3SJBC

Crystal structure of s. cerevisiae get3 in the open state in complex with get1 cytosolic domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
63
structure length
63
Chain Sequence
ELSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 25
structure length 63
sequence length 63
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3sjbC00
2P22C 2F66C 3QF7A 3SJCC 3SJAC 3THOA 1X4TA 3B2EE 3SJBC 3CSXA 1SKVA 2CAZC 2JS5A 1NT2B 3ICXA 3QG5A 3ZS8C
chains in the Genus database with same CATH superfamily
3O65A 3TGUH 2XAGA 1I7FA 4JF3A 1N34B 2NR5A 4J7ZA 1D5NA 4GKJO 4DR7B 1XMQO 3CE2A 3SJQC 4CBCA 4DUZB 4LH6A 4I4TB 3ETEA 2UU9B 1URFA 2RCVA 2PYJA 4JTAB 5LP6B 1R3IC 2DMXA 2E5LB 4UFZA 2ADPA 4X20B 2YIBD 4KHPB 4UB6Z 3FD9A 4ZHQB 3JAWA 2YIAA 3D8CA 2IBZH 2JRIA 3BFRA 4O4LB 3K5NA 3D3IA 3I5DA 1HR0O 3HKEA 5EC2C 4GUNA 4BW5A 5C8YA 4JI3B 2YXHA 4FFBB 4LF5O 5EZYA 5J2TB 4DW0A 4ZI7B 3VBBA 3QNEA 5L3EA 5LXTA 2C2AA 1BE3H 3GB7C 3JARB 4LF4O 2QKSA 4X64B 3ZMTA 1JJ2U 1YJNV 4X66B 3C3SA 4OX9B 4UCUA 1NTMH 2LFSA 1Y74B 3CRAA 3JATB 4X65O 4NXMO 2PUSA 5CBFA 5BMVA 1SC5B 1IBLO 4MW8A 1QVFU 5H6QA 3DSQA 4P9OA 4DR4B 4FLXA 3CC4V 1K9MW 5B1BB 4DR6O 3FFQA 5BR8O 2KKWA 1QQCA 4JI5O 4LCUC 5IYDO 1NVPB 4RUFA 4RWUA 1GM7A 4IHJB 4NXNB 3WFVA 1VQLV 1Z2GA 1JFFB 1P84F 5EIBD 2G38A 4E2LA 1XBLA 4EKWA 1XL4A 3WB2A 2RMKB 2Q8VA 3ZHQA 4GT1A 2LJ2A 2JEUA 4J11A 2EINB 5JVDA 4CH5A 3QO5A 5JH7A 2EBOA 2QWPB 4IL6Z 5ITZB 2VQEO 1AI4A 1WNSA 1RM1B 3ZHUA 3OTFA 1X4TA 1T5EA 5JJNB 2ITDC 3ETGA 3DGEA 1R6NA 5H6RA 5LHIA 2AHYA 2GSMB 1YF2A 2JEXA 4JV5O 3K9SA 3U10A 4TV9B 4DK1A 5D5QA 4YY3O 2VQFB 1H2GA 1Q86W 1Q6UA 3QTCA 2LP7A 3TETA 1N33O 5IY5B 1HNXB 4LFBB 3HKDB 3UM7A 1JMKC 1SQXH 1XNRO 2RJZA 4PJ0Z 1IBMB 3BABA 2XAHA 4AILC 3H1KH 2BTOA 2ZD9A 1K92A 1S72V 3K06A 1V54B 3FAVA 3QVNA 3ZJZA 4DV5O 4PV1B 1O9HA 4I0XB 4TQDA 3CCQV 2MK3A 1GK9A 2FMLA 5EC1C 1MG1A 2EJRA 4DV3O 2Y69B 2BOBC 5DEDA 3LDEA 3BHPA 3G67A 4ASUG 4WFFA 1H2MA 3HR0A 3AK3A 4K0KO 4N21A 1N0JA 2BOCC 5CB4B 2YIBA 1QR8A 5H2FZ 1KP3A 5IYZB 4UXNA 4LNUB 2EIJB 1H2NA 4J10A 3CWBH 4KXRA 1MABG 2WLKA 4AHCA 1NQTA 4JI0O 4JI6O 3AG3C 4DV2O 2P4VA 1NT2B 3N2GB 3ABKC 2IH3C 2QGNA 3K58A 4XDLA 1VQ9V 1FAFA 1OCCC 4PHZA 3ABMC 4I55B 5L3DA 4WFHA 5IYCO 3BCCH 4DUYB 1AJPA 2IJHA 3U11A 1AB3A 1PNMA 3K08A 5KAIZ 4TSFG 2WA3A 4JI2B 1B06A 4YJ2B 1I5XA 4UCVA 1AR1B 1LUVA 5IJ9A 4K35A 1XI1A 1G6UA 3EFFK 3JAKA 3JYCA 3LNMB 3ABLB 3DXRA 4I50A 1AJQA 3CCLV 3RGBA 1VQ6V 2EILC 2WLLA 3WB1A 4O4JA 2GHYA 3E22B 4CZZA 1EM1A 4B3RO 1TUBA 2PZSA 4JI7O 4AQYO 2V7QG 2OCCB 5GW7A 3ZN0A 5LMUO 2ZE6A 2VRZA 2ZXWC 1F4NA 2DYSB 3OMIB 3RYHB 3F5WC 4YIPA 1GKFA 3RFRA 2ZDIA 4O4HB 1GM9A 2DYRC 1CEZA 1EBOA 2ZNIA 1BGYH 4BWAA 1JA8A 3OFNG 4ZBMA 2V4DA 3KCYA 3BVOA 5H5NA 2HHHO 1WB8A 4FJCC 5CA1A 3BA8A 5L3GA 4MVMA 4LF9O 1XMOO 4WBNB 1N32O 3ZCCA 5LL6Y 2EZPA 2XAJA 3RYIA 1FFXA 3MDSA 5LOVB 4H44B 4LWSB 2R9RB 4X1YA 4TQFA 1HNZO 1ZTEA 3WG7B 1BL8A 4G27B 4RUEA 1H2LA 2HKOA 2JS3A 1VIBA 4B3TO 2UXCB 2JGDA 4LF8O 2NLJC 4IIJB 5KA6A 4NB5A 1N36B 5JQGA 2IW5A 2YXLA 2UXDO 5CMUA 2GUZA 4X62O 4K8ZA 3CCSV 4JI8O 2UUAO 1JQ0A 4R7CA 4Q6GA 4LFAB 2X7RB 1RP3B 1K73W 2Z0AA 4FIPC 4IYHA 4DR5O 4QPKA 3AG4B 5LGUA 1LNQA 2QDOA 4R8CA 2M6YA 4P9PA 1VQ4V 3K5MA 1K7DA 2P5OA 2IH1C 1FD9A 4FZ1A 3ZEDA 5EBMC 4Z2WA 1HW7A 3Q4HB 2PI4A 1ZWIC 4GX2A 3JAMN 4DRXB 3G4SV 4QNHB 4B3SB 1R6KA 3QG5A 1GRJA 3CCUV 2IJJA 3JALB 1SA0B 3CD6V 2K1EA 5GONB 1NBMG 4LFCB 3ASNB 3IGAC 1K97A 2R70A 2PF4E 4TV8A 5KHGA 4FM0A 1KBHA 3CRRA 4DV6O 3E83A 3SDLA 1PNLA 3RYCB 1NVPD 1TVKA 1AP6A 2A79B 3K04A 4C7UA 5H9CA 4LC1A 2QWNB 1W2BU 5JJEB 1TA8A 3TJTA 2D3OW 4DV1B 3A0BZ 1OCZB 3SPHA 1IBKO 1V55B 3EXAA 1EFRG 2XTAA 5K1PA 3T1YO 3JD2A 1VF6A 1YTFB 3OTOO 1VEWA 2RNBA 2IJIA 3SYAA 2QM7A 4B3MO 3APQA 3CPWU 3AEIA 3HKBA 1KB9F 3A0HZ 5CA0B 1WN7A 1WP7A 5IT9N 2M7WA 3KKYA 4UCTA 1M57C 5KMGB 1YITV 3SPGA 2Q9LA 1ZL8A 3HKCB 4X88A 3O9OA 3X2QB 2YI9A 1P7GA 3CCJV 1IXBA 3JSNA 1L0LH 5KX5A 4FLVA 1RPOA 2HVJC 3JSLA 4I7ZB 3I56V 3K57A 4HNAA 4W4LA 4GLXA 1KKDA 4PA3A 3CMAV 1SESA 2A3QA 2XNDG 1HNWB 2DQ3A 3N27A 1GN4A 3OW2U 1W0JG 1VQPV 4MSWC 3F7VC 3M8AA 4L87A 1PNKA 3K5LA 2YDEA 4QE7A 2VS0A 4PDMA 1Q7YW 4PDRA 2B9ZA 3GWKC 4JYAO 1Q43A 4OGQB 2HFEC 1M90W 1AP5A 4I4TA 1S77D 4LF7B 2Z5UA 3ETDA 2LGQA 4YJ3B 1KMIZ 4FMTA 5LP6A 4LF4B 1P4RA 1FXVA 5B1BC 5CA3A 5KHJA 5EBLC 5J2UB 4X20A 5IJ0B 4ZHQA 2ZINA 2D2CB 5JCOA 3W7XA 3OMNB 3CXCU 1VQ8V 4X65B 4NXMB 1PM9A 5KHIA 4O4LA 5B1AB 2ZKOA 1XHZA 2QR4A 1I0HA 2UXBO 1IBLB 4O2AB 1YVWA 1KECA 1PD3A 4JI4O 4FFBA 1XOUA 4R6ZA 3SPCA 5J2TA 3K59A 3IC7A 4CS3A 1RM1C 4ZI7A 2FB5A 4DR3B 4JI5B 3D36C 4GKKO 1L1FA 5D5PA 2Y48A 3G6BA 2QA4V 3AG2B 3JARA 2EIKB 3S3XA 4Z1VA 2VWJA 2CUGA 4QGPA 1JJOA 4B7EA 4TUYB 2GTSA 3ZBHA 1Y74A 3H1JH 4FLWA 3K79A 5LHHA 3JATA 5EYPB 2VQEB 1RSOB 2P06A 5IY5C 4JI1B 4CC6A 2F4VB 1GO3F 3ZRVA 5B1NA 4X8AA 2F93B 4FLUA 3MHSC 1I94B 1WAZA 3AK1A 1V54C 4YY3B 4IHJA 2ARHA 1JFFA 3VOUA 1IZ3A 4I9WA 1N34O 4J7JA 1QU7A 1UJWB 2XAFA 3C90A 1GN6A 2UUCO 1N33B 3NR7A 3SYOA 4DR7O 3JCUZ 1XNRB 3AG1C 3H1LH 4U7NA 4JGSA 4WFAV 3H01A 1PPJH 4QPJA 4DUZO 1OCOB 5ITZA 2WLIB 3H1IH 2UU9O 2EIJC 1YI2V 1R73A 3D36A 3LNNA 4KHPO 4B7KA 3B40A 1MA1A 5JJJB 2KG7B 1JVMA 4NTWA 2ZCEA 4U3JB 2WA4A 5LBQA 3AG7A 3RVYA 5BZBA 4TV9A 2JIZG 2WAMA 1K3EA 1BHBA 3B09A 1JCHA 1UPGA 2P90A 1G1XB 2QTOA 1VMGA 4ZOLB 3VQVA 5DN6G 1YXBA 1RFYA 4MVZA 3E8BA 1M93A 1TUEB 3HKDA 3B77A 3CB2A 4MTXA 4PA7A 1WA8B 2QTSA 2DWDC 3TXQA 1PV0A 4JI0B 1GN3A 1W59A 3B8NA 1M56C 3ZS8C 1NS1A 4X64O 4HBNA 1K34A 2X6AA 1BT8A 2N04A 5K1XA 4I0XA 1H8HG 2E75B 4X1IB 4X66O 2V1DA 4OX9O 3JCZA 2W6IG 4D6TH 4DK0A 1ZAUA 1ZSPA 2F66C 3ABUA 3SR2C 4W4KA 3QF7A 2QEXV 2P6JA 5LYJB 4DR1B 2IU3A 1Q3EA 5CB4A 3NXSA 4XDJA 5IYZA 4XDKA 1LR1A 4DR4O 4LNUA 4O4IB 3RYFB 4NXNO 2F95B 4OPAA 2HP8A 1B3QA 3SPIA 3N2GA 1J5EO 1NR1A 2WWWA 1Q6IA 2ZIOA 2UUBO 3GWOA 4B3RB 3W7UA 4JYCA 2LQTA 4H0LB 4I55A 5EIBC 3ASOC 1E1RG 4E4EA 4JI7B 2IM9A 2ZDIC 3BY6A 1ROPA 5TISZ 1KD1W 5FNVB 3FB7C 3WG7C 2Q73A 1YTFD 4YJ2A 2ZE7A 4A5UB 2X6CA 3APOA 4PDVA 2JVDA 1S76D 4JAUA 1YEWA 1R3LC 1UFIA 3FKSG 2R9IA 4JAVA 2VQFO 2ZT9B 3KZIZ 1SQVH 3L9DA 4F6EA 3E22A 1BMFG 4BIUA 1L8DA 1BQ0A 4DR2O 4LH7A 4DYLA 3IFXA 1IBMO 1FJGO 2OTJV 4I5SA 3N2KB 2YIDA 3RYHA 4UB8Z 1M4UA 4O4HA 2ODMA 4MTFA 3CCVV 1DK1A 2QJ1A 2Q7GA 3CC7V 1KUQA 3OGCC 5HFLA 4U3FH 3G6EV 1Q81W 5L3FA 2ZE5A 2BTQB 4L8JA 5HFMA 3KG2A 2WSSG 2ZM6B 1G8MA 3OMAB 4KFMA 3ICXA 1BCCH 3BA9A 4WBNA 1R3JC 3R66A 1XQ8A 3K9AA 4DR5B 4BW9A 3SGIA 2HJDA 4DV7B 4MVUA 3ZRWB 5DM6V 3THOA 5LOVA 1SERA 3OEEG 4LWSA 1PKXA 3MAQA 3K03A 4OPHA 1U97A 1KP2A 1M9NA 1MNGA 1SZXA 4TWKA 4NKGB 1DF5A 2HR3A 4X1KB 1AI5A 3K0GA 5F2VO 4IIJA 4O2BB 1XILA 1Y67A 1QLNA 3HPLC 3P3PA 4FLTA 4J9ZB 1AJNA 1OCZC 5IDJA 1GH6A 1N4CA 4WCEV 1NJIW 4EEQA 2AGAA 2JJ1G 4NVPA 4DUYO 3IAYA 2E74B 4BAYA 3B8MA 4H37A 2YSUB 2AZ0A 4UCRA 3FYIB 3AG3B 4JI2O 4RAIA 4YHHB 5FPRA 5GTIZ 3A0RA 1QNMA 1H8EG 1JR9A 5IWAB 2LFRA 2UXXA 2JS5A 4B08A 3T4DA 1QR9A 5LA6B 3SYQA 1K33A 1OCCB 3K3WA 4KP4A 1VF6C 4RQFA 3ABMB 3JASB 3CP1A 4CC5A 4JYBA 2PGGA 3E8GA 3FX7A 1N8RW 3IJ4A 2HLDG 1A32A 3RYIB 4MTOA 2Q7EA 4DRXA 2A0LA 2UXNA 4J80A 2BCCH 4IT5A 3SJCC 1YSCA 3CS5A 3JALA 1SA0A 2LW1A 4CS2A 5GONA 2EIMB 2F23A 4DV0O 2CTQA 3MD0A 4K8XA 1X59A 3OEHG 2XT9A 1SF9A 3RYCA 3UKMA 3ZHSA 1YZBA 3CJHB 4P2ZA 3G80A 4CH4A 4OXSA 2XAQA 3LDCA 1E79G 2EX3A 1B04A 5FPOA 4EB6B 1NU1H 2GTAA 3BRCA 3ZX6A 2N05A 5LHGA 3PN1A 1TGOA 4GZRB 1S5HC 4FFKA 4QIWF 4I9QA 5BXZA 1FFTB 2BSKB 2PI5A 4GYCB 3OT7A 3OR6C 2RQ6A 1AVMA 4YIOA 5CN0A 3T1HO 1NH2B 1VQMV 1CXZB 3E8HA 5CA0A 3CCRV 3RVZA 4JYAB 5LMNB 4JZ2A 2XUMA 3FB8C 3I55V 2YICA 2H94A 2W0XA 1N36O 5KMGA 4F6RB 1Z5VA 1YCIA 4WFGA 5LP6C 4DV4B 3UT5B 3HKCA 1XNQB 2FKXA 4WF9V 3P32A 1M5IA 1NTZH 1ZLZA 3CRQA 5B3SB 4D7TA 3B2EE 3OAAG 2DN9A 5JCOC 1HP8A 4GKJB 4LFAO 1RPRA 3OE7G 4R50A 1XMQB 1AR4A 3OUFA 4KL1A 3JD1A 4WFBV 1BZKA 2F1MA 2B5UA 2LGWA 1K4DC 1D5AA 1EN6A 4XBFA 4J7KA 4UV9A 2ZE8A 4MTGA 1IX9A 2ZR2A 1WP8A 3OUSA 1KYOF 2X6BA 4MW3A 1XEQA 1WPXA 5EBWC 4BIOA 3A2FA 4B3SO 3JD3A 3E8FA 4YJ3A 4ZIBA 1HR0B 2XOKG 2EZOA 4ABMA 4UVBA 4Q20A 4LFCO 4NTYA 5J2UA 3UQ8A 5IJ0A 4LF5B 2YEVB 1MMMA 1WLEA 1Y6XA 3H1HH 3PJSK 3VQXA 3OD4A 1OCRB 2CH7B 1BQZA 1R3KC 2DE0X 2Q7HA 1AROP 3P30A 1M1KW 3K0DA 1QLEB 4O2AA 4HNAB 4YXWG 2YS8A 2P7TC 4CS4A 2KSDA 1GAXA 1OCOC 4FPPA 1H38A 4FM2A 5DECA 2Y4UA 2A7WA 2WLNA 1S0VA 3DC5A 1D2DA 2VWKA 1CP9A 1IURA 1QHTA 1Y76B 2ADQB 3UCSC 3SYPA 4RQEA 5FL7G 1COWG 5FLXN 3AK2A 2PTMA 4U7OA 1FXKB 2WLMA 2EINC 4WFEA 3BPZA 2H8PC 2UUCB 1XUQA 5KUKA 4TUYA 1XL6A 2AZ2A 4DR6B 5AG2A 5BR8B 1JPXA 2QWOB 4UVCA 4FLYA 1K5SA 5EYPA 2K9PA 1RSOA 2CE4A 4J41A 3P3NA 4H13B 5A9GA 4LF6O 1NI8A 4MVRA 4ICGA 3CRMA 1FPOA 3DTUB 2Y0PA 2ZNJA 1HNWO 3J80N 1S5JA 3LSUA 2YI8A 3JD4A 1M57B 3CCEV 4KUMA 4PA9A 5E79Z 4N23A 1NR7A 1GMGA 3F5TA 1OHHG 2GV9A 2YUAA 3E89A 4FM1A 1SQGA 3CHXA 4IYIA 1L0NH 3JAWB 1S5LZ 2OYQA 4MVQA 4JV5B 1XDCA 2WLIA 2QM8A 4LF7O 1NKDA 2GBOA 5KA5A 2Y0IA 1XREA 5E1AC 3HKEB 5IE9A 5C8YB 1GTOA 2Y69C 3TCUA 5KAFZ 1YIJV 5IYBO 2KG7A 5EZYB 4JAAA 4U3JA 4MT8A 2F43G 1I08A 1H2SB 1K4CC 3LSQA 2A9HA 3SJBC 5J9PC 3E2EA 2CGNA 5LXTB 2Q69A 4MVSA 2MW2B 2X0LA 5B5EZ 2JJ2G 1VP7A 2E5LO 4ZOLA 1ENVA 5KHHA 4DV5B 4IGGA 3CEIA 4PA6A 1B6QA 1Y4MA 5CBHA 4JTCB 1MZEA 1WB7A 2JDIG 1MZFA 3H9VA 4DR3O 4DV3B 1WA8A 1OZ0A 3E35A 2E76B 1BSMA 2W0FC 1GN2A 3STZC 4K0KB 5BMVB 1SETA 4K3AA 1J5EB 5KHKA 4JI3O 1KC8W 2UUBB 1VQOV 4X1IA 3L72H 3T2MA 3FB6C 4EFEA 1SS3A 4JI6B 5LYJA 4DV2B 3ZRSA 2BE3A 4JI1O 2F4VO 4D7SA 5B1OA 4EFBA 3LUTB 1I5YA 4H33A 2OWOA 2EJ7A 3IC9A 4F4LA 3CX5F 4O4IA 1F4MA 1Z5WA 1FS0G 4GX5A 5JVDB 5JH7B 2Y4TA 3ABLC 2JGUA 1I94O 1EN5A 1E1QG 1SRYA 5BY1A 1HDJA 2P4KA 4TOIA 3RYFA 2FL4A 1FYJA 2JK5C 5A2QN 4NTXA 3ZMVA 1IXMA 1PL4A 3SPJA 1THZA 2OCCC 4DR2B 2Q4PA 3CXHF 4DW1A 4G28B 2DYSC 2P67A 3LSSA 1FJGB 5C93A 2L6LA 1DF4A 3W7SA 1NZ6A 2A06H 1YJWV 3F7YC 3OR7C 1LUWA 2QSAA 5FNVA 5LGTA 3G71V 1KU9A 2FTKA 2XHBA 4JPRA 4MVOA 2AHZA 2CTRA 2P22C 4AQYB 3CMEV 5LMUB 3AG1B 1NH2D 2ATKC 1P49A 5EK0A 2IU0A 1JOYA 3EVKA 1EN4A 4LP8A 3FAVB 3KCXA 1Q90D 1DLBA 1R6TA 2YXYA 1Y66A 2OCHA 3WB0A 1Q82W 1MSDA 1SQFA 2ZIMA 4LR3A 3TK1A 2HHHB 3N2KA 4Z1MG 4ZKIA 1VARA 3ZHRA 1PP9H 2FYUH 2L35A 4LF9B 1XMOB 2E3CA 1VF5B 1N32B 1MSWD 3GVMA 4HZ3A 4LBEC 2OTLV 5KLVH 2DJVA 1HNXO 4LFBO 2HEPA 1HNZB 1DTOA 3UO2A 3ZN1A 2CTWA 2BTQA 1IVSA 4UV8A 3ZMSA 2KB1A 4QJFB 2R72A 1XHXA 3ML0A 4DR1O 4B3TB 3AG4C 4LF8B 2ZR3A 2DOSA 3SJAC 3OGIB 1M56B 1US6A 2Q68A 3ZRWA 3VQYA 2EIMC 2UXDB 2ETNA 3L70H 4UCSA 4NR1A 1NTKH 4X62B 2WPDG 4X9QA 1QCEA 2OIGA 2QKAA 4JI8B 4X1KA 1OJHA 2UUAB 4O2BA 4UUJC 3S3WA 2AW9A 3OM3B 2WLJA 3ASNC 2NNUA 4GCZA 5IJ9B 3ETQA 4PI0A 2O57A 3SYCA 3JAKB 3T4ZA 1W0KG 4DV0B 1H2KA 3K5OA 3DXRB 4I50B 3T1CA 3LDDA 2WLLB 2OT5A 2QKCA 2RN9A 1G4YB 3L74H 4O4JB 2CK3G 1KQSU 1TUBB 2R9AA 1V55C 2RDCA 3RW0A 5LA6A 2EULA 2AXTZ 1K8AW 2W6JG 3JASA 1R1BA 5CBGA 3ASOB 1KKCA 2CTPA 3CCMV 2HG5C 2DWEC 4BIZA 4DV6B 2QM4A 3D3QA 3UO3A 5B3SC 3ABKB 2CDYA 1U96A 3M99B 3T1HB 3U0ZA 5CA1B 5KUMA 1IBKB 3T1YB 1AI6A 5JWPA 2DW4A 1QBZA 2DQ0A 1QVGU 5B66Z 3W7WA 3QO7A 3ZHTA 1FFXB 4NYKA 3X2QC 3Q4HA 3OTOB 4B3MB 4HYOA 3ZHVA 4X1YB 3W7TA 3CJHA 3MHHC 4RO2A 3ZIAG 4P30A 1VQ5V 2ZM6O 1WJZA 1GM8A 4HAMA 3TXSA 2N74A 1TAEA 2Q0OC 2JGDB 4JASA 4JZGA 2LO1A 4EB6A 1VQKV 2ITCC 2HJFC 4DV7O 4DO2A 1N0NA 5JQGB 1YDXA 5L3CA 2BSKA 1SKVA 2EILB 1VF7A 2GUZB 1V9PA 3JD0A 4J9YB 4JTDB 1HWYA 1FXHA 4CH3A 2Q67A 1OCRC 1Q6HA 3ZMZA 2Q5ZA 3QO8A 1YJ9V 3R65A 2ZXWB 1K5QA 3RN4A 4F6RA 4PELA 1QLEC 3UT5A 4BR6A 4X89A 2YC0A 3L71H 2DYRB 2QWRB 1F23A 4CH6A 1SQPH 3CYOA 1MOFA 1AI7A 1SQBH 4PDLA 4DXWA 1Q8IA 1EZVH 2UXCO 1BS3A 2B1IA 5B1AC 4YHHO 3J7AU 1FXKC 1IDSA 1CPYA 3RT3C 1J95A 1AILA 1PL0A 3CRCA 5IWAO 1Q5OA 2LW7A 3L73H 1VQNV 1ZUQA 2WLHA 4J42A 1EZJA 3CSXA 2QE7G 4TV8B 1S3JA 4PA4A 1ORQC 3ABTA 3AG2C 3C3TA 3EHBB 4PD4F 2EIKC 2KQXA 1TVKB 4GX0A 1YHQV 2PY5A 2UXBB 4MS2A 2Q0AA 4PI2A 3B4SA 2OIEA 1WPBA 4JI4B 3M7MX 2XASA 4G2KA 2YEVA 2CGOA 3L75H 1AR5A 1OV9A 2CAZC 1SQQH 1DGSA 5GTHZ 2CH7A 3HB3B 4GX1A 1FKAO 2NN4A 3E86A 3CC2V 2HVKC 4GKKB 1F51A 1P7BA 3HKBB 3STLC 4FLZA 1VQ7V 2ZQMA 1F7YA 4LF6B 2GDSA 2Z3YA 4QE9A 3VQWA 2Q6AA 4UVAA 4UCOA 3BAAA 1SZTA 4FZ0A 3ZMUA 2IJKA 1Y76A 1ZL8B 3DC6A 5L3BA 3J81N 4FVMA 3BEHA 3RWRD 2PYLA 3A8TA 1ZX3A 4TT3G 1FXKA 5KX5B 4DV1O 3FB5C 4AI8A 3WU2Z 4JYYA 2QWQB 2H3OA 2ILMA 4FK5C 5LMNO 5LGNA 1O9GA 2B1GA 1JX9A 4DV4O 3FYEB 3RBZA 1XNQO 3ZRXA 1BHAA
chains in the Genus database with same CATH topology
2UUBB 4X1IA 3N2KB 3RYHA 1I7FA 1N34B 1M4UA 4DRXB 4O4HA 4B3SB 3QG5A 4EFEA 2QJ1A 2Q7GA 3JALB 1SA0B 4JI6B 4DR7B 5LYJA 4DV2B 5GONB 4LFCB 4D7SA 4EFBA 4DUZB 4LH6A 4I4TB 2BTQB 4L8JA 2UU9B 2OWOA 2R70A 2PYJA 4TV8A 5KHGA 4FM0A 2ZM6B 4O4IA 1Z5WA 5LP6B 5JVDB 5JH7B 2E5LB 3ICXA 2JGUA 3RYCB 4UFZA 3BA9A 4X20B 4WBNA 2YIBD 4KHPB 1XQ8A 1TVKA 4TOIA 3RYFA 4ZHQB 4BW9A 4DR5B 3JAWA 3SGIA 4DV7B 5JJEB 1TA8A 2YIAA 3THOA 5LOVA 4DV1B 3MAQA 5K1PA 4O4LB 3K5NA 4DR2B 3HKEA 4X1KB 5C8YA 4JI3B 4IIJA 1FJGB 4FFBB 4O2BB 5EZYA 5J2TB 3HKBA 4FLTA 4ZI7B 5CA0B 1WN7A 5FNVA 5LXTA 4EEQA 4NVPA 4UCTA 1KU9A 3IAYA 5KMGB 2XHBA 3JARB 4X64B 3HKCB 2P22C 4AQYB 4UCRA 5LMUB 2YI9A 4X66B 3JSNA 4OX9B 5KX5A 4YHHB 1P49A 4UCUA 5FPRA 4FLVA 3JSLA 3K57A 4HNAA 4GLXA 3JATB 5IWAB 2JS5A 4B08A 5LA6B 1HNWB 2PUSA 3JASB 4CC5A 3WB0A 5BMVA 1SQFA 2PGGA 3DSQA 2ZIMA 4LR3A 2HHHB 4DR4B 4FLXA 3K5LA 3RYIB 3N2KA 2Q7EA 3FFQA 4DRXA 2KKWA 4LF9B 1XMOB 2E3CA 1N32B 1QQCA 3SJCC 4NXNB 4IHJB 3JALA 1SA0A 1Q43A 4CS2A 5GONA 1JFFB 5EIBD 2HEPA 1HNZB 4I4TA 2BTQA 4K8XA 4LF7B 3WB2A 2R72A 4YJ3B 1KMIZ 1XHXA 5LP6A 4LF4B 5JVDA 4CH5A 5JH7A 4B3TB 5KHJA 3RYCA 4LF8B 5J2UB 4X20A 5IJ0B 5ITZB 3SJAC 4ZHQA 4CH4A 1WNSA 3VQYA 2ZINA 5JCOA 2UXDB 4UCSA 3OTFA 1X4TA 1T5EA 4X65B 4NXMB 2EX3A 4X62B 1B04A 5KHIA 4O4LA 5FPOA 4EB6B 5JJNB 3BRCA 1XHZA 3PN1A 4JI8B 4X1KA 1TGOA 2UUAB 1IBLB 4O2AB 4I9QA 4GYCB 3U10A 4FFBA 4O2BA 4TV9B 4DK1A 5D5QA 2RQ6A 5J2TA 3K59A 2VQFB 4CS3A 4ZI7A 3QTCA 4DR3B 5CA0A 5IJ9B 4JI5B 3ETQA 4PI0A 5D5PA 4JYAB 3JAKB 5LMNB 1HNXB 4LFBB 3HKDB 4DV0B 5KMGA 1JMKC 4F6RB 3JARA 3K5OA 1Z5VA 2RJZA 4DV4B 5LP6C 4I50B 3UT5B 3HKCA 1XNQB 1IBMB 3BABA 2VWJA 4AILC 2BTOA 1M5IA 1JJOA 4O4JB 4TUYB 4D7TA 1TUBB 3B2EE 2R9AA 5JCOC 4FLWA 3JATA 4GKJB 5EYPB 5LA6A 1O9HA 2VQEB 4TQDA 1XMQB 3JASA 4KL1A 4JI1B 4CC6A 2F4VB 2F1MA 2F93B 1D5AA 3BHPA 4FLUA 4DV6B 2QM4A 1I94B 5CB4B 2YIBA 4YY3B 5IYZB 4IHJA 4LNUB 3T1HB 3U0ZA 1JFFA 5CA1B 1IBKB 3A2FA 3T1YB 4AHCA 1N33B 4YJ3A 1FFXB 4ZIBA 1HR0B 3OTOB 1XNRB 4B3MB 1NT2B 5J2UA 4X1YB 3N2GB 3UQ8A 5IJ0A 5ITZA 4LF5B 3K58A 4PHZA 3VQXA 4I55B 1TAEA 3LNNA 4EB6A 2Q7HA 5JJJB 4DUYB 2ZCEA 4U3JB 5JQGB 3U11A 4O2AA 4HNAB 1SKVA 4CS4A 4TV9A 1VF7A 1V9PA 4FM2A 4JI2B 4YJ2B 4UCVA 2VWKA 4CH3A 1QHTA 5IJ9A 4ZOLB 3VQVA 1XI1A 1G6UA 1M93A 3JAKA 3HKDA 2PTMA 4F6RA 3CB2A 4I50A 3UT5A 3BPZA 3RGBA 2UUCB 3WB1A 4JI0B 4CH6A 4O4JA 3E22B 4TUYA 4DR6B 1TUBA 5BR8B 1Q8IA 3ZS8C 2PZSA 4FLYA 4HBNA 5EYPA 1RSOA 5K1XA 4X1IB 3RYHB 3RFRA 4O4HB 4DK0A 1ZAUA 2F66C 1Q5OA 3SR2C 3QF7A 2ZNJA 5LYJB 4DR1B 1S5JA 2ZNIA 1Q3EA 4BWAA 5CB4A 2YI8A 5IYZA 2V4DA 3CSXA 4LNUA 4TV8B 4O4IB 5CA1A 3BA8A 4WBNB 2GV9A 4FM1A 1SQGA 3CHXA 1TVKB 3RYFB 3RYIA 1FFXA 3JAWB 2F95B 2OYQA 2PY5A 2UXBB 5LOVB 2Q0AA 4PI2A 4JV5B 1WPBA 3N2GA 4TQFA 3M7MX 4X1YA 4JI4B 2ZIOA 4B3RB 2CAZC 3HKEB 1DGSA 4I55A 5EIBC 2UXCB 5C8YB 4GKKB 4JI7B 4IIJB 2IM9A 5EZYB 1N36B 3HKBB 4U3JA 5JQGA 4FLZA 2YXLA 4LF6B 1H2SB 3VQWA 3SJBC 5FNVB 5LXTB 4UCOA 4YJ2A 3BAAA 4K8ZA 4Q6GA 4ZOLA 4LFAB 2JVDA 1YEWA 5KHHA 4DV5B 4FVMA 3RWRD 2PYLA 5KX5B 4DV3B 3E22A 1O9GA 1L8DA 3K5MA 4K0KB 5BMVB 4LH7A 2P5OA 1J5EB 5KHKA 3ZEDA 1HW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P22 C;  2F66 C;  3QF7 A;  3SJC C;  3SJA C;  3THO A;  1X4T A;  3B2E E;  3SJB C;  3CSX A;  1SKV A;  2CAZ C;  2JS5 A;  1NT2 B;  3ICX A;  3QG5 A;  3ZS8 C; 
#chains in the Genus database with same CATH topology
 3O65 A;  3TGU H;  2XAG A;  1I7F A;  4JF3 A;  1N34 B;  2NR5 A;  4J7Z A;  1D5N A;  4GKJ O;  4DR7 B;  1XMQ O;  3CE2 A;  3SJQ C;  4CBC A;  4DUZ B;  4LH6 A;  4I4T B;  3ETE A;  2UU9 B;  1URF A;  2RCV A;  2PYJ A;  4JTA B;  5LP6 B;  1R3I C;  2DMX A;  2E5L B;  4UFZ A;  2ADP A;  4X20 B;  2YIB D;  4KHP B;  4UB6 Z;  3FD9 A;  4ZHQ B;  3JAW A;  2YIA A;  3D8C A;  2IBZ H;  2JRI A;  3BFR A;  4O4L B;  3K5N A;  3D3I A;  3I5D A;  1HR0 O;  3HKE A;  5EC2 C;  4GUN A;  4BW5 A;  5C8Y A;  4JI3 B;  2YXH A;  4FFB B;  4LF5 O;  5EZY A;  5J2T B;  4DW0 A;  4ZI7 B;  3VBB A;  3QNE A;  5L3E A;  5LXT A;  2C2A A;  1BE3 H;  3GB7 C;  3JAR B;  4LF4 O;  2QKS A;  4X64 B;  3ZMT A;  1JJ2 U;  1YJN V;  4X66 B;  3C3S A;  4OX9 B;  4UCU A;  1NTM H;  2LFS A;  1Y74 B;  3CRA A;  3JAT B;  4X65 O;  4NXM O;  2PUS A;  5CBF A;  5BMV A;  1SC5 B;  1IBL O;  4MW8 A;  1QVF U;  5H6Q A;  3DSQ A;  4P9O A;  4DR4 B;  4FLX A;  3CC4 V;  1K9M W;  5B1B B;  4DR6 O;  3FFQ A;  5BR8 O;  2KKW A;  1QQC A;  4JI5 O;  4LCU C;  5IYD O;  1NVP B;  4RUF A;  4RWU A;  1GM7 A;  4IHJ B;  4NXN B;  3WFV A;  1VQL V;  1Z2G A;  1JFF B;  1P84 F;  5EIB D;  2G38 A;  4E2L A;  1XBL A;  4EKW A;  1XL4 A;  3WB2 A;  2RMK B;  2Q8V A;  3ZHQ A;  4GT1 A;  2LJ2 A;  2JEU A;  4J11 A;  2EIN B;  5JVD A;  4CH5 A;  3QO5 A;  5JH7 A;  2EBO A;  2QWP B;  4IL6 Z;  5ITZ B;  2VQE O;  1AI4 A;  1WNS A;  1RM1 B;  3ZHU A;  3OTF A;  1X4T A;  1T5E A;  5JJN B;  2ITD C;  3ETG A;  3DGE A;  1R6N A;  5H6R A;  5LHI A;  2AHY A;  2GSM B;  1YF2 A;  2JEX A;  4JV5 O;  3K9S A;  3U10 A;  4TV9 B;  4DK1 A;  5D5Q A;  4YY3 O;  2VQF B;  1H2G A;  1Q86 W;  1Q6U A;  3QTC A;  2LP7 A;  3TET A;  1N33 O;  5IY5 B;  1HNX B;  4LFB B;  3HKD B;  3UM7 A;  1JMK C;  1SQX H;  1XNR O;  2RJZ A;  4PJ0 Z;  1IBM B;  3BAB A;  2XAH A;  4AIL C;  3H1K H;  2BTO A;  2ZD9 A;  1K92 A;  1S72 V;  3K06 A;  1V54 B;  3FAV A;  3QVN A;  3ZJZ A;  4DV5 O;  4PV1 B;  1O9H A;  4I0X B;  4TQD A;  3CCQ V;  2MK3 A;  1GK9 A;  2FML A;  5EC1 C;  1MG1 A;  2EJR A;  4DV3 O;  2Y69 B;  2BOB C;  5DED A;  3LDE A;  3BHP A;  3G67 A;  4ASU G;  4WFF A;  1H2M A;  3HR0 A;  3AK3 A;  4K0K O;  4N21 A;  1N0J A;  2BOC C;  5CB4 B;  2YIB A;  1QR8 A;  5H2F Z;  1KP3 A;  5IYZ B;  4UXN A;  4LNU B;  2EIJ B;  1H2N A;  4J10 A;  3CWB H;  4KXR A;  1MAB G;  2WLK A;  4AHC A;  1NQT A;  4JI0 O;  4JI6 O;  3AG3 C;  4DV2 O;  2P4V A;  1NT2 B;  3N2G B;  3ABK C;  2IH3 C;  2QGN A;  3K58 A;  4XDL A;  1VQ9 V;  1FAF A;  1OCC C;  4PHZ A;  3ABM C;  4I55 B;  5L3D A;  4WFH A;  5IYC O;  3BCC H;  4DUY B;  1AJP A;  2IJH A;  3U11 A;  1AB3 A;  1PNM A;  3K08 A;  5KAI Z;  4TSF G;  2WA3 A;  4JI2 B;  1B06 A;  4YJ2 B;  1I5X A;  4UCV A;  1AR1 B;  1LUV A;  5IJ9 A;  4K35 A;  1XI1 A;  1G6U A;  3EFF K;  3JAK A;  3JYC A;  3LNM B;  3ABL B;  3DXR A;  4I50 A;  1AJQ A;  3CCL V;  3RGB A;  1VQ6 V;  2EIL C;  2WLL A;  3WB1 A;  4O4J A;  2GHY A;  3E22 B;  4CZZ A;  1EM1 A;  4B3R O;  1TUB A;  2PZS A;  4JI7 O;  4AQY O;  2V7Q G;  2OCC B;  5GW7 A;  3ZN0 A;  5LMU O;  2ZE6 A;  2VRZ A;  2ZXW C;  1F4N A;  2DYS B;  3OMI B;  3RYH B;  3F5W C;  4YIP A;  1GKF A;  3RFR A;  2ZDI A;  4O4H B;  1GM9 A;  2DYR C;  1CEZ A;  1EBO A;  2ZNI A;  1BGY H;  4BWA A;  1JA8 A;  3OFN G;  4ZBM A;  2V4D A;  3KCY A;  3BVO A;  5H5N A;  2HHH O;  1WB8 A;  4FJC C;  5CA1 A;  3BA8 A;  5L3G A;  4MVM A;  4LF9 O;  1XMO O;  4WBN B;  1N32 O;  3ZCC A;  5LL6 Y;  2EZP A;  2XAJ A;  3RYI A;  1FFX A;  3MDS A;  5LOV B;  4H44 B;  4LWS B;  2R9R B;  4X1Y A;  4TQF A;  1HNZ O;  1ZTE A;  3WG7 B;  1BL8 A;  4G27 B;  4RUE A;  1H2L A;  2HKO A;  2JS3 A;  1VIB A;  4B3T O;  2UXC B;  2JGD A;  4LF8 O;  2NLJ C;  4IIJ B;  5KA6 A;  4NB5 A;  1N36 B;  5JQG A;  2IW5 A;  2YXL A;  2UXD O;  5CMU A;  2GUZ A;  4X62 O;  4K8Z A;  3CCS V;  4JI8 O;  2UUA O;  1JQ0 A;  4R7C A;  4Q6G A;  4LFA B;  2X7R B;  1RP3 B;  1K73 W;  2Z0A A;  4FIP C;  4IYH A;  4DR5 O;  4QPK A;  3AG4 B;  5LGU A;  1LNQ A;  2QDO A;  4R8C A;  2M6Y A;  4P9P A;  1VQ4 V;  3K5M A;  1K7D A;  2P5O A;  2IH1 C;  1FD9 A;  4FZ1 A;  3ZED A;  5EBM C;  4Z2W A;  1HW7 A;  3Q4H B;  2PI4 A;  1ZWI C;  4GX2 A;  3JAM N;  4DRX B;  3G4S V;  4QNH B;  4B3S B;  1R6K A;  3QG5 A;  1GRJ A;  3CCU V;  2IJJ A;  3JAL B;  1SA0 B;  3CD6 V;  2K1E A;  5GON B;  1NBM G;  4LFC B;  3ASN B;  3IGA C;  1K97 A;  2R70 A;  2PF4 E;  4TV8 A;  5KHG A;  4FM0 A;  1KBH A;  3CRR A;  4DV6 O;  3E83 A;  3SDL A;  1PNL A;  3RYC B;  1NVP D;  1TVK A;  1AP6 A;  2A79 B;  3K04 A;  4C7U A;  5H9C A;  4LC1 A;  2QWN B;  1W2B U;  5JJE B;  1TA8 A;  3TJT A;  2D3O W;  4DV1 B;  3A0B Z;  1OCZ B;  3SPH A;  1IBK O;  1V55 B;  3EXA A;  1EFR G;  2XTA A;  5K1P A;  3T1Y O;  3JD2 A;  1VF6 A;  1YTF B;  3OTO O;  1VEW A;  2RNB A;  2IJI A;  3SYA A;  2QM7 A;  4B3M O;  3APQ A;  3CPW U;  3AEI A;  3HKB A;  1KB9 F;  3A0H Z;  5CA0 B;  1WN7 A;  1WP7 A;  5IT9 N;  2M7W A;  3KKY A;  4UCT A;  1M57 C;  5KMG B;  1YIT V;  3SPG A;  2Q9L A;  1ZL8 A;  3HKC B;  4X88 A;  3O9O A;  3X2Q B;  2YI9 A;  1P7G A;  3CCJ V;  1IXB A;  3JSN A;  1L0L H;  5KX5 A;  4FLV A;  1RPO A;  2HVJ C;  3JSL A;  4I7Z B;  3I56 V;  3K57 A;  4HNA A;  4W4L A;  4GLX A;  1KKD A;  4PA3 A;  3CMA V;  1SES A;  2A3Q A;  2XND G;  1HNW B;  2DQ3 A;  3N27 A;  1GN4 A;  3OW2 U;  1W0J G;  1VQP V;  4MSW C;  3F7V C;  3M8A A;  4L87 A;  1PNK A;  3K5L A;  2YDE A;  4QE7 A;  2VS0 A;  4PDM A;  1Q7Y W;  4PDR A;  2B9Z A;  3GWK C;  4JYA O;  1Q43 A;  4OGQ B;  2HFE C;  1M90 W;  1AP5 A;  4I4T A;  1S77 D;  4LF7 B;  2Z5U A;  3ETD A;  2LGQ A;  4YJ3 B;  1KMI Z;  4FMT A;  5LP6 A;  4LF4 B;  1P4R A;  1FXV A;  5B1B C;  5CA3 A;  5KHJ A;  5EBL C;  5J2U B;  4X20 A;  5IJ0 B;  4ZHQ A;  2ZIN A;  2D2C B;  5JCO A;  3W7X A;  3OMN B;  3CXC U;  1VQ8 V;  4X65 B;  4NXM B;  1PM9 A;  5KHI A;  4O4L A;  5B1A B;  2ZKO A;  1XHZ A;  2QR4 A;  1I0H A;  2UXB O;  1IBL B;  4O2A B;  1YVW A;  1KEC A;  1PD3 A;  4JI4 O;  4FFB A;  1XOU A;  4R6Z A;  3SPC A;  5J2T A;  3K59 A;  3IC7 A;  4CS3 A;  1RM1 C;  4ZI7 A;  2FB5 A;  4DR3 B;  4JI5 B;  3D36 C;  4GKK O;  1L1F A;  5D5P A;  2Y48 A;  3G6B A;  2QA4 V;  3AG2 B;  3JAR A;  2EIK B;  3S3X A;  4Z1V A;  2VWJ A;  2CUG A;  4QGP A;  1JJO A;  4B7E A;  4TUY B;  2GTS A;  3ZBH A;  1Y74 A;  3H1J H;  4FLW A;  3K79 A;  5LHH A;  3JAT A;  5EYP B;  2VQE B;  1RSO B;  2P06 A;  5IY5 C;  4JI1 B;  4CC6 A;  2F4V B;  1GO3 F;  3ZRV A;  5B1N A;  4X8A A;  2F93 B;  4FLU A;  3MHS C;  1I94 B;  1WAZ A;  3AK1 A;  1V54 C;  4YY3 B;  4IHJ A;  2ARH A;  1JFF A;  3VOU A;  1IZ3 A;  4I9W A;  1N34 O;  4J7J A;  1QU7 A;  1UJW B;  2XAF A;  3C90 A;  1GN6 A;  2UUC O;  1N33 B;  3NR7 A;  3SYO A;  4DR7 O;  3JCU Z;  1XNR B;  3AG1 C;  3H1L H;  4U7N A;  4JGS A;  4WFA V;  3H01 A;  1PPJ H;  4QPJ A;  4DUZ O;  1OCO B;  5ITZ A;  2WLI B;  3H1I H;  2UU9 O;  2EIJ C;  1YI2 V;  1R73 A;  3D36 A;  3LNN A;  4KHP O;  4B7K A;  3B40 A;  1MA1 A;  5JJJ B;  2KG7 B;  1JVM A;  4NTW A;  2ZCE A;  4U3J B;  2WA4 A;  5LBQ A;  3AG7 A;  3RVY A;  5BZB A;  4TV9 A;  2JIZ G;  2WAM A;  1K3E A;  1BHB A;  3B09 A;  1JCH A;  1UPG A;  2P90 A;  1G1X B;  2QTO A;  1VMG A;  4ZOL B;  3VQV A;  5DN6 G;  1YXB A;  1RFY A;  4MVZ A;  3E8B A;  1M93 A;  1TUE B;  3HKD A;  3B77 A;  3CB2 A;  4MTX A;  4PA7 A;  1WA8 B;  2QTS A;  2DWD C;  3TXQ A;  1PV0 A;  4JI0 B;  1GN3 A;  1W59 A;  3B8N A;  1M56 C;  3ZS8 C;  1NS1 A;  4X64 O;  4HBN A;  1K34 A;  2X6A A;  1BT8 A;  2N04 A;  5K1X A;  4I0X A;  1H8H G;  2E75 B;  4X1I B;  4X66 O;  2V1D A;  4OX9 O;  3JCZ A;  2W6I G;  4D6T H;  4DK0 A;  1ZAU A;  1ZSP A;  2F66 C;  3ABU A;  3SR2 C;  4W4K A;  3QF7 A;  2QEX V;  2P6J A;  5LYJ B;  4DR1 B;  2IU3 A;  1Q3E A;  5CB4 A;  3NXS A;  4XDJ A;  5IYZ A;  4XDK A;  1LR1 A;  4DR4 O;  4LNU A;  4O4I B;  3RYF B;  4NXN O;  2F95 B;  4OPA A;  2HP8 A;  1B3Q A;  3SPI A;  3N2G A;  1J5E O;  1NR1 A;  2WWW A;  1Q6I A;  2ZIO A;  2UUB O;  3GWO A;  4B3R B;  3W7U A;  4JYC A;  2LQT A;  4H0L B;  4I55 A;  5EIB C;  3ASO C;  1E1R G;  4E4E A;  4JI7 B;  2IM9 A;  2ZDI C;  3BY6 A;  1ROP A;  5TIS Z;  1KD1 W;  5FNV B;  3FB7 C;  3WG7 C;  2Q73 A;  1YTF D;  4YJ2 A;  2ZE7 A;  4A5U B;  2X6C A;  3APO A;  4PDV A;  2JVD A;  1S76 D;  4JAU A;  1YEW A;  1R3L C;  1UFI A;  3FKS G;  2R9I A;  4JAV A;  2VQF O;  2ZT9 B;  3KZI Z;  1SQV H;  3L9D A;  4F6E A;  3E22 A;  1BMF G;  4BIU A;  1L8D A;  1BQ0 A;  4DR2 O;  4LH7 A;  4DYL A;  3IFX A;  1IBM O;  1FJG O;  2OTJ V;  4I5S A;  3N2K B;  2YID A;  3RYH A;  4UB8 Z;  1M4U A;  4O4H A;  2ODM A;  4MTF A;  3CCV V;  1DK1 A;  2QJ1 A;  2Q7G A;  3CC7 V;  1KUQ A;  3OGC C;  5HFL A;  4U3F H;  3G6E V;  1Q81 W;  5L3F A;  2ZE5 A;  2BTQ B;  4L8J A;  5HFM A;  3KG2 A;  2WSS G;  2ZM6 B;  1G8M A;  3OMA B;  4KFM A;  3ICX A;  1BCC H;  3BA9 A;  4WBN A;  1R3J C;  3R66 A;  1XQ8 A;  3K9A A;  4DR5 B;  4BW9 A;  3SGI A;  2HJD A;  4DV7 B;  4MVU A;  3ZRW B;  5DM6 V;  3THO A;  5LOV A;  1SER A;  3OEE G;  4LWS A;  1PKX A;  3MAQ A;  3K03 A;  4OPH A;  1U97 A;  1KP2 A;  1M9N A;  1MNG A;  1SZX A;  4TWK A;  4NKG B;  1DF5 A;  2HR3 A;  4X1K B;  1AI5 A;  3K0G A;  5F2V O;  4IIJ A;  4O2B B;  1XIL A;  1Y67 A;  1QLN A;  3HPL C;  3P3P A;  4FLT A;  4J9Z B;  1AJN A;  1OCZ C;  5IDJ A;  1GH6 A;  1N4C A;  4WCE V;  1NJI W;  4EEQ A;  2AGA A;  2JJ1 G;  4NVP A;  4DUY O;  3IAY A;  2E74 B;  4BAY A;  3B8M A;  4H37 A;  2YSU B;  2AZ0 A;  4UCR A;  3FYI B;  3AG3 B;  4JI2 O;  4RAI A;  4YHH B;  5FPR A;  5GTI Z;  3A0R A;  1QNM A;  1H8E G;  1JR9 A;  5IWA B;  2LFR A;  2UXX A;  2JS5 A;  4B08 A;  3T4D A;  1QR9 A;  5LA6 B;  3SYQ A;  1K33 A;  1OCC B;  3K3W A;  4KP4 A;  1VF6 C;  4RQF A;  3ABM B;  3JAS B;  3CP1 A;  4CC5 A;  4JYB A;  2PGG A;  3E8G A;  3FX7 A;  1N8R W;  3IJ4 A;  2HLD G;  1A32 A;  3RYI B;  4MTO A;  2Q7E A;  4DRX A;  2A0L A;  2UXN A;  4J80 A;  2BCC H;  4IT5 A;  3SJC C;  1YSC A;  3CS5 A;  3JAL A;  1SA0 A;  2LW1 A;  4CS2 A;  5GON A;  2EIM B;  2F23 A;  4DV0 O;  2CTQ A;  3MD0 A;  4K8X A;  1X59 A;  3OEH G;  2XT9 A;  1SF9 A;  3RYC A;  3UKM A;  3ZHS A;  1YZB A;  3CJH B;  4P2Z A;  3G80 A;  4CH4 A;  4OXS A;  2XAQ A;  3LDC A;  1E79 G;  2EX3 A;  1B04 A;  5FPO A;  4EB6 B;  1NU1 H;  2GTA A;  3BRC A;  3ZX6 A;  2N05 A;  5LHG A;  3PN1 A;  1TGO A;  4GZR B;  1S5H C;  4FFK A;  4QIW F;  4I9Q A;  5BXZ A;  1FFT B;  2BSK B;  2PI5 A;  4GYC B;  3OT7 A;  3OR6 C;  2RQ6 A;  1AVM A;  4YIO A;  5CN0 A;  3T1H O;  1NH2 B;  1VQM V;  1CXZ B;  3E8H A;  5CA0 A;  3CCR V;  3RVZ A;  4JYA B;  5LMN B;  4JZ2 A;  2XUM A;  3FB8 C;  3I55 V;  2YIC A;  2H94 A;  2W0X A;  1N36 O;  5KMG A;  4F6R B;  1Z5V A;  1YCI A;  4WFG A;  5LP6 C;  4DV4 B;  3UT5 B;  3HKC A;  1XNQ B;  2FKX A;  4WF9 V;  3P32 A;  1M5I A;  1NTZ H;  1ZLZ A;  3CRQ A;  5B3S B;  4D7T A;  3B2E E;  3OAA G;  2DN9 A;  5JCO C;  1HP8 A;  4GKJ B;  4LFA O;  1RPR A;  3OE7 G;  4R50 A;  1XMQ B;  1AR4 A;  3OUF A;  4KL1 A;  3JD1 A;  4WFB V;  1BZK A;  2F1M A;  2B5U A;  2LGW A;  1K4D C;  1D5A A;  1EN6 A;  4XBF A;  4J7K A;  4UV9 A;  2ZE8 A;  4MTG A;  1IX9 A;  2ZR2 A;  1WP8 A;  3OUS A;  1KYO F;  2X6B A;  4MW3 A;  1XEQ A;  1WPX A;  5EBW C;  4BIO A;  3A2F A;  4B3S O;  3JD3 A;  3E8F A;  4YJ3 A;  4ZIB A;  1HR0 B;  2XOK G;  2EZO A;  4ABM A;  4UVB A;  4Q20 A;  4LFC O;  4NTY A;  5J2U A;  3UQ8 A;  5IJ0 A;  4LF5 B;  2YEV B;  1MMM A;  1WLE A;  1Y6X A;  3H1H H;  3PJS K;  3VQX A;  3OD4 A;  1OCR B;  2CH7 B;  1BQZ A;  1R3K C;  2DE0 X;  2Q7H A;  1ARO P;  3P30 A;  1M1K W;  3K0D A;  1QLE B;  4O2A A;  4HNA B;  4YXW G;  2YS8 A;  2P7T C;  4CS4 A;  2KSD A;  1GAX A;  1OCO C;  4FPP A;  1H38 A;  4FM2 A;  5DEC A;  2Y4U A;  2A7W A;  2WLN A;  1S0V A;  3DC5 A;  1D2D A;  2VWK A;  1CP9 A;  1IUR A;  1QHT A;  1Y76 B;  2ADQ B;  3UCS C;  3SYP A;  4RQE A;  5FL7 G;  1COW G;  5FLX N;  3AK2 A;  2PTM A;  4U7O A;  1FXK B;  2WLM A;  2EIN C;  4WFE A;  3BPZ A;  2H8P C;  2UUC B;  1XUQ A;  5KUK A;  4TUY A;  1XL6 A;  2AZ2 A;  4DR6 B;  5AG2 A;  5BR8 B;  1JPX A;  2QWO B;  4UVC A;  4FLY A;  1K5S A;  5EYP A;  2K9P A;  1RSO A;  2CE4 A;  4J41 A;  3P3N A;  4H13 B;  5A9G A;  4LF6 O;  1NI8 A;  4MVR A;  4ICG A;  3CRM A;  1FPO A;  3DTU B;  2Y0P A;  2ZNJ A;  1HNW O;  3J80 N;  1S5J A;  3LSU A;  2YI8 A;  3JD4 A;  1M57 B;  3CCE V;  4KUM A;  4PA9 A;  5E79 Z;  4N23 A;  1NR7 A;  1GMG A;  3F5T A;  1OHH G;  2GV9 A;  2YUA A;  3E89 A;  4FM1 A;  1SQG A;  3CHX A;  4IYI A;  1L0N H;  3JAW B;  1S5L Z;  2OYQ A;  4MVQ A;  4JV5 B;  1XDC A;  2WLI A;  2QM8 A;  4LF7 O;  1NKD A;  2GBO A;  5KA5 A;  2Y0I A;  1XRE A;  5E1A C;  3HKE B;  5IE9 A;  5C8Y B;  1GTO A;  2Y69 C;  3TCU A;  5KAF Z;  1YIJ V;  5IYB O;  2KG7 A;  5EZY B;  4JAA A;  4U3J A;  4MT8 A;  2F43 G;  1I08 A;  1H2S B;  1K4C C;  3LSQ A;  2A9H A;  3SJB C;  5J9P C;  3E2E A;  2CGN A;  5LXT B;  2Q69 A;  4MVS A;  2MW2 B;  2X0L A;  5B5E Z;  2JJ2 G;  1VP7 A;  2E5L O;  4ZOL A;  1ENV A;  5KHH A;  4DV5 B;  4IGG A;  3CEI A;  4PA6 A;  1B6Q A;  1Y4M A;  5CBH A;  4JTC B;  1MZE A;  1WB7 A;  2JDI G;  1MZF A;  3H9V A;  4DR3 O;  4DV3 B;  1WA8 A;  1OZ0 A;  3E35 A;  2E76 B;  1BSM A;  2W0F C;  1GN2 A;  3STZ C;  4K0K B;  5BMV B;  1SET A;  4K3A A;  1J5E B;  5KHK A;  4JI3 O;  1KC8 W;  2UUB B;  1VQO V;  4X1I A;  3L72 H;  3T2M A;  3FB6 C;  4EFE A;  1SS3 A;  4JI6 B;  5LYJ A;  4DV2 B;  3ZRS A;  2BE3 A;  4JI1 O;  2F4V O;  4D7S A;  5B1O A;  4EFB A;  3LUT B;  1I5Y A;  4H33 A;  2OWO A;  2EJ7 A;  3IC9 A;  4F4L A;  3CX5 F;  4O4I A;  1F4M A;  1Z5W A;  1FS0 G;  4GX5 A;  5JVD B;  5JH7 B;  2Y4T A;  3ABL C;  2JGU A;  1I94 O;  1EN5 A;  1E1Q G;  1SRY A;  5BY1 A;  1HDJ A;  2P4K A;  4TOI A;  3RYF A;  2FL4 A;  1FYJ A;  2JK5 C;  5A2Q N;  4NTX A;  3ZMV A;  1IXM A;  1PL4 A;  3SPJ A;  1THZ A;  2OCC C;  4DR2 B;  2Q4P A;  3CXH F;  4DW1 A;  4G28 B;  2DYS C;  2P67 A;  3LSS A;  1FJG B;  5C93 A;  2L6L A;  1DF4 A;  3W7S A;  1NZ6 A;  2A06 H;  1YJW V;  3F7Y C;  3OR7 C;  1LUW A;  2QSA A;  5FNV A;  5LGT A;  3G71 V;  1KU9 A;  2FTK A;  2XHB A;  4JPR A;  4MVO A;  2AHZ A;  2CTR A;  2P22 C;  4AQY B;  3CME V;  5LMU B;  3AG1 B;  1NH2 D;  2ATK C;  1P49 A;  5EK0 A;  2IU0 A;  1JOY A;  3EVK A;  1EN4 A;  4LP8 A;  3FAV B;  3KCX A;  1Q90 D;  1DLB A;  1R6T A;  2YXY A;  1Y66 A;  2OCH A;  3WB0 A;  1Q82 W;  1MSD A;  1SQF A;  2ZIM A;  4LR3 A;  3TK1 A;  2HHH B;  3N2K A;  4Z1M G;  4ZKI A;  1VAR A;  3ZHR A;  1PP9 H;  2FYU H;  2L35 A;  4LF9 B;  1XMO B;  2E3C A;  1VF5 B;  1N32 B;  1MSW D;  3GVM A;  4HZ3 A;  4LBE C;  2OTL V;  5KLV H;  2DJV A;  1HNX O;  4LFB O;  2HEP A;  1HNZ B;  1DTO A;  3UO2 A;  3ZN1 A;  2CTW A;  2BTQ A;  1IVS A;  4UV8 A;  3ZMS A;  2KB1 A;  4QJF B;  2R72 A;  1XHX A;  3ML0 A;  4DR1 O;  4B3T B;  3AG4 C;  4LF8 B;  2ZR3 A;  2DOS A;  3SJA C;  3OGI B;  1M56 B;  1US6 A;  2Q68 A;  3ZRW A;  3VQY A;  2EIM C;  2UXD B;  2ETN A;  3L70 H;  4UCS A;  4NR1 A;  1NTK H;  4X62 B;  2WPD G;  4X9Q A;  1QCE A;  2OIG A;  2QKA A;  4JI8 B;  4X1K A;  1OJH A;  2UUA B;  4O2B A;  4UUJ C;  3S3W A;  2AW9 A;  3OM3 B;  2WLJ A;  3ASN C;  2NNU A;  4GCZ A;  5IJ9 B;  3ETQ A;  4PI0 A;  2O57 A;  3SYC A;  3JAK B;  3T4Z A;  1W0K G;  4DV0 B;  1H2K A;  3K5O A;  3DXR B;  4I50 B;  3T1C A;  3LDD A;  2WLL B;  2OT5 A;  2QKC A;  2RN9 A;  1G4Y B;  3L74 H;  4O4J B;  2CK3 G;  1KQS U;  1TUB B;  2R9A A;  1V55 C;  2RDC A;  3RW0 A;  5LA6 A;  2EUL A;  2AXT Z;  1K8A W;  2W6J G;  3JAS A;  1R1B A;  5CBG A;  3ASO B;  1KKC A;  2CTP A;  3CCM V;  2HG5 C;  2DWE C;  4BIZ A;  4DV6 B;  2QM4 A;  3D3Q A;  3UO3 A;  5B3S C;  3ABK B;  2CDY A;  1U96 A;  3M99 B;  3T1H B;  3U0Z A;  5CA1 B;  5KUM A;  1IBK B;  3T1Y B;  1AI6 A;  5JWP A;  2DW4 A;  1QBZ A;  2DQ0 A;  1QVG U;  5B66 Z;  3W7W A;  3QO7 A;  3ZHT A;  1FFX B;  4NYK A;  3X2Q C;  3Q4H A;  3OTO B;  4B3M B;  4HYO A;  3ZHV A;  4X1Y B;  3W7T A;  3CJH A;  3MHH C;  4RO2 A;  3ZIA G;  4P30 A;  1VQ5 V;  2ZM6 O;  1WJZ A;  1GM8 A;  4HAM A;  3TXS A;  2N74 A;  1TAE A;  2Q0O C;  2JGD B;  4JAS A;  4JZG A;  2LO1 A;  4EB6 A;  1VQK V;  2ITC C;  2HJF C;  4DV7 O;  4DO2 A;  1N0N A;  5JQG B;  1YDX A;  5L3C A;  2BSK A;  1SKV A;  2EIL B;  1VF7 A;  2GUZ B;  1V9P A;  3JD0 A;  4J9Y B;  4JTD B;  1HWY A;  1FXH A;  4CH3 A;  2Q67 A;  1OCR C;  1Q6H A;  3ZMZ A;  2Q5Z A;  3QO8 A;  1YJ9 V;  3R65 A;  2ZXW B;  1K5Q A;  3RN4 A;  4F6R A;  4PEL A;  1QLE C;  3UT5 A;  4BR6 A;  4X89 A;  2YC0 A;  3L71 H;  2DYR B;  2QWR B;  1F23 A;  4CH6 A;  1SQP H;  3CYO A;  1MOF A;  1AI7 A;  1SQB H;  4PDL A;  4DXW A;  1Q8I A;  1EZV H;  2UXC O;  1BS3 A;  2B1I A;  5B1A C;  4YHH O;  3J7A U;  1FXK C;  1IDS A;  1CPY A;  3RT3 C;  1J95 A;  1AIL A;  1PL0 A;  3CRC A;  5IWA O;  1Q5O A;  2LW7 A;  3L73 H;  1VQN V;  1ZUQ A;  2WLH A;  4J42 A;  1EZJ A;  3CSX A;  2QE7 G;  4TV8 B;  1S3J A;  4PA4 A;  1ORQ C;  3ABT A;  3AG2 C;  3C3T A;  3EHB B;  4PD4 F;  2EIK C;  2KQX A;  1TVK B;  4GX0 A;  1YHQ V;  2PY5 A;  2UXB B;  4MS2 A;  2Q0A A;  4PI2 A;  3B4S A;  2OIE A;  1WPB A;  4JI4 B;  3M7M X;  2XAS A;  4G2K A;  2YEV A;  2CGO A;  3L75 H;  1AR5 A;  1OV9 A;  2CAZ C;  1SQQ H;  1DGS A;  5GTH Z;  2CH7 A;  3HB3 B;  4GX1 A;  1FKA O;  2NN4 A;  3E86 A;  3CC2 V;  2HVK C;  4GKK B;  1F51 A;  1P7B A;  3HKB B;  3STL C;  4FLZ A;  1VQ7 V;  2ZQM A;  1F7Y A;  4LF6 B;  2GDS A;  2Z3Y A;  4QE9 A;  3VQW A;  2Q6A A;  4UVA A;  4UCO A;  3BAA A;  1SZT A;  4FZ0 A;  3ZMU A;  2IJK A;  1Y76 A;  1ZL8 B;  3DC6 A;  5L3B A;  3J81 N;  4FVM A;  3BEH A;  3RWR D;  2PYL A;  3A8T A;  1ZX3 A;  4TT3 G;  1FXK A;  5KX5 B;  4DV1 O;  3FB5 C;  4AI8 A;  3WU2 Z;  4JYY A;  2QWQ B;  2H3O A;  2ILM A;  4FK5 C;  5LMN O;  5LGN A;  1O9G A;  2B1G A;  1JX9 A;  4DV4 O;  3FYE B;  3RBZ A;  1XNQ O;  3ZRX A;  1BHA A; 
#chains in the Genus database with same CATH homology
 2UUB B;  4X1I A;  3N2K B;  3RYH A;  1I7F A;  1N34 B;  1M4U A;  4DRX B;  4O4H A;  4B3S B;  3QG5 A;  4EFE A;  2QJ1 A;  2Q7G A;  3JAL B;  1SA0 B;  4JI6 B;  4DR7 B;  5LYJ A;  4DV2 B;  5GON B;  4LFC B;  4D7S A;  4EFB A;  4DUZ B;  4LH6 A;  4I4T B;  2BTQ B;  4L8J A;  2UU9 B;  2OWO A;  2R70 A;  2PYJ A;  4TV8 A;  5KHG A;  4FM0 A;  2ZM6 B;  4O4I A;  1Z5W A;  5LP6 B;  5JVD B;  5JH7 B;  2E5L B;  3ICX A;  2JGU A;  3RYC B;  4UFZ A;  3BA9 A;  4X20 B;  4WBN A;  2YIB D;  4KHP B;  1XQ8 A;  1TVK A;  4TOI A;  3RYF A;  4ZHQ B;  4BW9 A;  4DR5 B;  3JAW A;  3SGI A;  4DV7 B;  5JJE B;  1TA8 A;  2YIA A;  3THO A;  5LOV A;  4DV1 B;  3MAQ A;  5K1P A;  4O4L B;  3K5N A;  4DR2 B;  3HKE A;  4X1K B;  5C8Y A;  4JI3 B;  4IIJ A;  1FJG B;  4FFB B;  4O2B B;  5EZY A;  5J2T B;  3HKB A;  4FLT A;  4ZI7 B;  5CA0 B;  1WN7 A;  5FNV A;  5LXT A;  4EEQ A;  4NVP A;  4UCT A;  1KU9 A;  3IAY A;  5KMG B;  2XHB A;  3JAR B;  4X64 B;  3HKC B;  2P22 C;  4AQY B;  4UCR A;  5LMU B;  2YI9 A;  4X66 B;  3JSN A;  4OX9 B;  5KX5 A;  4YHH B;  1P49 A;  4UCU A;  5FPR A;  4FLV A;  3JSL A;  3K57 A;  4HNA A;  4GLX A;  3JAT B;  5IWA B;  2JS5 A;  4B08 A;  5LA6 B;  1HNW B;  2PUS A;  3JAS B;  4CC5 A;  3WB0 A;  5BMV A;  1SQF A;  2PGG A;  3DSQ A;  2ZIM A;  4LR3 A;  2HHH B;  4DR4 B;  4FLX A;  3K5L A;  3RYI B;  3N2K A;  2Q7E A;  3FFQ A;  4DRX A;  2KKW A;  4LF9 B;  1XMO B;  2E3C A;  1N32 B;  1QQC A;  3SJC C;  4NXN B;  4IHJ B;  3JAL A;  1SA0 A;  1Q43 A;  4CS2 A;  5GON A;  1JFF B;  5EIB D;  2HEP A;  1HNZ B;  4I4T A;  2BTQ A;  4K8X A;  4LF7 B;  3WB2 A;  2R72 A;  4YJ3 B;  1KMI Z;  1XHX A;  5LP6 A;  4LF4 B;  5JVD A;  4CH5 A;  5JH7 A;  4B3T B;  5KHJ A;  3RYC A;  4LF8 B;  5J2U B;  4X20 A;  5IJ0 B;  5ITZ B;  3SJA C;  4ZHQ A;  4CH4 A;  1WNS A;  3VQY A;  2ZIN A;  5JCO A;  2UXD B;  4UCS A;  3OTF A;  1X4T A;  1T5E A;  4X65 B;  4NXM B;  2EX3 A;  4X62 B;  1B04 A;  5KHI A;  4O4L A;  5FPO A;  4EB6 B;  5JJN B;  3BRC A;  1XHZ A;  3PN1 A;  4JI8 B;  4X1K A;  1TGO A;  2UUA B;  1IBL B;  4O2A B;  4I9Q A;  4GYC B;  3U10 A;  4FFB A;  4O2B A;  4TV9 B;  4DK1 A;  5D5Q A;  2RQ6 A;  5J2T A;  3K59 A;  2VQF B;  4CS3 A;  4ZI7 A;  3QTC A;  4DR3 B;  5CA0 A;  5IJ9 B;  4JI5 B;  3ETQ A;  4PI0 A;  5D5P A;  4JYA B;  3JAK B;  5LMN B;  1HNX B;  4LFB B;  3HKD B;  4DV0 B;  5KMG A;  1JMK C;  4F6R B;  3JAR A;  3K5O A;  1Z5V A;  2RJZ A;  4DV4 B;  5LP6 C;  4I50 B;  3UT5 B;  3HKC A;  1XNQ B;  1IBM B;  3BAB A;  2VWJ A;  4AIL C;  2BTO A;  1M5I A;  1JJO A;  4O4J B;  4TUY B;  4D7T A;  1TUB B;  3B2E E;  2R9A A;  5JCO C;  4FLW A;  3JAT A;  4GKJ B;  5EYP B;  5LA6 A;  1O9H A;  2VQE B;  4TQD A;  1XMQ B;  3JAS A;  4KL1 A;  4JI1 B;  4CC6 A;  2F4V B;  2F1M A;  2F93 B;  1D5A A;  3BHP A;  4FLU A;  4DV6 B;  2QM4 A;  1I94 B;  5CB4 B;  2YIB A;  4YY3 B;  5IYZ B;  4IHJ A;  4LNU B;  3T1H B;  3U0Z A;  1JFF A;  5CA1 B;  1IBK B;  3A2F A;  3T1Y B;  4AHC A;  1N33 B;  4YJ3 A;  1FFX B;  4ZIB A;  1HR0 B;  3OTO B;  1XNR B;  4B3M B;  1NT2 B;  5J2U A;  4X1Y B;  3N2G B;  3UQ8 A;  5IJ0 A;  5ITZ A;  4LF5 B;  3K58 A;  4PHZ A;  3VQX A;  4I55 B;  1TAE A;  3LNN A;  4EB6 A;  2Q7H A;  5JJJ B;  4DUY B;  2ZCE A;  4U3J B;  5JQG B;  3U11 A;  4O2A A;  4HNA B;  1SKV A;  4CS4 A;  4TV9 A;  1VF7 A;  1V9P A;  4FM2 A;  4JI2 B;  4YJ2 B;  4UCV A;  2VWK A;  4CH3 A;  1QHT A;  5IJ9 A;  4ZOL B;  3VQV A;  1XI1 A;  1G6U A;  1M93 A;  3JAK A;  3HKD A;  2PTM A;  4F6R A;  3CB2 A;  4I50 A;  3UT5 A;  3BPZ A;  3RGB A;  2UUC B;  3WB1 A;  4JI0 B;  4CH6 A;  4O4J A;  3E22 B;  4TUY A;  4DR6 B;  1TUB A;  5BR8 B;  1Q8I A;  3ZS8 C;  2PZS A;  4FLY A;  4HBN A;  5EYP A;  1RSO A;  5K1X A;  4X1I B;  3RYH B;  3RFR A;  4O4H B;  4DK0 A;  1ZAU A;  2F66 C;  1Q5O A;  3SR2 C;  3QF7 A;  2ZNJ A;  5LYJ B;  4DR1 B;  1S5J A;  2ZNI A;  1Q3E A;  4BWA A;  5CB4 A;  2YI8 A;  5IYZ A;  2V4D A;  3CSX A;  4LNU A;  4TV8 B;  4O4I B;  5CA1 A;  3BA8 A;  4WBN B;  2GV9 A;  4FM1 A;  1SQG A;  3CHX A;  1TVK B;  3RYF B;  3RYI A;  1FFX A;  3JAW B;  2F95 B;  2OYQ A;  2PY5 A;  2UXB B;  5LOV B;  2Q0A A;  4PI2 A;  4JV5 B;  1WPB A;  3N2G A;  4TQF A;  3M7M X;  4X1Y A;  4JI4 B;  2ZIO A;  4B3R B;  2CAZ C;  3HKE B;  1DGS A;  4I55 A;  5EIB C;  2UXC B;  5C8Y B;  4GKK B;  4JI7 B;  4IIJ B;  2IM9 A;  5EZY B;  1N36 B;  3HKB B;  4U3J A;  5JQG A;  4FLZ A;  2YXL A;  4LF6 B;  1H2S B;  3VQW A;  3SJB C;  5FNV B;  5LXT B;  4UCO A;  4YJ2 A;  3BAA A;  4K8Z A;  4Q6G A;  4ZOL A;  4LFA B;  2JVD A;  1YEW A;  5KHH A;  4DV5 B;  4FVM A;  3RWR D;  2PYL A;  5KX5 B;  4DV3 B;  3E22 A;  1O9G A;  1L8D A;  3K5M A;  4K0K B;  5BMV B;  4LH7 A;  2P5O A;  1J5E B;  5KHK A;  3ZED A;  1HW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...