3SJAC

Crystal structure of s. cerevisiae get3 in the open state in complex with get1 cytosolic domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
b'MNELSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 24
structure length 61
sequence length 61
chains with identical sequence D, G, H, J
ec nomenclature
pdb deposition date 2011-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3sjaC00
3QG5A 2F66C 2JS5A 3QF7A 1SKVA 1NT2B 3ICXA 3SJBC 3SJAC 3SJCC 3B2EE 2CAZC 3THOA 1X4TA 3ZS8C 2P22C 3CSXA
chains in the Genus database with same CATH superfamily
4NB5A 3H9VA 1Q86W 1N8RW 4FLWA 2VWKA 5EC1C 5LMUB 4JZ2A 4WFEA 3ZMVA 3JCZA 1VQ7V 1NVPD 4JGSA 1WLEA 3E22B 4JV5B 5ITZA 5KA6A 4JASA 2UXCB 5IWAO 5LGUA 1SKVA 2F95B 3E8GA 4DR3O 2DN9A 1IX9A 3AK2A 1FPOA 2DQ0A 5KAFZ 4U3FH 2NLJC 2VQFO 2JVDA 3JARA 1COWG 1W2BU 4BIUA 3EHBB 3CX5F 4NXNO 3I5DA 4X1IB 1D5NA 2JEXA 3JASB 2QTSA 4TV9B 4LWSB 4KHPB 1M9NA 5KA5A 2CE4A 3CC2V 3F7VC 4MS2A 5LP6B 5CBHA 2UUAB 2RQ6A 4X89A 4EB6A 5C93A 1KECA 5EBMC 3CXCU 4MTOA 3JAMN 4BR6A 3TGUH 2R9AA 2IJIA 1N34B 4X20B 1R6KA 3JD4A 1M5IA 1HNZO 5H6QA 2F1MA 1XBLA 2DYSB 4TSFG 1S77D 2JS5A 3HKCA 3WB0A 3X2QB 4GYCB 1H8EG 3K5MA 5EZYB 1MABG 1SS3A 1N0JA 4I0XA 4DR6O 1IBMB 4PDMA 1HP8A 1K33A 1VMGA 1WJZA 4NVPA 1QNMA 2GUZB 4CC5A 4X64B 1QLEC 5DM6V 4L8JA 4TWKA 2E75B 2BSKB 1Z5VA 2X0LA 4DK1A 2Q4PA 1D5AA 3D8CA 3ZHUA 4JAUA 2ZM6B 4X66B 2ADPA 1KKDA 1VF6A 1AR4A 1ZL8B 1HNXO 1JCHA 2XAJA 2ZE5A 4JF3A 5DECA 5HFMA 3ZHSA 3OGIB 4X1IA 4UVAA 1RP3B 4DR5B 4TV9A 4LWSA 2Z0AA 3RW0A 4LF9O 4LF6O 4JI3O 4IL6Z 2ZXWC 4GKKO 1KD1W 2YIBD 3AG7A 5LP6A 1YTFB 5LP6C 3DSQA 4O4JA 1B06A 2ZE6A 3R66A 2BOBC 1AB3A 5CBFA 1R3KC 2NN4A 2WSSG 4MVZA 2BTOA 3D3QA 1RFYA 4PDVA 4CS3A 3AG4B 2WLJA 3SJBC 1BMFG 2UUBO 3LDDA 2Q7HA 4R50A 1GK9A 5EZYA 1PD3A 4FMTA 4PV1B 2FL4A 4NXNB 4HAMA 5LHIA 2OT5A 3P3NA 2GUZA 2VQEO 1HNWO 3E8HA 1K7DA 3SYPA 2KB1A 3B77A 4X1YA 4F6RB 2LW7A 1PNLA 1L8DA 3T2MA 1Q3EA 3OR7C 2AW9A 4DR7B 2YIDA 1H2KA 1HNZB 1ZL8A 3C3SA 1WA8B 3ASNB 3K9SA 5IYZA 1VEWA 1VQ4V 4DV6O 4MVOA 1G4YB 2C2AA 1MSDA 1VF5B 3K03A 4WBNA 2YXHA 2Q6AA 4HNAB 1EFRG 2WLLB 3SYOA 3CPWU 1XNQO 3B8MA 3LUTB 2CDYA 1TGOA 2OCCC 1H8HG 4JYAB 4DV4O 1R73A 3HKBB 3CRQA 3FAVB 1S0VA 4RAIA 2DYRB 4IT5A 3L74H 3E8BA 1Q43A 4DUYO 4O2AA 1JQ0A 1WPBA 1SESA 1NI8A 4YXWG 1QQCA 3AG4C 1MG1A 3B40A 4FFBA 2Q0AA 1HNXB 5LA6A 1SA0B 2E74B 3M8AA 2DMXA 4FLYA 4DRXB 1QBZA 4CS2A 4X65B 2R72A 3WFVA 1OV9A 4LF9B 1P7BA 1FAFA 5CN0A 1OCZB 2N04A 5EYPB 5K1PA 1M56C 1NBMG 4IIJA 4F6RA 1N33B 1ENVA 1JFFB 2VS0A 3K9AA 2UXBO 5IJ0B 1O9GA 4BIZA 1N4CA 4HZ3A 1JJOA 1GN3A 1WA8A 2V4DA 3L70H 3E2EA 2YIAA 4ZIBA 2Z5UA 1ROPA 4JYCA 4PA7A 3RVZA 1SC5B 2AGAA 4HNAA 2WLLA 4IHJB 3RYFB 1UPGA 2XAGA 4I7ZB 4ABMA 1FFXA 3J80N 3AG2B 2VWJA 4F6EA 3HR0A 1AI5A 1PNKA 2AZ2A 4PA3A 1X4TA 2YICA 4MW8A 2PUSA 1TUBB 3FAVA 2FKXA 3Q4HB 3GWKC 1YJ9V 1TVKA 1K4CC 4PI2A 5B1BC 1U97A 3JSLA 5EBWC 3SPIA 3ZMSA 2Y69B 4LF4O 5LGTA 2ZE8A 5AG2A 4RUEA 1SA0A 1BZKA 5EBLC 3ABLC 1XUQA 3CCUV 4DRXA 4K8ZA 2IJHA 3RT3C 4CBCA 1S3JA 1XNQB 2HP8A 4TV8A 1H38A 2JRIA 3ABKC 2Y48A 2UXDB 3MHSC 1Y6XA 2ODMA 5EYPA 1XNRB 3HKDB 4AI8A 3CMEV 1XMQO 4LH6A 1VQNV 4DK0A 1KKCA 1V55B 2OIEA 3ETQA 4O2BB 1XHZA 1LUWA 5IJ0A 1XL4A 4IYIA 3GB7C 5CMUA 3CE2A 4JTCB 1TUEB 2YEVA 1MOFA 4IHJA 4MT8A 3RYFA 3BVOA 1FXHA 1K97A 4LC1A 1BHBA 1V54B 4JZGA 3QNEA 4B3TO 2WLIB 4KFMA 4DV1O 3RBZA 1TUBA 3DXRA 3Q4HA 4J11A 3IC7A 2OIGA 1NTKH 2F43G 1ZUQA 3T1YO 4OXSA 4LF5B 4D7SA 3KCXA 3OT7A 1PV0A 3DC6A 1Y74B 3ABMC 3BPZA 3JD1A 5E1AC 1VARA 2Y69C 1YVWA 3UO2A 1IURA 3L75H 3CCEV 2NNUA 2GSMB 4BAYA 4UFZA 2UUCB 2L35A 3WB1A 3UO3A 5JH7B 4MVUA 2JIZG 4O4LB 4FLTA 1XQ8A 5FNVB 3HKDA 2DQ3A 1CEZA 1HDJA 3DC5A 3JSNA 1ZX3A 3HPLC 5LYJB 3ICXA 4O2BA 4QPJA 3SJCC 1B3QA 3BRCA 2QA4V 2X7RB 1BCCH 3MDSA 3N2KA 1D2DA 5JCOA 3IJ4A 4U3JB 4LF4B 3CRRA 4DUZB 1DF5A 1SQBH 3CCRV 2F93B 5EC2C 2PI4A 4DXWA 2HJDA 1Q90D 2UXCO 3ASOC 2Q5ZA 1F23A 1NTMH 2WLIA 1Y4MA 4H33A 4MTGA 2OCHA 1LNQA 2EILC 1XMQB 3K08A 1GM9A 2P22C 4TQDA 3BA9A 1N36O 1XL6A 2FTKA 1ZLZA 5CA3A 1Y74A 2P67A 4EFBA 3OEHG 2HVKC 4QIWF 5J9PC 4UXNA 2RMKB 1GN6A 3K5LA 5JH7A 1VQMV 3CSXA 2EIJB 2HEPA 3BCCH 5FNVA 1OCCB 2OWOA 1AILA 3JD3A 2BOCC 2LQTA 5JJJB 3ZIAG 2DWEC 4CH5A 1TA8A 3T1YB 4LCUC 4UCUA 1Y66A 1N32O 4I4TB 1QU7A 2QKCA 2WA4A 3ZHRA 4UB6Z 4X64O 1K5SA 2X6AA 1JOYA 1RSOA 4K3AA 4JYBA 3TXQA 4PA9A 4WFFA 1OJHA 1JR9A 5IT9N 2ZM6O 2P4KA 3ZBHA 3OR6C 3JATB 1EN5A 4P9OA 4GX5A 4J9YB 4LFBO 1XOUA 2H94A 3U0ZA 3B4SA 4DR5O 1SRYA 4NTWA 3JAWB 1K8AW 3LSUA 3CRAA 3BFRA 3F5TA 2ZINA 4CH6A 4YHHB 2P6JA 3FD9A 5IYDO 4AQYO 1NH2D 2OYQA 2FYUH 1ZTEA 3FB7C 4YIOA 3VBBA 1YDXA 2EIJC 3D36A 3E35A 3D36C 5CA1B 2XUMA 1F51A 4PJ0Z 1KBHA 1KB9F 1N36B 3K5OA 2BE3A 3FYIB 4R7CA 3APQA 5KUKA 3UM7A 5DEDA 2QM7A 5CBGA 3CCVV 3K58A 2ITDC 3ML0A 1W0JG 4X8AA 3K59A 1K34A 2OTLV 1F4NA 1KMIZ 3EXAA 2ZT9B 2G38A 2HKOA 3JATA 3A8TA 3K06A 4HBNA 4DR7O 4W4LA 2B5UA 3FYEB 4Q6GA 4P2ZA 3C90A 2PGGA 4LFCB 1NR1A 4DR4B 3F5WC 4X1KA 4JI5B 2B1IA 4NTXA 3UCSC 1N32B 4TUYB 4OX9O 3SDLA 5E79Z 3SYAA 2R9IA 3A0HZ 3ETGA 2AXTZ 4EKWA 1WB7A 5CB4B 5L3BA 1VQ6V 4JYAO 2N05A 1EBOA 3JALB 3E22A 2EIMB 2AZ0A 2PTMA 1QHTA 5BR8B 5GW7A 2A0LA 5CA1A 1IXMA 3ZHVA 2Z3YA 2P5OA 3ZCCA 2Q67A 1I5YA 3LNNA 1VF6C 2WAMA 1KYOF 1HW7A 4LFBB 5TISZ 4UVBA 1XDCA 1W0KG 2GBOA 4FZ0A 1J95A 3JASA 3S3XA 4X65O 3SR2C 1Q5OA 1AVMA 4B7EA 5IJ9B 4K8XA 1BGYH 3A0RA 3B2EE 3U11A 3AG1B 1DF4A 3CP1A 4JTAB 1I08A 4AQYB 4WFBV 2YXLA 1N33O 3ZN0A 4J42A 4X20A 3ZRXA 2HG5C 1YXBA 1OCRB 1LUVA 2DYSC 4FZ1A 5BMVB 2ADQB 3X2QC 3KZIZ 5IYBO 3W7WA 4JI0O 3N2GB 3CMAV 2Q73A 2ZNIA 1KU9A 2LGWA 2QKSA 1T5EA 4JI8B 4MW3A 5B1AB 2KG7B 3CCQV 1S76D 1XILA 2BSKA 5KLVH 3JALA 4AILC 4BWAA 1RPRA 2QWRB 4JI6B 3DTUB 5B66Z 4J7KA 1BL8A 2QTOA 2XTAA 2P90A 2E5LO 3ZRSA 3W7UA 1IBKO 2V7QG 1FXKB 5B1OA 3ZMUA 4OPHA 4B08A 5IYCO 4OX9B 4JAVA 2YI9A 1A32A 1R6TA 3EVKA 3L9DA 5KHIA 4X88A 1XHXA 5IJ9A 4MTFA 1VQ5V 2UXDO 5LXTB 4J80A 4AHCA 1XNRO 2CUGA 3AG1C 3T1HO 4JI1B 1PNMA 5L3CA 1SF9A 1KP2A 4UV9A 4I55B 4OPAA 1YIJV 1Y67A 1FD9A 1VIBA 2R70A 1OHHG 3AG3B 2AHYA 3BA8A 3SPGA 4GX2A 5H6RA 1M4UA 1IVSA 3KCYA 1Q82W 1AI6A 4B3RO 2PYLA 4PDLA 4WFHA 1GN4A 4PI0A 2Q7EA 4IGGA 2X6CA 3IGAC 5A9GA 1EM1A 2PZSA 1V9PA 2HJFC 1YZBA 2Q68A 5KUMA 5EK0A 1L1FA 3QO5A 1K3EA 2YI8A 2ZE7A 2LW1A 1AJQA 5EIBC 4LF5O 4H0LB 3BY6A 3WU2Z 3ZRWB 1VQPV 1AP6A 3ASNC 2RNBA 2QKAA 1IZ3A 1FXKA 1K4DC 5JJNB 5J2TB 2P06A 2UUCO 2JGDB 4JI0B 3ABUA 2XAHA 3RFRA 2EULA 3OM3B 1S5JA 4CH4A 5LXTA 2RJZA 1H2MA 4DV0B 1WB8A 3QTCA 4D7TA 4ZHQB 1KQSU 3HKBA 5KAIZ 2IU0A 2DYRC 1SQFA 2K1EA 2IBZH 2ZQMA 4EEQA 3O9OA 4FLZA 4I9QA 2QM8A 1WP8A 4U7NA 4DUZO 2B1GA 3OW2U 2E5LB 2WLKA 3JYCA 1XMOB 2GV9A 4UUJC 4QNHB 1IBKB 2W6JG 4O4HB 1JX9A 1S5HC 1VF7A 4JI4B 4MVSA 3WG7B 3JD2A 3AK1A 2HR3A 5J2UB 4X9QA 4PHZA 1OCZC 2FMLA 4RUFA 3T1HB 2LFRA 5LHHA 1JFFA 2ZCEA 2GHYA 5C8YB 3HB3B 3J81N 3M7MX 4R6ZA 4NXMB 5JQGB 3I55V 1QVGU 5B3SB 1FJGB 2IU3A 1YTFD 3ZMZA 3JCUZ 3BABA 4B3RB 2EZPA 4YY3O 2JGDA 4J7ZA 3MHHC 3CC4V 3H01A 4JTDB 3ZJZA 2D3OW 1NVPB 3AG2C 3WB2A 1O9HA 2ETNA 4F4LA 2Y0IA 3LSQA 2W6IG 2Y4TA 2B9ZA 3K3WA 3FX7A 3F7YC 4K0KB 3UKMA 1THZA 4L87A 2NR5A 5L3EA 2DJVA 3SYCA 1XREA 4ZOLB 4U7OA 1J5EB 3IFXA 2K9PA 4PELA 1CP9A 4O4HA 2ZDIA 5EIBD 2XASA 2LFSA 3OE7G 5L3GA 3DGEA 4C7UA 5J2UA 1BHAA 1R3LC 3ETEA 3J7AU 3SPCA 2A79B 5DN6G 3CRMA 2F4VB 1V55C 5C8YA 1PP9H 1JPXA 5JVDB 1MA1A 2EZOA 5H9CA 2RDCA 1AI4A 1M93A 1PPJH 5JCOC 3VQYA 4G27B 1RM1B 3G67A 2ZIOA 2A06H 5KMGB 2ZIMA 2WLNA 4YHHO 1Q81W 2FB5A 2QDOA 3RYIB 3W7SA 4FM2A 4DW1A 2QM4A 1GM8A 4DV3O 3VQWA 1PL0A 3OAAG 1ZWIC 1S5LZ 1JVMA 3E8FA 1V54C 2JEUA 3GVMA 3JAKB 1FKAO 3CWBH 1Y76B 3KG2A 2ARHA 4LF7O 4FLUA 2ZR2A 1YJWV 1VQOV 3PN1A 1PL4A 2LP7A 2CTQA 5B1NA 1OCOB 3G80A 4ZOLA 2IH1C 4Z1VA 2HLDG 3OTFA 1FXVA 1JMKC 1Z2GA 4YY3B 3MD0A 2F23A 1GMGA 3QG5A 4TQFA 2DOSA 3OGCC 3G4SV 3ZMTA 1XI1A 1SZTA 1Z5WA 3QF7A 4O4LA 2GTAA 2PI5A 1YJNV 1HR0B 1E79G 1AI7A 1UJWB 2EIKB 2JJ1G 5LYJA 1H2NA 2PF4E 3CJHB 1EN4A 3L71H 2D2CB 4LFCO 1NQTA 1VQKV 4DR4O 4JI5O 3CB2A 1QR9A 4H44B 4U3JA 4DO2A 3CXHF 1H2GA 5KMGA 3H1JH 1P4RA 5BZBA 1VQLV 3NXSA 1I94O 3RYCB 1Q6UA 4RO2A 2CH7B 2H3OA 2WLMA 2RN9A 2AHZA 4FFKA 1KUQA 5BR8O 3L72H 4LFAO 3JARB 3JAKA 4R8CA 3LDEA 1GTOA 1FFTB 3PJSK 3RWRD 2GTSA 2W0FC 3RN4A 4XDLA 1VQ9V 3TK1A 4GKJB 3B8NA 3M99B 3I56V 4PA6A 2XT9A 4Z2WA 1OCOC 3VQVA 1YITV 1YSCA 2X6BA 3N27A 1PM9A 1Q6HA 1EZJA 2YSUB 2QEXV 4B3MO 1HWYA 4DV3B 4MVRA 3CRCA 2YC0A 3L73H 1URFA 4XDKA 1G6UA 1UFIA 1P84F 2N74A 5IE9A 5B5EZ 1OCCC 2F66C 2ILMA 2KQXA 1JJ2U 4G2KA 3CJHA 4LF7B 1QLEB 1SZXA 2LGQA 2O57A 5LHGA 2DE0X 4DV5O 3RVYA 4I4TA 1SQQH 3FB8C 3W7TA 3CYOA 4FM0A 4JI8O 2QSAA 4I9WA 4HYOA 1WNSA 3RYCA 1KP3A 1YCIA 2CH7A 2QE7G 4YJ3B 4DR1B 3UT5B 4TT3G 2QR4A 5KX5B 4XDJA 4JI6O 1SERA 3RGBA 3H1LH 1M90W 1VQ8V 2LO1A 3CS5A 3GWOA 2CTWA 1TAEA 5KHJA 2ZXWB 2Q8VA 2IM9A 4O4JB 3C3TA 3UQ8A 3JAWA 1KC8W 1GM7A 4UV8A 5L3FA 4MTXA 1I94B 4JI1O 2QJ1A 4JYYA 1CPYA 4PA4A 4E2LA 4BW5A 2ZNJA 4LFAB 4J7JA 3OUSA 1FS0G 5IY5B 1QR8A 5LOVB 2PYJA 5D5PA 3W7XA 1NR7A 2Q7GA 5JWPA 4OGQB 3MAQA 2M7WA 2BTQB 1MMMA 4TOIA 3OTOB 4O4IB 3TXSA 5D5QA 3O65A 1RPOA 4X1YB 5GTIZ 4NR1A 1K5QA 3G6EV 4H13B 4YJ2B 2ZR3A 2Q0OC 4B3MB 3SJAC 4LF8B 4B3SB 4YJ3A 2VRZA 3UT5A 1E1QG 5IYZB 1R3IC 1SETA 2XAQA 3ZX6A 5KX5A 5LMNB 4WBNB 3OMAB 4GLXA 2HHHO 3QO8A 4DV7B 1AROP 3CCMV 4ZI7B 2YXYA 4GUNA 2QWNB 2JGUA 3TJTA 1X59A 4UCVA 4FJCC 2OCCB 4ICGA 1AJPA 5H5NA 2GDSA 4DV5B 4CS4A 5A2QN 4FVMA 1SQVH 4TUYA 4ZKIA 1DGSA 1LR1A 5IWAB 3ABTA 1PKXA 4DR3B 4O2AB 4DR2O 4BIOA 2V1DA 1W59A 4LP8A 5CB4A 4DV0O 1M1KW 4JI2O 1DLBA 2KKWA 4FFBB 1G1XB 2EIMC 3APOA 4UCRA 2CGOA 2YUAA 3U10A 5LA6B 1WN7A 2VQFB 1Q6IA 3ZN1A 5IY5C 4G28B 5LOVA 2P7TC 3H1HH 1DTOA 4RQFA 3P32A 3CC7V 1AR1B 1SQGA 2BTQA 1XMOO 4EFEA 4O4IA 1M56B 4PD4F 4JI4O 2UU9O 2ZD9A 4IIJB 4QJFB 1JA8A 2CK3G 2HFEC 2R9RB 1GO3F 1F4MA 5GTHZ 2WPDG 4WCEV 4YJ2A 2WWWA 3SYQA 2LJ2A 5FLXN 3FB6C 3RYHB 3B09A 2Q69A 3CCSV 4CC6A 5IDJA 1AP5A 3VQXA 3FB5C 1NS1A 4NXMO 4DR6B 4ZI7A 1ZAUA 2HVJC 1OCRC 1FFXB 1XEQA 2E76B 4J10A 2WA3A 5BMVA 1FJGO 4MVMA 1YHQV 4GZRB 4QE7A 2CAZC 1R1BA 3N2GA 4JAAA 1M57B 1B04A 1TVKB 3ZEDA 5B1BB 5BY1A 3OMIB 2E3CA 1MNGA 3ZS8C 2EX3A 5B1AC 2MW2B 2KG7A 4LNUB 3S3WA 3IC9A 4QGPA 4Z1MG 5JJEB 4WFAV 4MSWC 3E89A 4K0KO 4UCOA 3CD6V 2HHHB 3ABLB 1EZVH 2CGNA 1L0LH 5GONB 1ZSPA 1R6NA 4RQEA 3BAAA 1FYJA 2A3QA 4TV8B 4QE9A 1J5EO 3ABKB 3R65A 4LF6B 4JI3B 5F2VO 4GKKB 2JJ2G 3LNMB 1FXKC 2Q9LA 1AR5A 4LBEC 4X62O 3A0BZ 1BS3A 5KHHA 4ASUG 2P4VA 4DR2B 4Q20A 4K35A 3TCUA 3RYHA 4UCTA 3K0DA 5HFLA 4JI2B 2F4VO 4I55A 1BQZA 2CTPA 3LDCA 2UUBB 1P7GA 3OUFA 1NKDA 4KL1A 2YEVB 1H2SB 3AG3C 2XNDG 2VQEB 1YF2A 5LGNA 3QO7A 1HNWB 3STZC 4A5UB 2H8PC 3ZHQA 3DXRB 2EBOA 2XAFA 3SPHA 2UU9B 1M57C 1G8MA 4DV2O 1SQPH 1BSMA 4H37A 1GRJA 1MZFA 3CHXA 3KKYA 3CCJV 2XOKG 3ABMB 4LNUA 2JS3A 4P9PA 3ETDA 1US6A 4DV6B 2PY5A 4FIPC 3FKSG 4UB8Z 3VOUA 2EJRA 4N21A 4KUMA 5GONA 2QWPB 4FM1A 1WAZA 2DW4A 3ZRWA 1YI2V 3K0GA 2IW5A 4CH3A 4E4EA 1I5XA 5J2TA 3JD0A 4DV4B 1P49A 1B6QA 4NKGB 1NH2B 1H2LA 2EINB 4DUYB 4GX0A 3N2KB 1BT8A 1HR0O 1GH6A 5CA0B 1K9MW 4ZHQA 3G71V 1QLNA 4UVCA 5L3DA 2ITCC 4FLVA 4JI7O 4J9ZB 4W4KA 3ASOB 5FPRA 1NT2B 2DWDC 4J41A 3G6BA 2XHBA 3QVNA 3HKEB 1MZEA 4WF9V 1OZ0A 2EILB 5K1XA 3SPJA 2ZDIC 4X62B 2A7WA 3WG7C 3T1CA 1NJIW 2UXBB 2IJJA 1DK1A 2MK3A 5H2FZ 2Y0PA 3OMNB 4XBFA 2CTRA 4ZBMA 1L0NH 1K73W 2ZKOA 3AEIA 3IAYA 2YDEA 1IBLO 4GKJO 4WFGA 4FPPA 4QPKA 3E86A 1E1RG 3CEIA 4BW9A 1Q8IA 3STLC 3T4ZA 5JQGA 2JK5C 1VP7A 1Q7YW 2M6YA 4DYLA 5B3SC 5LBQA 4N23A 5KHGA 3P3PA 1U96A 1IXBA 2BCCH 1AJNA 3E83A 3ZHTA 1QCEA 3H1IH 1EN6A 3K5NA 5LL6Y 4DV2B 3H1KH 2EINC 1IDSA 2OTJV 3NR7A 5CA0A 4LR3A 4JPRA 3T4DA 2IJKA 1RSOB 5LMUO 4RWUA 1N0NA 4JV5O 3K04A 1GKFA 4GX1A 4NTYA 3HKEA 1ORQC 3D3IA 2RCVA 4DR1O 4D6TH 1NTZH 4PDRA 1MSWD 3SJQC 4FK5C 1BE3H 5FPOA 4I50B 1WPXA 5BXZA 4KHPO 5JVDA 4LH7A 4P30A 2KSDA 3LSSA 5KHKA 3OEEG 1F7YA 4JI7B 2UUAO 1WP7A 4CZZA 1RM1C 5ITZB 2QWQB 3THOA 1NU1H 3K79A 1S72V 4GT1A 4B3TB 2UXNA 1N34O 3RYIA 2JDIG 4DV1B 4UCSA 4GCZA 1R3JC 2YS8A 3ZRVA 2ATKC 4NYKA 3BEHA 3P30A 1IBMO 1Y76A 2A9HA 4KXRA 4YIPA 2EJ7A 3CCLV 4KP4A 1IBLB 3SGIA 4FLXA 1CXZB 2W0XA 3OTOO 5FL7G 1BQ0A 3TETA 1I0HA 1SQXH 1K92A 3EFFK 4EB6B 1GN2A 1I7FA 3FFQA 1QVFU 4X66O 3A2FA 2QGNA 4MVQA 2WLHA 4B7KA 4DW0A 3OD4A 4LF8O 4B3SO 1YEWA 3K57A 2Y4UA 2UXXA 2YIBA 2IH3C 1NZ6A 3HKCB 1GAXA 5LMNO 4IYHA 3BHPA 4DV7O 4X1KB 2QWOB 4I0XB 4I5SA 4I50A 3OFNG 2L6LA 2EIKC 3AK3A
chains in the Genus database with same CATH topology
4DV0B 3QTCA 3N2KA 4D7TA 4ZHQB 5JCOA 1DGSA 3HKBA 5IWAB 4FLWA 2VWKA 5LMUB 4DR3B 4U3JB 4O2AB 4LF4B 4DUZB 3E22B 5CB4A 4JV5B 5ITZA 1SQFA 2UXCB 4EEQA 2F93B 1SKVA 2KKWA 2F95B 4FFBB 4FLZA 4UCRA 4I9QA 3U10A 5LA6B 1WN7A 2VQFB 2E5LB 1XMOB 5LOVA 2GV9A 1IBKB 4O4HB 1VF7A 4JI4B 2JVDA 3JARA 1SQGA 2BTQA 1XMQB 5J2UB 4EFEA 4X1IB 4O4IA 3JASB 2P22C 4TV9B 4TQDA 3BA9A 4IIJB 4KHPB 4PHZA 3T1HB 4EFBA 1JFFA 2ZCEA 4YJ2A 5C8YB 5LP6B 3M7MX 2UUAB 2RQ6A 4EB6A 3RYHB 4NXMB 5JQGB 2R9AA 3K5LA 4CC6A 1N34B 4X20B 1M5IA 1FJGB 3VQXA 5JH7A 2F1MA 3BABA 4B3RB 4DR6B 3CSXA 2HEPA 4ZI7A 2JS5A 1ZAUA 3HKCA 3WB0A 5FNVA 4GYCB 1FFXB 2OWOA 5BMVA 3K5MA 5EZYB 1IBMB 2CAZC 3WB2A 1O9HA 5JJJB 4CH5A 4NVPA 3N2GA 1TA8A 3T1YB 4CC5A 1B04A 1TVKB 4UCUA 4X64B 3ZEDA 4I4TB 2E3CA 4L8JA 3ZS8C 2EX3A 1Z5VA 4DK1A 4K0KB 1D5AA 4LNUB 1RSOA 2ZM6B 5JJEB 4X66B 4ZOLB 4UCOA 2HHHB 1J5EB 4O4HA 5GONB 3JATB 5EIBD 3BAAA 4TV8B 4LF6B 4JI3B 4GKKB 5J2UA 4X1IA 4DR5B 4TV9A 3U0ZA 5KHHA 2YIBD 2F4VB 5C8YA 3JAWB 5LP6A 4DR2B 5LP6C 5JVDB 3DSQA 4O4JA 3RYHA 2ZINA 4CH6A 4UCTA 4YHHB 4JI2B 1M93A 5JCOC 4I55A 3VQYA 2UUBB 2ZIOA 5KMGB 2BTOA 2ZIMA 4KL1A 2OYQA 1H2SB 4CS3A 3RYIB 4FM2A 3SJBC 2QM4A 3VQWA 5CA1B 2VQEB 2Q7HA 5EZYA 1HNWB 4NXNB 3JAKB 2UU9B 1N36B 3K5OA 3CHXA 4FLUA 3PN1A 4LNUA 4X1YA 4F6RB 1L8DA 1Q3EA 3K58A 4DV6B 2PY5A 4ZOLA 4DR7B 3K59A 1HNZB 3OTFA 1KMIZ 5GONA 3JATA 1JMKC 5IYZA 4FM1A 4YY3B 4HBNA 3QG5A 4TQFA 4WBNA 4Q6GA 1XI1A 4CH3A 4HNAB 1Z5WA 3QF7A 4O4LA 2PGGA 5J2TA 4LFCB 4DV4B 1HR0B 1P49A 4DR4B 4X1KA 4JI5B 1TGOA 1N32B 5LYJA 4TUYB 4DUYB 4JYAB 3N2KB 3HKBB 5CA0B 4ZHQA 3CB2A 1Q43A 4U3JA 4O2AA 5CB4B 5KMGA 3JALB 1WPBA 3E22A 1QQCA 2PTMA 1QHTA 4FLVA 5BR8B 4FFBA 2Q0AA 1HNXB 5CA1A 3RYCB 5LA6A 1SA0B 1NT2B 5FPRA 2P5OA 4FLYA 3LNNA 2XHBA 1HW7A 4DRXB 3HKEB 4LFBB 3JARB 3JAKA 5K1XA 4CS2A 4X65B 2R72A 4X62B 3RWRD 4LF9B 2UXBB 3JASA 5EYPB 5K1PA 4GKJB 4IIJA 3SR2C 1Q5OA 4F6RA 1N33B 1JFFB 5IJ9B 4K8XA 3VQVA 5IJ0B 3IAYA 1O9GA 3U11A 3B2EE 4AQYB 1JJOA 2YXLA 4BW9A 1Q8IA 2V4DA 2YIAA 4ZIBA 4DV3B 5JQGA 4X20A 4HNAA 5KHGA 4IHJB 1G6UA 3RYFB 5BMVB 1FFXA 3K5NA 2F66C 2VWJA 4DV2B 1X4TA 3N2GB 4LF7B 2ZNIA 2PUSA 1KU9A 1TUBB 1T5EA 4JI8B 5CA0A 4LR3A 1TVKA 4I4TA 4PI2A 3JSLA 3JALA 4FM0A 4AILC 4BWAA 1WNSA 4JI6B 3RYCA 1SA0A 4YJ3B 4DR1B 3UT5B 4DRXA 3HKEA 4K8ZA 5KX5B 1XNQB 3RGBA 4TV8A 2UXDB 5EYPA 4B08A 1XNRB 3HKDB 4OX9B 1TAEA 5KHJA 2YI9A 4LH6A 4DK0A 5FPOA 4I50B 5KHIA 3ETQA 1XHXA 4O2BB 5IJ9A 1XHZA 2IM9A 5IJ0A 4O4JB 5LXTB 4AHCA 3UQ8A 3JAWA 4JI1B 5JVDA 4LH7A 4I55B 5KHKA 4JI7B 1I94B 2R70A 5ITZB 3THOA 2QJ1A 3BA8A 4B3TB 4IHJA 1M4UA 3RYIA 3RYFA 4DV1B 2ZNJA 4LFAB 4UCSA 5LOVB 2PYLA 2PYJA 5D5PA 4PI0A 2Q7GA 2Q7EA 1TUBA 3MAQA 2BTQB 4TOIA 3OTOB 4O4IB 2PZSA 5D5QA 4LF5B 1V9PA 4D7SA 4X1YB 1IBLB 3SGIA 3BPZA 4FLXA 2YI8A 4YJ2B 5EIBC 4B3MB 3SJAC 4LF8B 4B3SB 4EB6B 4YJ3A 1I7FA 3FFQA 3UT5A 5IYZB 3A2FA 4UFZA 5KX5A 2UUCB 5LMNB 4WBNB 4GLXA 4DV7B 3WB1A 1YEWA 5JH7B 3K57A 5JJNB 2YIBA 4O4LB 5J2TB 4ZI7B 4FLTA 3HKCB 1XQ8A 2JGUA 3HKDA 5FNVB 4JI0B 3BHPA 4X1KB 4UCVA 3JSNA 3RFRA 5LYJB 4I50A 3ICXA 4O2BA 3SJCC 4DV5B 1S5JA 4CS4A 4CH4A 5LXTA 3BRCA 4FVMA 4TUYA 2RJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QG5 A;  2F66 C;  2JS5 A;  3QF7 A;  1SKV A;  1NT2 B;  3ICX A;  3SJB C;  3SJA C;  3SJC C;  3B2E E;  2CAZ C;  3THO A;  1X4T A;  3ZS8 C;  2P22 C;  3CSX A; 
#chains in the Genus database with same CATH topology
 4NB5 A;  3H9V A;  1Q86 W;  1N8R W;  4FLW A;  2VWK A;  5EC1 C;  5LMU B;  4JZ2 A;  4WFE A;  3ZMV A;  3JCZ A;  1VQ7 V;  1NVP D;  4JGS A;  1WLE A;  3E22 B;  4JV5 B;  5ITZ A;  5KA6 A;  4JAS A;  2UXC B;  5IWA O;  5LGU A;  1SKV A;  2F95 B;  3E8G A;  4DR3 O;  2DN9 A;  1IX9 A;  3AK2 A;  1FPO A;  2DQ0 A;  5KAF Z;  4U3F H;  2NLJ C;  2VQF O;  2JVD A;  3JAR A;  1COW G;  1W2B U;  4BIU A;  3EHB B;  3CX5 F;  4NXN O;  3I5D A;  4X1I B;  1D5N A;  2JEX A;  3JAS B;  2QTS A;  4TV9 B;  4LWS B;  4KHP B;  1M9N A;  5KA5 A;  2CE4 A;  3CC2 V;  3F7V C;  4MS2 A;  5LP6 B;  5CBH A;  2UUA B;  2RQ6 A;  4X89 A;  4EB6 A;  5C93 A;  1KEC A;  5EBM C;  3CXC U;  4MTO A;  3JAM N;  4BR6 A;  3TGU H;  2R9A A;  2IJI A;  1N34 B;  4X20 B;  1R6K A;  3JD4 A;  1M5I A;  1HNZ O;  5H6Q A;  2F1M A;  1XBL A;  2DYS B;  4TSF G;  1S77 D;  2JS5 A;  3HKC A;  3WB0 A;  3X2Q B;  4GYC B;  1H8E G;  3K5M A;  5EZY B;  1MAB G;  1SS3 A;  1N0J A;  4I0X A;  4DR6 O;  1IBM B;  4PDM A;  1HP8 A;  1K33 A;  1VMG A;  1WJZ A;  4NVP A;  1QNM A;  2GUZ B;  4CC5 A;  4X64 B;  1QLE C;  5DM6 V;  4L8J A;  4TWK A;  2E75 B;  2BSK B;  1Z5V A;  2X0L A;  4DK1 A;  2Q4P A;  1D5A A;  3D8C A;  3ZHU A;  4JAU A;  2ZM6 B;  4X66 B;  2ADP A;  1KKD A;  1VF6 A;  1AR4 A;  1ZL8 B;  1HNX O;  1JCH A;  2XAJ A;  2ZE5 A;  4JF3 A;  5DEC A;  5HFM A;  3ZHS A;  3OGI B;  4X1I A;  4UVA A;  1RP3 B;  4DR5 B;  4TV9 A;  4LWS A;  2Z0A A;  3RW0 A;  4LF9 O;  4LF6 O;  4JI3 O;  4IL6 Z;  2ZXW C;  4GKK O;  1KD1 W;  2YIB D;  3AG7 A;  5LP6 A;  1YTF B;  5LP6 C;  3DSQ A;  4O4J A;  1B06 A;  2ZE6 A;  3R66 A;  2BOB C;  1AB3 A;  5CBF A;  1R3K C;  2NN4 A;  2WSS G;  4MVZ A;  2BTO A;  3D3Q A;  1RFY A;  4PDV A;  4CS3 A;  3AG4 B;  2WLJ A;  3SJB C;  1BMF G;  2UUB O;  3LDD A;  2Q7H A;  4R50 A;  1GK9 A;  5EZY A;  1PD3 A;  4FMT A;  4PV1 B;  2FL4 A;  4NXN B;  4HAM A;  5LHI A;  2OT5 A;  3P3N A;  2GUZ A;  2VQE O;  1HNW O;  3E8H A;  1K7D A;  3SYP A;  2KB1 A;  3B77 A;  4X1Y A;  4F6R B;  2LW7 A;  1PNL A;  1L8D A;  3T2M A;  1Q3E A;  3OR7 C;  2AW9 A;  4DR7 B;  2YID A;  1H2K A;  1HNZ B;  1ZL8 A;  3C3S A;  1WA8 B;  3ASN B;  3K9S A;  5IYZ A;  1VEW A;  1VQ4 V;  4DV6 O;  4MVO A;  1G4Y B;  2C2A A;  1MSD A;  1VF5 B;  3K03 A;  4WBN A;  2YXH A;  2Q6A A;  4HNA B;  1EFR G;  2WLL B;  3SYO A;  3CPW U;  1XNQ O;  3B8M A;  3LUT B;  2CDY A;  1TGO A;  2OCC C;  1H8H G;  4JYA B;  4DV4 O;  1R73 A;  3HKB B;  3CRQ A;  3FAV B;  1S0V A;  4RAI A;  2DYR B;  4IT5 A;  3L74 H;  3E8B A;  1Q43 A;  4DUY O;  4O2A A;  1JQ0 A;  1WPB A;  1SES A;  1NI8 A;  4YXW G;  1QQC A;  3AG4 C;  1MG1 A;  3B40 A;  4FFB A;  2Q0A A;  1HNX B;  5LA6 A;  1SA0 B;  2E74 B;  3M8A A;  2DMX A;  4FLY A;  4DRX B;  1QBZ A;  4CS2 A;  4X65 B;  2R72 A;  3WFV A;  1OV9 A;  4LF9 B;  1P7B A;  1FAF A;  5CN0 A;  1OCZ B;  2N04 A;  5EYP B;  5K1P A;  1M56 C;  1NBM G;  4IIJ A;  4F6R A;  1N33 B;  1ENV A;  1JFF B;  2VS0 A;  3K9A A;  2UXB O;  5IJ0 B;  1O9G A;  4BIZ A;  1N4C A;  4HZ3 A;  1JJO A;  1GN3 A;  1WA8 A;  2V4D A;  3L70 H;  3E2E A;  2YIA A;  4ZIB A;  2Z5U A;  1ROP A;  4JYC A;  4PA7 A;  3RVZ A;  1SC5 B;  2AGA A;  4HNA A;  2WLL A;  4IHJ B;  3RYF B;  1UPG A;  2XAG A;  4I7Z B;  4ABM A;  1FFX A;  3J80 N;  3AG2 B;  2VWJ A;  4F6E A;  3HR0 A;  1AI5 A;  1PNK A;  2AZ2 A;  4PA3 A;  1X4T A;  2YIC A;  4MW8 A;  2PUS A;  1TUB B;  3FAV A;  2FKX A;  3Q4H B;  3GWK C;  1YJ9 V;  1TVK A;  1K4C C;  4PI2 A;  5B1B C;  1U97 A;  3JSL A;  5EBW C;  3SPI A;  3ZMS A;  2Y69 B;  4LF4 O;  5LGT A;  2ZE8 A;  5AG2 A;  4RUE A;  1SA0 A;  1BZK A;  5EBL C;  3ABL C;  1XUQ A;  3CCU V;  4DRX A;  4K8Z A;  2IJH A;  3RT3 C;  4CBC A;  1S3J A;  1XNQ B;  2HP8 A;  4TV8 A;  1H38 A;  2JRI A;  3ABK C;  2Y48 A;  2UXD B;  3MHS C;  1Y6X A;  2ODM A;  5EYP A;  1XNR B;  3HKD B;  4AI8 A;  3CME V;  1XMQ O;  4LH6 A;  1VQN V;  4DK0 A;  1KKC A;  1V55 B;  2OIE A;  3ETQ A;  4O2B B;  1XHZ A;  1LUW A;  5IJ0 A;  1XL4 A;  4IYI A;  3GB7 C;  5CMU A;  3CE2 A;  4JTC B;  1TUE B;  2YEV A;  1MOF A;  4IHJ A;  4MT8 A;  3RYF A;  3BVO A;  1FXH A;  1K97 A;  4LC1 A;  1BHB A;  1V54 B;  4JZG A;  3QNE A;  4B3T O;  2WLI B;  4KFM A;  4DV1 O;  3RBZ A;  1TUB A;  3DXR A;  3Q4H A;  4J11 A;  3IC7 A;  2OIG A;  1NTK H;  2F43 G;  1ZUQ A;  3T1Y O;  4OXS A;  4LF5 B;  4D7S A;  3KCX A;  3OT7 A;  1PV0 A;  3DC6 A;  1Y74 B;  3ABM C;  3BPZ A;  3JD1 A;  5E1A C;  1VAR A;  2Y69 C;  1YVW A;  3UO2 A;  1IUR A;  3L75 H;  3CCE V;  2NNU A;  2GSM B;  4BAY A;  4UFZ A;  2UUC B;  2L35 A;  3WB1 A;  3UO3 A;  5JH7 B;  4MVU A;  2JIZ G;  4O4L B;  4FLT A;  1XQ8 A;  5FNV B;  3HKD A;  2DQ3 A;  1CEZ A;  1HDJ A;  3DC5 A;  3JSN A;  1ZX3 A;  3HPL C;  5LYJ B;  3ICX A;  4O2B A;  4QPJ A;  3SJC C;  1B3Q A;  3BRC A;  2QA4 V;  2X7R B;  1BCC H;  3MDS A;  3N2K A;  1D2D A;  5JCO A;  3IJ4 A;  4U3J B;  4LF4 B;  3CRR A;  4DUZ B;  1DF5 A;  1SQB H;  3CCR V;  2F93 B;  5EC2 C;  2PI4 A;  4DXW A;  2HJD A;  1Q90 D;  2UXC O;  3ASO C;  2Q5Z A;  1F23 A;  1NTM H;  2WLI A;  1Y4M A;  4H33 A;  4MTG A;  2OCH A;  1LNQ A;  2EIL C;  1XMQ B;  3K08 A;  1GM9 A;  2P22 C;  4TQD A;  3BA9 A;  1N36 O;  1XL6 A;  2FTK A;  1ZLZ A;  5CA3 A;  1Y74 A;  2P67 A;  4EFB A;  3OEH G;  2HVK C;  4QIW F;  5J9P C;  4UXN A;  2RMK B;  1GN6 A;  3K5L A;  5JH7 A;  1VQM V;  3CSX A;  2EIJ B;  2HEP A;  3BCC H;  5FNV A;  1OCC B;  2OWO A;  1AIL A;  3JD3 A;  2BOC C;  2LQT A;  5JJJ B;  3ZIA G;  2DWE C;  4CH5 A;  1TA8 A;  3T1Y B;  4LCU C;  4UCU A;  1Y66 A;  1N32 O;  4I4T B;  1QU7 A;  2QKC A;  2WA4 A;  3ZHR A;  4UB6 Z;  4X64 O;  1K5S A;  2X6A A;  1JOY A;  1RSO A;  4K3A A;  4JYB A;  3TXQ A;  4PA9 A;  4WFF A;  1OJH A;  1JR9 A;  5IT9 N;  2ZM6 O;  2P4K A;  3ZBH A;  3OR6 C;  3JAT B;  1EN5 A;  4P9O A;  4GX5 A;  4J9Y B;  4LFB O;  1XOU A;  2H94 A;  3U0Z A;  3B4S A;  4DR5 O;  1SRY A;  4NTW A;  3JAW B;  1K8A W;  3LSU A;  3CRA A;  3BFR A;  3F5T A;  2ZIN A;  4CH6 A;  4YHH B;  2P6J A;  3FD9 A;  5IYD O;  4AQY O;  1NH2 D;  2OYQ A;  2FYU H;  1ZTE A;  3FB7 C;  4YIO A;  3VBB A;  1YDX A;  2EIJ C;  3D36 A;  3E35 A;  3D36 C;  5CA1 B;  2XUM A;  1F51 A;  4PJ0 Z;  1KBH A;  1KB9 F;  1N36 B;  3K5O A;  2BE3 A;  3FYI B;  4R7C A;  3APQ A;  5KUK A;  3UM7 A;  5DED A;  2QM7 A;  5CBG A;  3CCV V;  3K58 A;  2ITD C;  3ML0 A;  1W0J G;  4X8A A;  3K59 A;  1K34 A;  2OTL V;  1F4N A;  1KMI Z;  3EXA A;  2ZT9 B;  2G38 A;  2HKO A;  3JAT A;  3A8T A;  3K06 A;  4HBN A;  4DR7 O;  4W4L A;  2B5U A;  3FYE B;  4Q6G A;  4P2Z A;  3C90 A;  2PGG A;  4LFC B;  1NR1 A;  4DR4 B;  3F5W C;  4X1K A;  4JI5 B;  2B1I A;  4NTX A;  3UCS C;  1N32 B;  4TUY B;  4OX9 O;  3SDL A;  5E79 Z;  3SYA A;  2R9I A;  3A0H Z;  3ETG A;  2AXT Z;  4EKW A;  1WB7 A;  5CB4 B;  5L3B A;  1VQ6 V;  4JYA O;  2N05 A;  1EBO A;  3JAL B;  3E22 A;  2EIM B;  2AZ0 A;  2PTM A;  1QHT A;  5BR8 B;  5GW7 A;  2A0L A;  5CA1 A;  1IXM A;  3ZHV A;  2Z3Y A;  2P5O A;  3ZCC A;  2Q67 A;  1I5Y A;  3LNN A;  1VF6 C;  2WAM A;  1KYO F;  1HW7 A;  4LFB B;  5TIS Z;  4UVB A;  1XDC A;  1W0K G;  2GBO A;  4FZ0 A;  1J95 A;  3JAS A;  3S3X A;  4X65 O;  3SR2 C;  1Q5O A;  1AVM A;  4B7E A;  5IJ9 B;  4K8X A;  1BGY H;  3A0R A;  3B2E E;  3U11 A;  3AG1 B;  1DF4 A;  3CP1 A;  4JTA B;  1I08 A;  4AQY B;  4WFB V;  2YXL A;  1N33 O;  3ZN0 A;  4J42 A;  4X20 A;  3ZRX A;  2HG5 C;  1YXB A;  1OCR B;  1LUV A;  2DYS C;  4FZ1 A;  5BMV B;  2ADQ B;  3X2Q C;  3KZI Z;  5IYB O;  3W7W A;  4JI0 O;  3N2G B;  3CMA V;  2Q73 A;  2ZNI A;  1KU9 A;  2LGW A;  2QKS A;  1T5E A;  4JI8 B;  4MW3 A;  5B1A B;  2KG7 B;  3CCQ V;  1S76 D;  1XIL A;  2BSK A;  5KLV H;  3JAL A;  4AIL C;  4BWA A;  1RPR A;  2QWR B;  4JI6 B;  3DTU B;  5B66 Z;  4J7K A;  1BL8 A;  2QTO A;  2XTA A;  2P90 A;  2E5L O;  3ZRS A;  3W7U A;  1IBK O;  2V7Q G;  1FXK B;  5B1O A;  3ZMU A;  4OPH A;  4B08 A;  5IYC O;  4OX9 B;  4JAV A;  2YI9 A;  1A32 A;  1R6T A;  3EVK A;  3L9D A;  5KHI A;  4X88 A;  1XHX A;  5IJ9 A;  4MTF A;  1VQ5 V;  2UXD O;  5LXT B;  4J80 A;  4AHC A;  1XNR O;  2CUG A;  3AG1 C;  3T1H O;  4JI1 B;  1PNM A;  5L3C A;  1SF9 A;  1KP2 A;  4UV9 A;  4I55 B;  4OPA A;  1YIJ V;  1Y67 A;  1FD9 A;  1VIB A;  2R70 A;  1OHH G;  3AG3 B;  2AHY A;  3BA8 A;  3SPG A;  4GX2 A;  5H6R A;  1M4U A;  1IVS A;  3KCY A;  1Q82 W;  1AI6 A;  4B3R O;  2PYL A;  4PDL A;  4WFH A;  1GN4 A;  4PI0 A;  2Q7E A;  4IGG A;  2X6C A;  3IGA C;  5A9G A;  1EM1 A;  2PZS A;  1V9P A;  2HJF C;  1YZB A;  2Q68 A;  5KUM A;  5EK0 A;  1L1F A;  3QO5 A;  1K3E A;  2YI8 A;  2ZE7 A;  2LW1 A;  1AJQ A;  5EIB C;  4LF5 O;  4H0L B;  3BY6 A;  3WU2 Z;  3ZRW B;  1VQP V;  1AP6 A;  3ASN C;  2RNB A;  2QKA A;  1IZ3 A;  1FXK A;  1K4D C;  5JJN B;  5J2T B;  2P06 A;  2UUC O;  2JGD B;  4JI0 B;  3ABU A;  2XAH A;  3RFR A;  2EUL A;  3OM3 B;  1S5J A;  4CH4 A;  5LXT A;  2RJZ A;  1H2M A;  4DV0 B;  1WB8 A;  3QTC A;  4D7T A;  4ZHQ B;  1KQS U;  3HKB A;  5KAI Z;  2IU0 A;  2DYR C;  1SQF A;  2K1E A;  2IBZ H;  2ZQM A;  4EEQ A;  3O9O A;  4FLZ A;  4I9Q A;  2QM8 A;  1WP8 A;  4U7N A;  4DUZ O;  2B1G A;  3OW2 U;  2E5L B;  2WLK A;  3JYC A;  1XMO B;  2GV9 A;  4UUJ C;  4QNH B;  1IBK B;  2W6J G;  4O4H B;  1JX9 A;  1S5H C;  1VF7 A;  4JI4 B;  4MVS A;  3WG7 B;  3JD2 A;  3AK1 A;  2HR3 A;  5J2U B;  4X9Q A;  4PHZ A;  1OCZ C;  2FML A;  4RUF A;  3T1H B;  2LFR A;  5LHH A;  1JFF A;  2ZCE A;  2GHY A;  5C8Y B;  3HB3 B;  3J81 N;  3M7M X;  4R6Z A;  4NXM B;  5JQG B;  3I55 V;  1QVG U;  5B3S B;  1FJG B;  2IU3 A;  1YTF D;  3ZMZ A;  3JCU Z;  3BAB A;  4B3R B;  2EZP A;  4YY3 O;  2JGD A;  4J7Z A;  3MHH C;  3CC4 V;  3H01 A;  4JTD B;  3ZJZ A;  2D3O W;  1NVP B;  3AG2 C;  3WB2 A;  1O9H A;  2ETN A;  4F4L A;  2Y0I A;  3LSQ A;  2W6I G;  2Y4T A;  2B9Z A;  3K3W A;  3FX7 A;  3F7Y C;  4K0K B;  3UKM A;  1THZ A;  4L87 A;  2NR5 A;  5L3E A;  2DJV A;  3SYC A;  1XRE A;  4ZOL B;  4U7O A;  1J5E B;  3IFX A;  2K9P A;  4PEL A;  1CP9 A;  4O4H A;  2ZDI A;  5EIB D;  2XAS A;  2LFS A;  3OE7 G;  5L3G A;  3DGE A;  4C7U A;  5J2U A;  1BHA A;  1R3L C;  3ETE A;  3J7A U;  3SPC A;  2A79 B;  5DN6 G;  3CRM A;  2F4V B;  1V55 C;  5C8Y A;  1PP9 H;  1JPX A;  5JVD B;  1MA1 A;  2EZO A;  5H9C A;  2RDC A;  1AI4 A;  1M93 A;  1PPJ H;  5JCO C;  3VQY A;  4G27 B;  1RM1 B;  3G67 A;  2ZIO A;  2A06 H;  5KMG B;  2ZIM A;  2WLN A;  4YHH O;  1Q81 W;  2FB5 A;  2QDO A;  3RYI B;  3W7S A;  4FM2 A;  4DW1 A;  2QM4 A;  1GM8 A;  4DV3 O;  3VQW A;  1PL0 A;  3OAA G;  1ZWI C;  1S5L Z;  1JVM A;  3E8F A;  1V54 C;  2JEU A;  3GVM A;  3JAK B;  1FKA O;  3CWB H;  1Y76 B;  3KG2 A;  2ARH A;  4LF7 O;  4FLU A;  2ZR2 A;  1YJW V;  1VQO V;  3PN1 A;  1PL4 A;  2LP7 A;  2CTQ A;  5B1N A;  1OCO B;  3G80 A;  4ZOL A;  2IH1 C;  4Z1V A;  2HLD G;  3OTF A;  1FXV A;  1JMK C;  1Z2G A;  4YY3 B;  3MD0 A;  2F23 A;  1GMG A;  3QG5 A;  4TQF A;  2DOS A;  3OGC C;  3G4S V;  3ZMT A;  1XI1 A;  1SZT A;  1Z5W A;  3QF7 A;  4O4L A;  2GTA A;  2PI5 A;  1YJN V;  1HR0 B;  1E79 G;  1AI7 A;  1UJW B;  2EIK B;  2JJ1 G;  5LYJ A;  1H2N A;  2PF4 E;  3CJH B;  1EN4 A;  3L71 H;  2D2C B;  4LFC O;  1NQT A;  1VQK V;  4DR4 O;  4JI5 O;  3CB2 A;  1QR9 A;  4H44 B;  4U3J A;  4DO2 A;  3CXH F;  1H2G A;  5KMG A;  3H1J H;  1P4R A;  5BZB A;  1VQL V;  3NXS A;  1I94 O;  3RYC B;  1Q6U A;  4RO2 A;  2CH7 B;  2H3O A;  2WLM A;  2RN9 A;  2AHZ A;  4FFK A;  1KUQ A;  5BR8 O;  3L72 H;  4LFA O;  3JAR B;  3JAK A;  4R8C A;  3LDE A;  1GTO A;  1FFT B;  3PJS K;  3RWR D;  2GTS A;  2W0F C;  3RN4 A;  4XDL A;  1VQ9 V;  3TK1 A;  4GKJ B;  3B8N A;  3M99 B;  3I56 V;  4PA6 A;  2XT9 A;  4Z2W A;  1OCO C;  3VQV A;  1YIT V;  1YSC A;  2X6B A;  3N27 A;  1PM9 A;  1Q6H A;  1EZJ A;  2YSU B;  2QEX V;  4B3M O;  1HWY A;  4DV3 B;  4MVR A;  3CRC A;  2YC0 A;  3L73 H;  1URF A;  4XDK A;  1G6U A;  1UFI A;  1P84 F;  2N74 A;  5IE9 A;  5B5E Z;  1OCC C;  2F66 C;  2ILM A;  2KQX A;  1JJ2 U;  4G2K A;  3CJH A;  4LF7 B;  1QLE B;  1SZX A;  2LGQ A;  2O57 A;  5LHG A;  2DE0 X;  4DV5 O;  3RVY A;  4I4T A;  1SQQ H;  3FB8 C;  3W7T A;  3CYO A;  4FM0 A;  4JI8 O;  2QSA A;  4I9W A;  4HYO A;  1WNS A;  3RYC A;  1KP3 A;  1YCI A;  2CH7 A;  2QE7 G;  4YJ3 B;  4DR1 B;  3UT5 B;  4TT3 G;  2QR4 A;  5KX5 B;  4XDJ A;  4JI6 O;  1SER A;  3RGB A;  3H1L H;  1M90 W;  1VQ8 V;  2LO1 A;  3CS5 A;  3GWO A;  2CTW A;  1TAE A;  5KHJ A;  2ZXW B;  2Q8V A;  2IM9 A;  4O4J B;  3C3T A;  3UQ8 A;  3JAW A;  1KC8 W;  1GM7 A;  4UV8 A;  5L3F A;  4MTX A;  1I94 B;  4JI1 O;  2QJ1 A;  4JYY A;  1CPY A;  4PA4 A;  4E2L A;  4BW5 A;  2ZNJ A;  4LFA B;  4J7J A;  3OUS A;  1FS0 G;  5IY5 B;  1QR8 A;  5LOV B;  2PYJ A;  5D5P A;  3W7X A;  1NR7 A;  2Q7G A;  5JWP A;  4OGQ B;  3MAQ A;  2M7W A;  2BTQ B;  1MMM A;  4TOI A;  3OTO B;  4O4I B;  3TXS A;  5D5Q A;  3O65 A;  1RPO A;  4X1Y B;  5GTI Z;  4NR1 A;  1K5Q A;  3G6E V;  4H13 B;  4YJ2 B;  2ZR3 A;  2Q0O C;  4B3M B;  3SJA C;  4LF8 B;  4B3S B;  4YJ3 A;  2VRZ A;  3UT5 A;  1E1Q G;  5IYZ B;  1R3I C;  1SET A;  2XAQ A;  3ZX6 A;  5KX5 A;  5LMN B;  4WBN B;  3OMA B;  4GLX A;  2HHH O;  3QO8 A;  4DV7 B;  1ARO P;  3CCM V;  4ZI7 B;  2YXY A;  4GUN A;  2QWN B;  2JGU A;  3TJT A;  1X59 A;  4UCV A;  4FJC C;  2OCC B;  4ICG A;  1AJP A;  5H5N A;  2GDS A;  4DV5 B;  4CS4 A;  5A2Q N;  4FVM A;  1SQV H;  4TUY A;  4ZKI A;  1DGS A;  1LR1 A;  5IWA B;  3ABT A;  1PKX A;  4DR3 B;  4O2A B;  4DR2 O;  4BIO A;  2V1D A;  1W59 A;  4LP8 A;  5CB4 A;  4DV0 O;  1M1K W;  4JI2 O;  1DLB A;  2KKW A;  4FFB B;  1G1X B;  2EIM C;  3APO A;  4UCR A;  2CGO A;  2YUA A;  3U10 A;  5LA6 B;  1WN7 A;  2VQF B;  1Q6I A;  3ZN1 A;  5IY5 C;  4G28 B;  5LOV A;  2P7T C;  3H1H H;  1DTO A;  4RQF A;  3P32 A;  3CC7 V;  1AR1 B;  1SQG A;  2BTQ A;  1XMO O;  4EFE A;  4O4I A;  1M56 B;  4PD4 F;  4JI4 O;  2UU9 O;  2ZD9 A;  4IIJ B;  4QJF B;  1JA8 A;  2CK3 G;  2HFE C;  2R9R B;  1GO3 F;  1F4M A;  5GTH Z;  2WPD G;  4WCE V;  4YJ2 A;  2WWW A;  3SYQ A;  2LJ2 A;  5FLX N;  3FB6 C;  3RYH B;  3B09 A;  2Q69 A;  3CCS V;  4CC6 A;  5IDJ A;  1AP5 A;  3VQX A;  3FB5 C;  1NS1 A;  4NXM O;  4DR6 B;  4ZI7 A;  1ZAU A;  2HVJ C;  1OCR C;  1FFX B;  1XEQ A;  2E76 B;  4J10 A;  2WA3 A;  5BMV A;  1FJG O;  4MVM A;  1YHQ V;  4GZR B;  4QE7 A;  2CAZ C;  1R1B A;  3N2G A;  4JAA A;  1M57 B;  1B04 A;  1TVK B;  3ZED A;  5B1B B;  5BY1 A;  3OMI B;  2E3C A;  1MNG A;  3ZS8 C;  2EX3 A;  5B1A C;  2MW2 B;  2KG7 A;  4LNU B;  3S3W A;  3IC9 A;  4QGP A;  4Z1M G;  5JJE B;  4WFA V;  4MSW C;  3E89 A;  4K0K O;  4UCO A;  3CD6 V;  2HHH B;  3ABL B;  1EZV H;  2CGN A;  1L0L H;  5GON B;  1ZSP A;  1R6N A;  4RQE A;  3BAA A;  1FYJ A;  2A3Q A;  4TV8 B;  4QE9 A;  1J5E O;  3ABK B;  3R65 A;  4LF6 B;  4JI3 B;  5F2V O;  4GKK B;  2JJ2 G;  3LNM B;  1FXK C;  2Q9L A;  1AR5 A;  4LBE C;  4X62 O;  3A0B Z;  1BS3 A;  5KHH A;  4ASU G;  2P4V A;  4DR2 B;  4Q20 A;  4K35 A;  3TCU A;  3RYH A;  4UCT A;  3K0D A;  5HFL A;  4JI2 B;  2F4V O;  4I55 A;  1BQZ A;  2CTP A;  3LDC A;  2UUB B;  1P7G A;  3OUF A;  1NKD A;  4KL1 A;  2YEV B;  1H2S B;  3AG3 C;  2XND G;  2VQE B;  1YF2 A;  5LGN A;  3QO7 A;  1HNW B;  3STZ C;  4A5U B;  2H8P C;  3ZHQ A;  3DXR B;  2EBO A;  2XAF A;  3SPH A;  2UU9 B;  1M57 C;  1G8M A;  4DV2 O;  1SQP H;  1BSM A;  4H37 A;  1GRJ A;  1MZF A;  3CHX A;  3KKY A;  3CCJ V;  2XOK G;  3ABM B;  4LNU A;  2JS3 A;  4P9P A;  3ETD A;  1US6 A;  4DV6 B;  2PY5 A;  4FIP C;  3FKS G;  4UB8 Z;  3VOU A;  2EJR A;  4N21 A;  4KUM A;  5GON A;  2QWP B;  4FM1 A;  1WAZ A;  2DW4 A;  3ZRW A;  1YI2 V;  3K0G A;  2IW5 A;  4CH3 A;  4E4E A;  1I5X A;  5J2T A;  3JD0 A;  4DV4 B;  1P49 A;  1B6Q A;  4NKG B;  1NH2 B;  1H2L A;  2EIN B;  4DUY B;  4GX0 A;  3N2K B;  1BT8 A;  1HR0 O;  1GH6 A;  5CA0 B;  1K9M W;  4ZHQ A;  3G71 V;  1QLN A;  4UVC A;  5L3D A;  2ITC C;  4FLV A;  4JI7 O;  4J9Z B;  4W4K A;  3ASO B;  5FPR A;  1NT2 B;  2DWD C;  4J41 A;  3G6B A;  2XHB A;  3QVN A;  3HKE B;  1MZE A;  4WF9 V;  1OZ0 A;  2EIL B;  5K1X A;  3SPJ A;  2ZDI C;  4X62 B;  2A7W A;  3WG7 C;  3T1C A;  1NJI W;  2UXB B;  2IJJ A;  1DK1 A;  2MK3 A;  5H2F Z;  2Y0P A;  3OMN B;  4XBF A;  2CTR A;  4ZBM A;  1L0N H;  1K73 W;  2ZKO A;  3AEI A;  3IAY A;  2YDE A;  1IBL O;  4GKJ O;  4WFG A;  4FPP A;  4QPK A;  3E86 A;  1E1R G;  3CEI A;  4BW9 A;  1Q8I A;  3STL C;  3T4Z A;  5JQG A;  2JK5 C;  1VP7 A;  1Q7Y W;  2M6Y A;  4DYL A;  5B3S C;  5LBQ A;  4N23 A;  5KHG A;  3P3P A;  1U96 A;  1IXB A;  2BCC H;  1AJN A;  3E83 A;  3ZHT A;  1QCE A;  3H1I H;  1EN6 A;  3K5N A;  5LL6 Y;  4DV2 B;  3H1K H;  2EIN C;  1IDS A;  2OTJ V;  3NR7 A;  5CA0 A;  4LR3 A;  4JPR A;  3T4D A;  2IJK A;  1RSO B;  5LMU O;  4RWU A;  1N0N A;  4JV5 O;  3K04 A;  1GKF A;  4GX1 A;  4NTY A;  3HKE A;  1ORQ C;  3D3I A;  2RCV A;  4DR1 O;  4D6T H;  1NTZ H;  4PDR A;  1MSW D;  3SJQ C;  4FK5 C;  1BE3 H;  5FPO A;  4I50 B;  1WPX A;  5BXZ A;  4KHP O;  5JVD A;  4LH7 A;  4P30 A;  2KSD A;  3LSS A;  5KHK A;  3OEE G;  1F7Y A;  4JI7 B;  2UUA O;  1WP7 A;  4CZZ A;  1RM1 C;  5ITZ B;  2QWQ B;  3THO A;  1NU1 H;  3K79 A;  1S72 V;  4GT1 A;  4B3T B;  2UXN A;  1N34 O;  3RYI A;  2JDI G;  4DV1 B;  4UCS A;  4GCZ A;  1R3J C;  2YS8 A;  3ZRV A;  2ATK C;  4NYK A;  3BEH A;  3P30 A;  1IBM O;  1Y76 A;  2A9H A;  4KXR A;  4YIP A;  2EJ7 A;  3CCL V;  4KP4 A;  1IBL B;  3SGI A;  4FLX A;  1CXZ B;  2W0X A;  3OTO O;  5FL7 G;  1BQ0 A;  3TET A;  1I0H A;  1SQX H;  1K92 A;  3EFF K;  4EB6 B;  1GN2 A;  1I7F A;  3FFQ A;  1QVF U;  4X66 O;  3A2F A;  2QGN A;  4MVQ A;  2WLH A;  4B7K A;  4DW0 A;  3OD4 A;  4LF8 O;  4B3S O;  1YEW A;  3K57 A;  2Y4U A;  2UXX A;  2YIB A;  2IH3 C;  1NZ6 A;  3HKC B;  1GAX A;  5LMN O;  4IYH A;  3BHP A;  4DV7 O;  4X1K B;  2QWO B;  4I0X B;  4I5S A;  4I50 A;  3OFN G;  2L6L A;  2EIK C;  3AK3 A; 
#chains in the Genus database with same CATH homology
 4DV0 B;  3QTC A;  3N2K A;  4D7T A;  4ZHQ B;  5JCO A;  1DGS A;  3HKB A;  5IWA B;  4FLW A;  2VWK A;  5LMU B;  4DR3 B;  4U3J B;  4O2A B;  4LF4 B;  4DUZ B;  3E22 B;  5CB4 A;  4JV5 B;  5ITZ A;  1SQF A;  2UXC B;  4EEQ A;  2F93 B;  1SKV A;  2KKW A;  2F95 B;  4FFB B;  4FLZ A;  4UCR A;  4I9Q A;  3U10 A;  5LA6 B;  1WN7 A;  2VQF B;  2E5L B;  1XMO B;  5LOV A;  2GV9 A;  1IBK B;  4O4H B;  1VF7 A;  4JI4 B;  2JVD A;  3JAR A;  1SQG A;  2BTQ A;  1XMQ B;  5J2U B;  4EFE A;  4X1I B;  4O4I A;  3JAS B;  2P22 C;  4TV9 B;  4TQD A;  3BA9 A;  4IIJ B;  4KHP B;  4PHZ A;  3T1H B;  4EFB A;  1JFF A;  2ZCE A;  4YJ2 A;  5C8Y B;  5LP6 B;  3M7M X;  2UUA B;  2RQ6 A;  4EB6 A;  3RYH B;  4NXM B;  5JQG B;  2R9A A;  3K5L A;  4CC6 A;  1N34 B;  4X20 B;  1M5I A;  1FJG B;  3VQX A;  5JH7 A;  2F1M A;  3BAB A;  4B3R B;  4DR6 B;  3CSX A;  2HEP A;  4ZI7 A;  2JS5 A;  1ZAU A;  3HKC A;  3WB0 A;  5FNV A;  4GYC B;  1FFX B;  2OWO A;  5BMV A;  3K5M A;  5EZY B;  1IBM B;  2CAZ C;  3WB2 A;  1O9H A;  5JJJ B;  4CH5 A;  4NVP A;  3N2G A;  1TA8 A;  3T1Y B;  4CC5 A;  1B04 A;  1TVK B;  4UCU A;  4X64 B;  3ZED A;  4I4T B;  2E3C A;  4L8J A;  3ZS8 C;  2EX3 A;  1Z5V A;  4DK1 A;  4K0K B;  1D5A A;  4LNU B;  1RSO A;  2ZM6 B;  5JJE B;  4X66 B;  4ZOL B;  4UCO A;  2HHH B;  1J5E B;  4O4H A;  5GON B;  3JAT B;  5EIB D;  3BAA A;  4TV8 B;  4LF6 B;  4JI3 B;  4GKK B;  5J2U A;  4X1I A;  4DR5 B;  4TV9 A;  3U0Z A;  5KHH A;  2YIB D;  2F4V B;  5C8Y A;  3JAW B;  5LP6 A;  4DR2 B;  5LP6 C;  5JVD B;  3DSQ A;  4O4J A;  3RYH A;  2ZIN A;  4CH6 A;  4UCT A;  4YHH B;  4JI2 B;  1M93 A;  5JCO C;  4I55 A;  3VQY A;  2UUB B;  2ZIO A;  5KMG B;  2BTO A;  2ZIM A;  4KL1 A;  2OYQ A;  1H2S B;  4CS3 A;  3RYI B;  4FM2 A;  3SJB C;  2QM4 A;  3VQW A;  5CA1 B;  2VQE B;  2Q7H A;  5EZY A;  1HNW B;  4NXN B;  3JAK B;  2UU9 B;  1N36 B;  3K5O A;  3CHX A;  4FLU A;  3PN1 A;  4LNU A;  4X1Y A;  4F6R B;  1L8D A;  1Q3E A;  3K58 A;  4DV6 B;  2PY5 A;  4ZOL A;  4DR7 B;  3K59 A;  1HNZ B;  3OTF A;  1KMI Z;  5GON A;  3JAT A;  1JMK C;  5IYZ A;  4FM1 A;  4YY3 B;  4HBN A;  3QG5 A;  4TQF A;  4WBN A;  4Q6G A;  1XI1 A;  4CH3 A;  4HNA B;  1Z5W A;  3QF7 A;  4O4L A;  2PGG A;  5J2T A;  4LFC B;  4DV4 B;  1HR0 B;  1P49 A;  4DR4 B;  4X1K A;  4JI5 B;  1TGO A;  1N32 B;  5LYJ A;  4TUY B;  4DUY B;  4JYA B;  3N2K B;  3HKB B;  5CA0 B;  4ZHQ A;  3CB2 A;  1Q43 A;  4U3J A;  4O2A A;  5CB4 B;  5KMG A;  3JAL B;  1WPB A;  3E22 A;  1QQC A;  2PTM A;  1QHT A;  4FLV A;  5BR8 B;  4FFB A;  2Q0A A;  1HNX B;  5CA1 A;  3RYC B;  5LA6 A;  1SA0 B;  1NT2 B;  5FPR A;  2P5O A;  4FLY A;  3LNN A;  2XHB A;  1HW7 A;  4DRX B;  3HKE B;  4LFB B;  3JAR B;  3JAK A;  5K1X A;  4CS2 A;  4X65 B;  2R72 A;  4X62 B;  3RWR D;  4LF9 B;  2UXB B;  3JAS A;  5EYP B;  5K1P A;  4GKJ B;  4IIJ A;  3SR2 C;  1Q5O A;  4F6R A;  1N33 B;  1JFF B;  5IJ9 B;  4K8X A;  3VQV A;  5IJ0 B;  3IAY A;  1O9G A;  3U11 A;  3B2E E;  4AQY B;  1JJO A;  2YXL A;  4BW9 A;  1Q8I A;  2V4D A;  2YIA A;  4ZIB A;  4DV3 B;  5JQG A;  4X20 A;  4HNA A;  5KHG A;  4IHJ B;  1G6U A;  3RYF B;  5BMV B;  1FFX A;  3K5N A;  2F66 C;  2VWJ A;  4DV2 B;  1X4T A;  3N2G B;  4LF7 B;  2ZNI A;  2PUS A;  1KU9 A;  1TUB B;  1T5E A;  4JI8 B;  5CA0 A;  4LR3 A;  1TVK A;  4I4T A;  4PI2 A;  3JSL A;  3JAL A;  4FM0 A;  4AIL C;  4BWA A;  1WNS A;  4JI6 B;  3RYC A;  1SA0 A;  4YJ3 B;  4DR1 B;  3UT5 B;  4DRX A;  3HKE A;  4K8Z A;  5KX5 B;  1XNQ B;  3RGB A;  4TV8 A;  2UXD B;  5EYP A;  4B08 A;  1XNR B;  3HKD B;  4OX9 B;  1TAE A;  5KHJ A;  2YI9 A;  4LH6 A;  4DK0 A;  5FPO A;  4I50 B;  5KHI A;  3ETQ A;  1XHX A;  4O2B B;  5IJ9 A;  1XHZ A;  2IM9 A;  5IJ0 A;  4O4J B;  5LXT B;  4AHC A;  3UQ8 A;  3JAW A;  4JI1 B;  5JVD A;  4LH7 A;  4I55 B;  5KHK A;  4JI7 B;  1I94 B;  2R70 A;  5ITZ B;  3THO A;  2QJ1 A;  3BA8 A;  4B3T B;  4IHJ A;  1M4U A;  3RYI A;  3RYF A;  4DV1 B;  2ZNJ A;  4LFA B;  4UCS A;  5LOV B;  2PYL A;  2PYJ A;  5D5P A;  4PI0 A;  2Q7G A;  2Q7E A;  1TUB A;  3MAQ A;  2BTQ B;  4TOI A;  3OTO B;  4O4I B;  2PZS A;  5D5Q A;  4LF5 B;  1V9P A;  4D7S A;  4X1Y B;  1IBL B;  3SGI A;  3BPZ A;  4FLX A;  2YI8 A;  4YJ2 B;  5EIB C;  4B3M B;  3SJA C;  4LF8 B;  4B3S B;  4EB6 B;  4YJ3 A;  1I7F A;  3FFQ A;  3UT5 A;  5IYZ B;  3A2F A;  4UFZ A;  5KX5 A;  2UUC B;  5LMN B;  4WBN B;  4GLX A;  4DV7 B;  3WB1 A;  1YEW A;  5JH7 B;  3K57 A;  5JJN B;  2YIB A;  4O4L B;  5J2T B;  4ZI7 B;  4FLT A;  3HKC B;  1XQ8 A;  2JGU A;  3HKD A;  5FNV B;  4JI0 B;  3BHP A;  4X1K B;  4UCV A;  3JSN A;  3RFR A;  5LYJ B;  4I50 A;  3ICX A;  4O2B A;  3SJC C;  4DV5 B;  1S5J A;  4CS4 A;  4CH4 A;  5LXT A;  3BRC A;  4FVM A;  4TUY A;  2RJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...