UVC A;  3UT5 A;  1JQ0 A;  2HVJ C;  5L3E A;  4TQF A;  1IXM A;  2CTQ A;  2EIK B;  3JD0 A;  4C7U A;  1HW7 A;  1QVF U;  1VQ7 V;  1EFR G;  5L3C A;  3RVZ A;  4TOI A;  3JSN A;  1WAZ A;  4JI7 O;  5KHH A;  4DR3 O;  4YJ2 B;  2DYS C;  4WFA V;  1N36 B;  2JRI A;  3T4Z A;  3K0D A;  1KU9 A;  1NR7 A;  2NN4 A;  2CH7 B;  3JYC A;  4DV6 B;  3M99 B;  4WFB V;  1N34 B;  5B1O A;  1CP9 A;  2XT9 A;  1IBM O;  3CME V;  2QWR B;  4KP4 A;  1YXB A;  2RMK B;  2E5L B;  5B66 Z;  4YJ3 B;  1KUQ A;  4LF5 B;  4LCU C;  3L75 H;  4ABM A;  1AB3 A;  2DE0 X;  4DO2 A;  1R6K A;  1QVG U;  2N05 A;  4FLT A;  4P2Z A;  4L87 A;  1O9H A;  1VQ8 V;  4R6Z A;  1KB9 F;  3HPL C;  4UCT A;  2A79 B;  3RYH A;  4X9Q A;  5E1A C;  4PDR A;  5JH7 B;  2ZNI A;  3QTC A;  4JAS A;  4PA7 A;  2WA4 A;  4I0X B;  4NVP A;  1RPO A;  1NZ6 A;  2WLH A;  3WB1 A;  2C2A A;  2PY5 A;  2W6J G;  1QR9 A;  3WB2 A;  3ZMV A;  3LNN A;  1US6 A;  1YTF D;  2P67 A;  1AP5 A;  1PNK A;  4UFZ A;  2F93 B;  4JAV A;  5B1B C;  4JF3 A;  4WFE A;  1XOU A;  2YUA A;  5KMG B;  1GM7 A;  1UFI A;  3F5W C;  2UUC O;  1KBH A;  2YIB A;  5LXT B;  2UU9 O;  2YIB D;  1FXK C;  5EBM C;  3CCE V;  3OGI B;  3QVN A;  3BHP A;  3TK1 A;  2XTA A;  1H8E G;  1AI5 A;  3RYF A;  2Q6A A;  3N2G B;  5B3S B;  3A0H Z;  4MVQ A;  5ITZ B;  2R9A A;  2FML A;  3K03 A;  2YIC A;  3OAA G;  1W0K G;  1OHH G;  5IJ0 A;  1BMF G;  3FB8 C;  2P4V A;  1KQS U;  1FS0 G;  1WLE A;  1G1X B;  2OCC B;  3OMN B;  3L71 H;  5IWA B;  1I5X A;  3G4S V;  1N8R W;  3HKC B;  1FXV A;  4ZOL B;  5J2U B;  5D5P A;  5JJJ B;  1AR5 A;  1TAE A;  4NTW A;  3E83 A;  5KA6 A;  3EHB B;  4W4L A;  3DXR B;  2Q0A A;  2JJ1 G;  2ZE8 A;  5KAF Z;  4FLX A;  4LFA B;  2AZ0 A;  4DUZ O;  4TV8 B;  4FJC C;  4DW1 A;  4EB6 A;  1GK9 A;  2VQF O;  1SQP H;  2HEP A;  1WB7 A;  1DF5 A;  3E89 A;  3AG2 C;  5TIS Z;  1A32 A;  4X88 A;  3P3N A;  3ZMU A;  2Y48 A;  3RYI A; 
#chains in the Genus database with same CATH homology
 3UT5 B;  5IJ9 A;  4IHJ A;  4YY3 B;  4OX9 B;  4CC6 A;  4LF8 B;  3ETQ A;  4O4H B;  5CA0 B;  3A2F A;  1IBK B;  4DUY B;  3K5L A;  4FLZ A;  4JI7 B;  3JAR A;  2XHB A;  4K8X A;  4DR3 B;  4B3T B;  3U0Z A;  3SJA C;  3MAQ A;  2ZIM A;  2CAZ C;  1D5A A;  3U11 A;  3HKB A;  5GON B;  1HNW B;  2R70 A;  4ZI7 A;  4ZHQ A;  2RJZ A;  3HKE B;  3HKD B;  5LOV A;  1T5E A;  3JAK B;  4I50 B;  3VQX A;  1XMQ B;  5EIB C;  4O4J B;  2PTM A;  1SQF A;  1Z5V A;  4DR6 B;  4TV9 A;  4DV2 B;  4K0K B;  4JI1 B;  1M5I A;  3BRC A;  1G6U A;  1QQC A;  4X64 B;  1Q8I A;  5CA1 B;  3JAT B;  4O2A A;  4JI0 B;  2JS5 A;  4X66 B;  4CS2 A;  2UUA B;  2IM9 A;  4LNU A;  4CS3 A;  5JCO C;  3BPZ A;  3RYH B;  3RYC A;  4D7S A;  1B04 A;  1JJO A;  2PUS A;  4TUY B;  4EEQ A;  4FM2 A;  4DK1 A;  1I7F A;  2Q7H A;  4LF9 B;  3BAA A;  4ZIB A;  4X1K A;  4FM0 A;  4YHH B;  4DR7 B;  2JVD A;  4FLU A;  2VWK A;  4DR2 B;  3T1H B;  2HHH B;  4LF7 B;  4X20 B;  3DSQ A;  4GKK B;  3HKC A;  4CH4 A;  4Q6G A;  2F4V B;  5KHG A;  1HNZ B;  4UCO A;  2F66 C;  3QG5 A;  5KX5 A;  4X1I B;  4UCS A;  1RSO A;  5JJN B;  2YXL A;  4DV5 B;  5FNV A;  4CS4 A;  4O4I A;  1H2S B;  4DV3 B;  3RYF B;  4EFE A;  4YJ2 A;  1X4T A;  3SGI A;  4DV0 B;  4O2B A;  2UXD B;  4JI2 B;  5KHK A;  3JAW B;  3IAY A;  1KMI Z;  5IJ0 B;  2PZS A;  1S5J A;  4LF6 B;  4X1Y B;  1Z5W A;  1WNS A;  5LA6 A;  1XMO B;  1NT2 B;  1Q5O A;  5IYZ A;  3JAL B;  3B2E E;  2RQ6 A;  4DV1 B;  1TUB A;  3PN1 A;  2ZCE A;  3K59 A;  4YJ3 A;  4GLX A;  5FPO A;  3K5O A;  4B3S B;  1JMK C;  4AIL C;  2UUB B;  4I55 A;  1VF7 A;  5EZY B;  5LP6 B;  5JVD B;  1FFX B;  4BWA A;  1QHT A;  4IIJ A;  1P49 A;  2F1M A;  3OTF A;  4TQD A;  3OTO B;  1TVK A;  2ZIO A;  3N2K B;  2P22 C;  4JI8 B;  4GKJ B;  4I4T B;  5KHI A;  4FFB B;  4DR4 B;  2BTQ B;  5EYP A;  5CB4 A;  2BTO A;  2OYQ A;  5JH7 A;  4O4L B;  2YI9 A;  1Q3E A;  3JSL A;  5BMV A;  4O4J A;  1L8D A;  3VQV A;  2P5O A;  3JAS B;  1IBM B;  4U3J B;  3RYI B;  4HBN A;  4WBN B;  4LFB B;  5IJ9 B;  4IHJ B;  5J2T A;  5LMN B;  4DV4 B;  1N33 B;  4BW9 A;  1XHX A;  4FVM A;  4CH3 A;  2ZIN A;  5D5Q A;  3RFR A;  2PYJ A;  3CHX A;  4I9Q A;  3THO A;  4X65 B;  4K8Z A;  3JAR B;  4LF4 B;  3K58 A;  5KMG A;  2ZM6 B;  4FLY A;  5LXT A;  2Q7G A;  3ICX A;  5BR8 B;  4NXM B;  2UXC B;  5K1X A;  3HKB B;  2JGU A;  4ZI7 B;  4ZHQ B;  4JV5 B;  3N2G A;  5LOV B;  2UXB B;  5ITZ A;  4B3M B;  1SQG A;  4AHC A;  3K5N A;  5EIB D;  4LH7 A;  3FFQ A;  1SA0 A;  5LYJ A;  4TV9 B;  5C8Y A;  1JFF A;  3RWR D;  2PYL A;  4JI5 B;  2V4D A;  2KKW A;  5JQG A;  4ZOL A;  1O9G A;  4O2A B;  1HNX B;  5J2U A;  2ZNJ A;  2UUC B;  3E22 A;  4LNU B;  1SKV A;  5JCO A;  2UU9 B;  1XQ8 A;  3RYC B;  1I94 B;  5LP6 C;  3BAB A;  5KHJ A;  4B08 A;  4TV8 A;  4X1K B;  4FM1 A;  4PI2 A;  4EFB A;  1FJG B;  4NXN B;  4JI4 B;  4HNA A;  2PGG A;  2YI8 A;  4JI3 B;  3SJB C;  4PHZ A;  3ZS8 C;  4DRX A;  4UCR A;  2E3C A;  4DR5 B;  1TGO A;  4D7T A;  4F6R A;  1DGS A;  3UT5 A;  3K57 A;  4TQF A;  5KX5 B;  4O4H A;  5CA0 A;  1HW7 A;  5FNV B;  4TOI A;  1N32 B;  1M4U A;  3JSN A;  4O4I B;  5KHH A;  4CC5 A;  2OWO A;  1TA8 A;  1WPB A;  4YJ2 B;  1N36 B;  4X62 B;  1M93 A;  3K5M A;  2EX3 A;  4DUZ B;  1KU9 A;  3M7M X;  5GON A;  4EB6 B;  2VQF B;  1Q43 A;  2R72 A;  4DV6 B;  3U10 A;  3UQ8 A;  1N34 B;  3HKE A;  5LA6 B;  3HKD A;  1XNR B;  2QJ1 A;  5IYZ B;  3CB2 A;  1XI1 A;  4CH5 A;  3JAK A;  4I50 A;  3SR2 C;  1TUB B;  1YEW A;  2E5L B;  4CH6 A;  4YJ3 B;  4LF5 B;  5FPR A;  4JI6 B;  4I55 B;  2VQE B;  4FLT A;  1O9H A;  5CA1 A;  4IIJ B;  3JAT A;  1TVK B;  4UCT A;  2Q7E A;  4AQY B;  3SJC C;  3RYH A;  4DV7 B;  5EYP B;  5CB4 B;  4PI0 A;  4TUY A;  5JH7 B;  2ZNI A;  3QTC A;  4GYC B;  4L8J A;  5BMV B;  3VQY A;  4NVP A;  3WB1 A;  5J2T B;  2PY5 A;  4X20 A;  2YIA A;  3WB2 A;  3LNN A;  4UFZ A;  4UCU A;  2F93 B;  4FLW A;  3RGB A;  5KMG B;  4B3R B;  2YIB A;  5LXT B;  4KHP B;  2YIB D;  4X1I A;  4FLV A;  4KL1 A;  3BHP A;  3T1Y B;  4LFC B;  2F95 B;  3ZED A;  3CSX A;  1IBL B;  3RYF A;  5JJE B;  3N2G B;  5ITZ B;  2R9A A;  4DK0 A;  3JAW A;  3BA8 A;  5IJ0 A;  1SA0 B;  4DR1 B;  2VWJ A;  2QM4 A;  5LYJ B;  4X1Y A;  1ZAU A;  5C8Y B;  1JFF B;  5IWA B;  3JAL A;  3WB0 A;  1J5E B;  3HKC B;  5JQG B;  4ZOL B;  3VQW A;  5J2U B;  5LMU B;  5D5P A;  5JJJ B;  1TAE A;  3E22 B;  5EZY A;  1V9P A;  5LP6 A;  5JVD A;  3QF7 A;  2Q0A A;  4FLX A;  4LH6 A;  1FFX A;  4LFA B;  4TV8 B;  5K1P A;  1HR0 B;  4EB6 A;  2HEP A;  3N2K A;  2GV9 A;  4O2B B;  4I4T A;  1XNQ B;  4FFB A;  2BTQ A;  4HNA B;  1XHZ A;  1WN7 A;  4LR3 A;  3BA9 A;  4O4L A;  4UCV A;  3JAS A;  4DRX B;  4U3J A;  4JYA B;  3RYI A;  4WBN A;  4F6R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...