3SJFA

X-ray structure of human glutamate carboxypeptidase ii in complex with a urea-based inhibitor (a25)
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Novel Substrate-Based Inhibitors of Human Glutamate Carboxypeptidase II with Enhanced Lipophilicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 266
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3sjfA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3sjfA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3sjfA02
4P6YA 3RZAA 1VHOA 3PB7X 3ICUA 1HEEA 1WVMA 3VARA 3N5FA 3GB0A 3CPXA 4P4EA 3KZWA 1R3NA 1ZG7A 3BHXA 2HB6A 4NGRA 4UEFA 4UIBA 3KGQA 5I4MA 2PJ2A 3D7HA 4YWYA 4P4FA 2AFSA 4OP4A 4A37A 3FEEA 3MN8A 3NH4A 2EK9A 4MXUA 3B3CA 4NGPA 1F57A 3PBBA 1F2OA 1H8LA 1Q7LA 2ZELA 2ZOGA 2ZEGA 2ZEHA 1IY7A 3KI9A 2PJ7A 3B35A 3VTAA 4NGQA 4O23A 5K8NA 1QMUA 3B2YA 3LMSA 2PJCA 2PVVA 2V8HA 2XEIA 4OC4A 2PJ5A 4YU9A 3TX8A 3KQXA 2RB7A 1YLOA 2GLJA 3HLPA 1HDQA 3GUXA 3DGVA 1XMBA 1CPXA 2QJ8A 1XRYA 4JYWA 3KASA 3FF3A 4OC3A 5JH9A 3RAMA 1R43A 2PJ9A 4TJVA 5THWA 4UEEA 4MRIA 5CPAA 2PCUA 3L2NA 1RTQA 4FWUA 4OIDA 4FUUA 7CPAA 2VL1A 6CPAA 3NA6A 4PXEA 3IIBA 2AFWA 1BPNA 4F9VA 1XJOA 1OBRA 2PE3A 4P45A 2BCOA 4OIWA 1CG2A 2GLFA 1CPSA 2QYVA 4UEZA 3IEHA 3WC6A 2GREA 5CBMA 1LAPA 4IHMA 4ZX8A 4KNGE 4C9AA 3GLJA 2XEGA 3B3WA 2BO9A 3SI1A 4NGNA 4OKOA 2FVGA 4MCRA 1ARMA 1QQ9A 1EE3P 4MHZA 3CPAA 2V77A 3PB9X 2Q51A 1YW6A 3IJ3A 4C9VA 2NSMA 3WABA 4PXBA 4ZY2A 4P4IA 3JRUA 5LRGA 3SJGA 5JGFA 4EMEA 4RUHA 3IC1A 3PB8X 4NGMA 1TKFA 2CTCA 4ZY1A 1ZG8A 4PQAA 1XF1A 2C6PA 1BPMA 4GM5A 2ZEFA 4R7MA 4TNUA 4X3RA 2ABZA 2PIZA 4WWVA 1Z8LA 2JBKA 4P4BA 4LQGA 4MHNA 3S9NA 1DTDA 3I1UA 2PJ6A 1HDUA 2ZOFA 1KWMA 3PRTA 4P10A 4C85A 1CX8A 5IB9A 1LANA 1ARLA 3IWWA 4MMOA 4K3NA 1IGBA 3PBEA 3FVLA 2CTBA 1ZLIA 4NFRA 5LYFA 3WT4A 2CIJA 3SI0A 2PJ1A 3SI2A 1DE4C 2OR4A 1GYTA 2EK8A 3B3TA 4UF4A 2PJ8A 5DS0A 1PCAA 4OC2A 1XFOA 2POKA 3I74A 2V8GA 4MCQA 4C9UA 4C8AA 3FEDA 2V8DA 3KR4A 5K8OA 4C8PA 2OOTA 2QVPA 4ZY0A 4W9YA 4R76A 5D29A 1CP6A 3B3SA 3V38A 2ZEDA 1Z2LA 4Z65A 4P44A 3SJFA 3VATA 1ELLP 2PJ4A 3H8GA 2O4HA 2ZEPA 3S9LA 1LOKA 2AFMA 3SJEA 2XEFA 1YSJA 2JBJA 3VH9A 3BI1A 3H8FA 1Z5RA 2PJBA 4R8FA 2NYQA 2WZNA 1BAVA 1F2PA 4OMEA 4C99A 3PEIA 1LFWA 3D7FA 4IK2A 5HVHA 1TXRA 1AYEA 2AFZA 4MCSA 2O53A 3K9TA 1VHEA 3PFOA 4A94A 4R6TA 2Q4ZA 5D8NA 1TF9A 4MCPA 2IJZA 4P4JA 2C1CA 3IFEA 1YMEA 1TKHA 5JM6A 4EFDA 5LRKA 1CBXA 1VIXA 2AFOA 3D4UA 3FH4A 3FMCA 4H2KA 5LYLA 3QNVA 4C8CA 1TF8A 4F9UA 3RBUA 1VGYA 4CDJA 5F09A 3KHZA 4PXDA 5LRJA 4Q7AA 3NH5A 4P4DA 3V7ZA 3D7DA 2DEAA 3FX6A 3PB6X 4FBEA 1PYTB 1ZLHA 5LYIA 3I6SA 2CF4A 5J1QA 3KR5A 2AFXA 2EWBA 4PXCA 1UWYA 1FT7A 4ONWA 2IQ6A 4C86A 5HVFA 2ZEOA 3CT9A 4ZI6A 4G1PA 4WJBA 4DYOA 3WC5A 1Y0YA 3S9MA 2F8HA 2BOAA 4NGSA 3H8EA 4PPZA 4MHYA 3MRUA 2V8VA 2PRQA 2XEJA 2F7VA 4MHPA 3D67A 3NFZA 4X8IA 4CPAA 4TJXA 2AFUA 2HC9A 4C8FA 2PJ0A 2ZENA 3EIFA 3HUVA 2C6GA 4C8TA 2WYRA 4B6ZA 4FAIA 4NGTA 3KHXA 4UIAA 3BI0A 1V6CA 2Q43A 4JZ0A 1LCPA 2G9DA 1Y7EA 4EWTA 4NJQA 4OC5A 5ELYA 3SJXA 3FJUA 2ANPA 2J9AA 2PJ3A 1ELMP 1XBUA 4YN3A 3T8WA 3D66A 4C8UA 3B3VA 4OC0A 1LAMA 1Y0RA 3ISZA 1Y9ZA 3WC7A 1YW4A 2GU2A 1AMPA 4X2TA 3PB4X 4A38A 3TC8A 2C6CA 4BD9A 1JQGA 5K8PA 4F8ZA 3DLJA 3KQZA 1M4LA 2ZEMA 1ZG9A 3KL9A 4A39A 4CDKA 3LWUA 5K8MA 4NJRA 8CPAA 4KSIA 2PVWA 1FNOA 3CDXA 2PJAA 3K2KA 3D68A 1NSAA 3BXMA 4AXVA 4ZX9A 3PFEA 4IAVA 3FECA 4TWEA 4C9RA 2RFHA 4OC1A 5HXDA 2I3CA 5HVGA 3D7GA 4C9EA 2PIYA 3NH8A 1BLLE 4DJLA 3IO1A 2ZEEA 4DUKA 1CP7A 3B7IA 2JEWA 4ZYQA 3ISXA 4C84A 2IMOA 5LYDA 1TKJA
chains in the Genus database with same CATH superfamily
2D0PA 3GIUA 4P6YA 1OZPA 1VHOA 3PB7X 4R57A 1HEEA 1B87A 1KUVA 3RZAA 3ICUA 4NCZA 1WVMA 3VARA 1ZO0A 4DJLA 1KUXA 3N5FA 1CJWA 2MP0A 2HV2A 1S7LA 3GB0A 3CPXA 4P4EA 1FY7A 1VBHA 5F5XA 2PQ8A 3KZWA 1R3NA 1ZG7A 4QBJA 3BHXA 2HB6A 4NF1A 4NGRA 1QSMA 5H86A 4KSAA 4QUSA 4UEFA 2ZXVA 4CAFA 4UIBA 3PLFB 2Q44A 3F8KA 3KGQA 5I4MA 4J0NA 3PGPA 2PJ2A 3D7HA 4YWYA 5JQ4A 3OWCA 4P4FA 2AFSA 2ZW6A 4OP4A 2P6FA 4A37A 3FEEA 4JJXA 3MN8A 4HKFA 2OB0A 1KZFA 2EK9A 3EXNA 3NH4A 4A31A 1M6VB 2JLMA 4H1HA 1VI4A 2B4BA 2X7BA 4MXUA 4AVCA 3B3CA 3FRMA 2OLSA 5AGEA 4NGPA 1F57A 1Z4EA 1YR0A 1MJBA 1F2OA 3PBBA 1H8LA 4CYOA 2EZBA 3EC4A 3UY5A 2GE3A 3VRQA 1NXJA 4FD4A 1Q7LA 2VZZA 1P0HA 1NE9A 2ZELA 2ZOGA 2ZEGA 2G3TA 2ZEHA 4KVXA 1IY7A 3KI9A 4CRZB 3F5BA 4I49A 2N3AB 2B5GB 2PJ7A 3B35A 3EZBA 5IR2A 3VTAA 2PSWA 4OAEA 5J3XA 5DWMA 4NGQA 2OZHA 4MI1A 3TLCA 4O23A 3CXPA 3DDDA 2FE7A 5FVJA 2NMTA 4FD6A 5K8NA 4MFQA 4JWPA 1QMUA 2PRBA 3B2YA 3LMSA 2PJCA 1YX0A 2PVVA 4AG7A 1S5KA 2V8HA 1SQHA 1YVHA 2XEIA 1XMTA 3S6GA 1R61A 3T0TA 4OC4A 2ARHA 3TE4A 4CO9A 2PJ5A 1MK4A 4YU9A 5F46A 5JPHA 2YGWA 3TX8A 2WPWA 2EO8A 3OB1B 3OP0A 3KQXA 2YNDA 3LACA 2RB7A 1YLOA 2WSAA 2GLJA 4UFXA 1YK3A 1X10A 3HLPA 1J3LA 1HDQA 3GUXA 4JXRA 1QSOA 3RYOA 3DGVA 1XMBA 1CPXA 2QJ8A 4XPDB 1XRYA 4C68A 4JYWA 2HQYA 3KASA 3FF3A 4OC3A 4U9ZA 5JH9A 3RAMA 1R43A 2PJ9A 4EVYA 4TJVA 3H5ZA 3VROA 2PR8A 5THWA 4UEEA 4CS0B 3NOJA 4FD5A 4MRIA 4H6ZA 5IX3A 3TLGA 4YRHA 2REEA 5CPAA 5E96A 1A9XB 1IU8A 2BL1A 2EBJA 2PCUA 2Z3PA 4JD6A 4KVME 3SXOA 3L2NA 5FD8A 4Q36A 3TLZA 1S3ZA 1RTQA 4FWUA 4OIDA 4FUUA 3D3SA 7CPAA 3T07A 2PC1A 4U5YA 2VL1A 5BWAB 3A9LA 5C88A 3DR8A 3VWDA 4C7HA 2I79A 6CPAA 2FXFA 3F0AA 3NA6A 4PXEA 3FBUA 4PSWA 1M44A 4X5KA 4XPLA 2Z3OA 3IIBA 2AFWA 1BPNA 4UBRA 4F9VA 1ZL0A 3VRPA 2P6GA 3V8IA 1BXRB 2DIKA 1XJOA 1OBRA 2XPLA 1XOVA 4P45A 2PE3A 3HPHE 4A4CA 2BCOA 2WUUA 4OIWA 1CG2A 2GLFA 3LODA 4UWJA 1CPSA 2QYVA 4UEZA 3IEHA 5GCNA 3WC6A 2GREA 2R7HA 5CBMA 3IWGA 1LAPA 1Y9KA 4IHMA 3D2PA 4ZX8A 4KOXA 4K30A 2VXKA 1M4DA 4KNGE 5HKYA 3TO7A 2EZCA 4C9AA 1K4JA 2D4OA 4R87A 2ZW5A 3PP9A 3IU2A 5C82A 3GLJA 2XEGA 4QC6A 3B3WA 4MJXA 2BO9A 2ATRA 2BSWA 4MY3A 3SI1A 4KORA 4NGNA 2HUZA 2GIVA 1C30B 1GGOA 4OKOA 3P2FA 2FVGA 5CNPA 4MCRA 1ARMA 1QQ9A 3LD2A 4MI4A 1EE3P 4MHZA 4R3LA 4E0AA 1I1DA 3GJZA 3CPAA 5G21A 2CNTA 2V77A 3PB9X 3W91A 2AUMA 2Q51A 1YW6A 3IJ3A 1MJ9A 2Q7BA 4CAWA 4C9VA 2NSMA 3R9GA 4PXBA 3WABA 2X0SA 5AG7A 3T5MA 4ZY2A 5G22A 4C2ZA 4YFJA 2VEZA 4UA3A 4P4IA 4KOVA 3JRUA 5LRGA 3SJGA 2Z10A 4JXQA 4YGOA 5JGFA 2R8VA 2XPOA 3IGRA 3EY5A 4UFWA 4XNHB 2CBLA 4EMEA 1XE4A 2I00A 3IC1A 5G1ZA 4RUHA 1B6BA 3DNSA 3PB8X 4DUKA 4GPLB 4BPXB 4NGMA 5HH1A 4A33A 2EZAA 2CY2A 3TO9A 4E5SA 4Q38A 4UCPA 3GYAA 1Z9UA 2Q4VA 1TKFA 2CTCA 4KUAA 4M6IA 1ZG8A 4PQAA 4ZY1A 1I12A 1XF1A 2C6PA 4IIYA 2B3VA 2HWGA 1BPMA 4GM5A 4BBHA 1IICA 3T90A 2ZEFA 3FYNA 4R7MA 4TNUA 3C26A 4X3RA 4ZGYB 1KC7A 2ABZA 1IB1E 2PIZA 3OAKA 4WWVA 3OB2B 1RXTA 1Z8LA 2JBKA 4C2YA 4PK3A 4F0YA 3N7ZA 4LQGA 4P4BA 2B4DA 5A27A 2UV8G 4MHNA 3S9NA 1S7FA 2AUNA 2FM4A 2BUEA 1UFHA 1DTDA 3I1UA 4HPSA 4CGLA 4RI1A 2PJ6A 1IYKA 1HDUA 2ZOFA 2IL4A 3NFQA 1KWMA 3PRTA 4P10A 4FD7A 5KTDA 4KLVA 1CX8A 4BTFA 5IV0A 1JDBC 4C85A 5AG6A 5IB9A 3TOBA 1LANA 2Q04A 1YQEA 1WJTA 1ARLA 4A32A 3IWWA 2FIWA 4KOUA 4MFJA 4M6GA 4MMOA 4K3NA 1J4JA 1IGBA 2IMOA 3PBEA 2C27A 3FVLA 2CTBA 3BUNB 3SXNA 1ZLIA 1Q2YA 2Z3LA 4CRYB 4JVOA 1VKCA 4NFRA 2OZUA 1JDEA 3ZZIA 4BPWB 4B5PB 2Z3MA 4NSQA 5LYFA 3WT4A 2CIJA 1Q2CA 4B10A 1A2ZA 4MFLA 1V0CA 1Z4RA 3GY9A 4KLWA 3SI0A 2PJ1A 3SI2A 1DE4C 2ZPAA 2OR4A 2FL4A 1N71A 3T05A 2R98A 4PK2A 4B5OA 1GYTA 2EK8A 3B3TA 3DR6A 3JUWA 4H6UA 4LUAA 4OLLA 4UF4A 2PJ8A 5DS0A 2VBQA 1PCAA 1EO0A 3GKRA 3RO0A 5AG4A 4OC2A 1XFOA 3P2HA 3TLAA 2POKA 3I74A 2B4JC 2CNSA 1XEBA 2V8GA 4MCQA 1M4GA 2C5QA 3VWEA 4C9UA 4CYPA 4C8AA 3FEDA 1R57A 2V8DA 3KR4A 5K8OA 4F6AA 2OOTA 3VRRA 2QVPA 2FIAA 4W9YA 2P6EA 4R76A 5D29A 5F13A 4LQ6A 1CP6A 1VHSA 4ZY0A 2P0WA 3B3SA 2XPPA 4UWIA 5A28A 3FXTA 2QIRA 4JLYA 1TIQA 3V38A 3TYXA 2ZEDA 1Z2LA 3NE7A 4Z65A 4P44A 3ZNIA 3SJFA 3VATA 2JDDA 3FB3A 3I9SA 4B14A 4CYQA 1ELLP 3TLBA 2PJ4A 2B5GA 3H8GA 4ZBGA 3VRNA 4L89A 2E28A 2O4HA 2F5IA 2ZEPA 3T9YA 1CS0B 4CGNA 2REFA 1RO5A 2Y1MA 4AG9A 2R82A 3S9LA 1LOKA 2YNEA 3EZAA 2Q7SA 3O8ZA 2AFMA 3SJEA 3QB8A 3R9FA 5HKWA 2XEFA 5BY0A 4BPUB 1YSJA 3HPGG 4COBA 2Z3NA 1Z8TA 2JBJA 2GANA 1NMTA 3R96A 5KTAA 3VH9A 3BI1A 3H4QA 3IU1A 3H8FA 1M1DA 1Z5RA 4HNYB 5F48A 2PJBA 1S7KA 1ON0A 3G23A 2FT0A 4CAEA 4R8FA 2NYQA 2A4NA 4OADA 5KTCA 1S7NA 3EZEA 3S6FA 2PCNA 2FSRA 4H89A 3U1BA 2KCWA 2WZNA 1BAVA 2VKZG 1F2PA 4II9A 1ZRSA 4UFVA 4OMEA 3FIXA 1NBWA 4C99A 1P4NA 3PEIA 5J8FA 2JDCA 4NEXA 1M4IA 1KEEB 1LFWA 3D7FA 4IK2A 5HVHA 5IB0A 4E94A 1TXRA 1AYEA 2AFZA 4MCSA 2O53A 3K9TA 4KZTA 4CAXA 4ONUA 1AUGA 1VHEA 1VBGA 2HI6A 3PFOA 4A94A 4R6TA 2Q4ZA 4RS2A 5D8NA 4HNXB 5EC4A 3BUXB 1TF9A 5HMNA 2HROA 4MCPA 2XPNA 2DPSA 1YREA 1L0CA 2AJ6A 2DPTA 1Z9EA 4B11A 2IJZA 4P4JA 2C1CA 3IFEA 4MFKA 1WWZA 4CAVA 2J8NA 1GHEA 2J8RA 1PU9A 1T36B 1YMEA 1TKHA 5JM6A 4U9YA 4EFDA 2DLAA 5LRKA 4IIXA 1CBXA 1QSTA 5JYBA 1VIXA 2AFOA 3D4UA 3B8GA 3FH4A 4A95A 1EZBA 3FMCA 4H2KA 5LYLA 1XF8A 1XIXA 3QNVA 4C8CA 2Z11A 4LX9A 4R9MA 4CZ1A 4M8DA 3KKWA 5I0CA 1TF8A 4KUBA 3D2MA 2GFQA 4MBUA 2D0OA 4F0XA 4F9UA 3RBUA 2FCKA 1VGYA 2EUIA 4MFZA 1U6MA 4CDJA 5F09A 1Y9WA 4NXYA 5AXIA 3TCVA 3KHZA 4PXDA 2DF5A 4Q7AA 4KOYA 5LRJA 3NH5A 4P4DA 2YNCA 3QAHA 3BUOB 3V7ZA 3D7DA 4XPKA 5K99A 2DEAA 4KVOE 3FX6A 5AG5A 4QVTA 3BJ7A 4B12A 3PB6X 3TLEA 4FBEA 2J8MA 5F49A 1PYTB 1ZLHA 4PV6A 4AVBA 4UCMA 1IIDA 1S60A 5LYIA 3I6SA 3ZJ0A 2CF4A 4CGOA 5J1QA 3KR5A 2AFXA 2EWBA 4PXCA 4C8PA 1UWYA 1FT7A 2ZW4A 4ONWA 1WK4A 4AVAA 4E8OA 1DIKA 4INJA 4BINA 4B13A 3TTHA 1Y7RA 1C3OB 2IQ6A 1I21A 5HVFA 3S6HA 4C86A 2ZEOA 3KRVA 3CT9A 4ZI6A 4G1PA 4WJBA 4UCNA 1Q2DA 3JTKA 4XPDC 2ODFA 4HNWB 1CM0A 4DYOA 3WC5A 3WR7A 1Y0YA 4A30A 3SHPA 2VQYA 3S9MA 2F8HA 2BOAA 4NGSA 3H8EA 4BMHA 4PPZA 3VGOA 2G3AA 3MRUA 2V8VA 4MHYA 5DWNA 3K9UA 2PRQA 1IOFA 1QSRA 4MY0A 2XEJA 4CGMA 2F7VA 5JVLA 4MHPA 1KUYA 1IYLA 2Q0YA 2RC4A 3D67A 5J8CA 3NFZA 4X8IA 4CPAA 4MHDA 2G0BA 4TJXA 4EYSA 2AFUA 2HC9A 3TO6A 4C8FA 3I3GA 3TLGB 2K5TA 1PUAA 2PJ0A 2ZENA 1YVKA 2PDOA 5F1YA 1B47A 4M6HA 4QB9A 2Q4YA 3EIFA 4RR2B 3DSBA 2Y1NA 3HUVA 3F9KC 4Y49C 2C6GA 2QECA 2FS5A 3G3SA 4C8TA 1Z8WA 2WYRA 1ZYMA 4B6ZA 4FAIA 4NGTA 3KHXA 4UIAA 1YGHA 3BI0A 2D4PA 1V6CA 2Q43A 3S6KA 4JZ0A 3D8PA 1LCPA 2G9DA 1Y7EA 4EWTA 4NJQA 4OC5A 1Z8XA 5ELYA 3R95A 4KS9A 3TOAA 4B5PA 3SJXA 2YNCC 5EMIA 3FJUA 2ANPA 2Z3KA 2J9AA 3R9EA 2PJ3A 1ELMP 2VZYA 1XBUA 2OZGA 4YN3A 3CXSA 2CNMA 1NSLA 2GP4A 3T8WA 3D66A 3HMJG 4KOSA 3BUMB 3E0KA 3RNZA 3BJ8A 2B58A 1IOIA 1BOBA 3B3VA 4C8UA 3G8WA 2QMLA 4MFPA 4GS4A 4PSXA 3EFAA 4OC0A 5F9MA 1LAMA 1JWQA 1Y0RA 3ISZA 4C7IA 1Y9ZA 3R1KA 4A2ZA 3WC7A 1YW4A 2GU2A 1AMPA 1X12A 3PB4X 3BUWB 4X2TA 4A38A 3TC8A 2C6CA 3TT2A 4BD9A 2OU2A 2B0AA 4XNHC 1JQGA 3EO4A 4AB7A 4CYNA 4KSFA 4DNCA 2Y0MA 4F8ZA 5K8PA 5ISVA 3DLJA 3KQZA 2B3UA 4A4BA 2WPXA 1M4LA 2ZEMA 4IF5A 5G20A 2YJTA 2AE6A 1ZG9A 3KL9A 5H84A 4A39A 4CDKA 3LWUA 5K8MA 4NJRA 8CPAA 4COGA 3CXQA 4Y49B 3K4IA 2BEIA 4KSIA 2PVWA 1EZAA 3MGDA 4J3GA 4C2XA 1FNOA 1YLEA 2PJAA 3CDXA 3FNCA 3K2KA 3D68A 4KOTA 1NSAA 2YJVA 3BLNA 4GXHA 2PR1A 2Z0ZA 4L8AA 3IWEA 3BXMA 1FBVA 4M85A 2CXAA 4M3SA 4AXVA 3C8OA 3TLYA 3SR3A 3PT1A 3PFEA 4ZX9A 4MJ8A 1Q5XA 4IAVA 3W6SA 3FECA 2H5MA 2VI7A 3JVNA 3U88C 3NE8A 5HKZA 4ORFA 2RFHA 4OC1A 4TWEA 5HXDA 4C9RA 1QSNA 2I3CA 1KBLA 3PFVA 1BO4A 1CE8B 1LRZA 5HVGA 3D7GA 4IUSA 2DXQA 4E2AA 3PZJA 4C9EA 2PIYA 3NH8A 1BLLE 1MJAA 2O28A 2B4DB 2ZW7A 4R3KA 4KOWA 3IO1A 2JEVA 2ZEEA 4RN7A 5F47A 1CP7A 4CGPA 2EVNA 3B7IA 2JEWA 2OH1A 3TFYA 4ZYQA 5EBVA 3ISXA 3CZXA 4C84A 2R1IA 3W6XA 1YVOA 5LYDA 3QAYA 1TKJA
chains in the Genus database with same CATH topology
4P6YA 3RZAA 1VHOA 3PB7X 3ICUA 1HEEA 1WVMA 3VARA 3N5FA 3GB0A 3CPXA 4P4EA 3KZWA 1R3NA 1ZG7A 3BHXA 2HB6A 4NGRA 4UEFA 4UIBA 3KGQA 5I4MA 2PJ2A 3D7HA 4YWYA 4P4FA 2AFSA 4OP4A 4A37A 3FEEA 3MN8A 3NH4A 2EK9A 4MXUA 3B3CA 4NGPA 1F57A 3PBBA 1F2OA 1H8LA 1Q7LA 2ZELA 2ZOGA 2ZEGA 2ZEHA 1IY7A 3KI9A 5IR2A 2PJ7A 3B35A 3VTAA 4NGQA 4O23A 5K8NA 1QMUA 3B2YA 3LMSA 2PJCA 2PVVA 2V8HA 2XEIA 4OC4A 2PJ5A 4YU9A 3TX8A 3KQXA 2RB7A 1YLOA 2GLJA 3HLPA 1HDQA 3GUXA 3DGVA 1XMBA 1CPXA 2QJ8A 1XRYA 4JYWA 3KASA 3FF3A 4OC3A 5JH9A 3RAMA 1R43A 2PJ9A 4TJVA 5THWA 4UEEA 4MRIA 5CPAA 2PCUA 3L2NA 1RTQA 4FWUA 4OIDA 4FUUA 7CPAA 2VL1A 6CPAA 3NA6A 4PXEA 3IIBA 2AFWA 1BPNA 4F9VA 1XJOA 1OBRA 2PE3A 4P45A 2BCOA 4OIWA 1CG2A 2GLFA 1CPSA 2QYVA 4UEZA 3IEHA 3WC6A 2GREA 5CBMA 1LAPA 4IHMA 4ZX8A 4KNGE 4C9AA 3GLJA 2XEGA 3B3WA 2BO9A 3SI1A 4NGNA 4OKOA 2FVGA 4MCRA 1ARMA 1QQ9A 1EE3P 4MHZA 3CPAA 2V77A 3PB9X 2Q51A 1YW6A 3IJ3A 4C9VA 2NSMA 3WABA 4PXBA 4ZY2A 4P4IA 3JRUA 5LRGA 3SJGA 5JGFA 4EMEA 4RUHA 3IC1A 3PB8X 4NGMA 1TKFA 2CTCA 4ZY1A 1ZG8A 4PQAA 1XF1A 2C6PA 1BPMA 4GM5A 2ZEFA 4R7MA 4TNUA 4X3RA 2ABZA 2PIZA 4WWVA 1Z8LA 2JBKA 4P4BA 4LQGA 4MHNA 3S9NA 1DTDA 3I1UA 2PJ6A 1HDUA 2ZOFA 1KWMA 3PRTA 4P10A 4C85A 1CX8A 5IB9A 1LANA 1ARLA 3IWWA 4MMOA 4K3NA 1IGBA 3PBEA 3FVLA 2CTBA 1ZLIA 4NFRA 5LYFA 3WT4A 2CIJA 3SI0A 2PJ1A 3SI2A 1DE4C 2OR4A 1GYTA 2EK8A 3B3TA 4UF4A 2PJ8A 5DS0A 1PCAA 4OC2A 1XFOA 2POKA 3I74A 2C5QA 2V8GA 4MCQA 4C9UA 4C8AA 3FEDA 2V8DA 3KR4A 5K8OA 4C8PA 2OOTA 2QVPA 4ZY0A 4W9YA 4R76A 5D29A 1CP6A 3B3SA 3V38A 2ZEDA 1Z2LA 4Z65A 4P44A 3SJFA 3VATA 1ELLP 2PJ4A 3H8GA 2O4HA 2ZEPA 3S9LA 1LOKA 2AFMA 3SJEA 2XEFA 1YSJA 2JBJA 3VH9A 3BI1A 3H8FA 1Z5RA 2PJBA 4R8FA 2NYQA 2WZNA 1BAVA 1F2PA 4OMEA 4C99A 3PEIA 1LFWA 3D7FA 4IK2A 5HVHA 1TXRA 1AYEA 2AFZA 4MCSA 2O53A 3K9TA 1VHEA 3PFOA 4A94A 4R6TA 2Q4ZA 5D8NA 1TF9A 4MCPA 2IJZA 4P4JA 2C1CA 3IFEA 1YMEA 1TKHA 5JM6A 4EFDA 5LRKA 1CBXA 1VIXA 2AFOA 3D4UA 3FH4A 3FMCA 4H2KA 5LYLA 3QNVA 4C8CA 1TF8A 4F9UA 3RBUA 1VGYA 4CDJA 5F09A 3KHZA 4PXDA 5LRJA 4Q7AA 3NH5A 4P4DA 3V7ZA 3D7DA 2DEAA 3FX6A 3PB6X 4FBEA 1PYTB 1ZLHA 5LYIA 3I6SA 2CF4A 5J1QA 3KR5A 2AFXA 2EWBA 4PXCA 1UWYA 1FT7A 4ONWA 2IQ6A 4C86A 5HVFA 2ZEOA 3CT9A 4ZI6A 4G1PA 4WJBA 4DYOA 3WC5A 1Y0YA 3S9MA 2F8HA 2BOAA 4NGSA 3H8EA 4PPZA 4MHYA 3MRUA 2V8VA 2PRQA 2XEJA 2F7VA 4MHPA 3D67A 3NFZA 4X8IA 4CPAA 4TJXA 2AFUA 2HC9A 4C8FA 2PJ0A 2ZENA 3EIFA 3HUVA 2C6GA 4C8TA 2WYRA 4B6ZA 4FAIA 4NGTA 3KHXA 4UIAA 3BI0A 1V6CA 2Q43A 4JZ0A 1LCPA 2G9DA 1Y7EA 4EWTA 4NJQA 4OC5A 5ELYA 3SJXA 3FJUA 2ANPA 2J9AA 2PJ3A 1ELMP 1XBUA 4YN3A 2GP4A 3T8WA 3D66A 4C8UA 3B3VA 4OC0A 1LAMA 1Y0RA 3ISZA 1Y9ZA 3WC7A 1YW4A 2GU2A 1AMPA 4X2TA 3PB4X 4A38A 3TC8A 2C6CA 4BD9A 1JQGA 5K8PA 4F8ZA 3DLJA 3KQZA 1M4LA 2ZEMA 1ZG9A 3KL9A 4A39A 4CDKA 3LWUA 5K8MA 4NJRA 8CPAA 4KSIA 2PVWA 1FNOA 3CDXA 2PJAA 3K2KA 3D68A 1NSAA 3BXMA 4AXVA 4ZX9A 3PFEA 4IAVA 3FECA 4TWEA 4C9RA 2RFHA 4OC1A 5HXDA 2I3CA 5HVGA 3D7GA 4C9EA 2PIYA 3NH8A 1BLLE 4DJLA 3IO1A 2ZEEA 4DUKA 1CP7A 3B7IA 2JEWA 4ZYQA 3ISXA 4C84A 2IMOA 5LYDA 1TKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P6Y A;  3RZA A;  1VHO A;  3PB7 X;  3ICU A;  1HEE A;  1WVM A;  3VAR A;  3N5F A;  3GB0 A;  3CPX A;  4P4E A;  3KZW A;  1R3N A;  1ZG7 A;  3BHX A;  2HB6 A;  4NGR A;  4UEF A;  4UIB A;  3KGQ A;  5I4M A;  2PJ2 A;  3D7H A;  4YWY A;  4P4F A;  2AFS A;  4OP4 A;  4A37 A;  3FEE A;  3MN8 A;  3NH4 A;  2EK9 A;  4MXU A;  3B3C A;  4NGP A;  1F57 A;  3PBB A;  1F2O A;  1H8L A;  1Q7L A;  2ZEL A;  2ZOG A;  2ZEG A;  2ZEH A;  1IY7 A;  3KI9 A;  2PJ7 A;  3B35 A;  3VTA A;  4NGQ A;  4O23 A;  5K8N A;  1QMU A;  3B2Y A;  3LMS A;  2PJC A;  2PVV A;  2V8H A;  2XEI A;  4OC4 A;  2PJ5 A;  4YU9 A;  3TX8 A;  3KQX A;  2RB7 A;  1YLO A;  2GLJ A;  3HLP A;  1HDQ A;  3GUX A;  3DGV A;  1XMB A;  1CPX A;  2QJ8 A;  1XRY A;  4JYW A;  3KAS A;  3FF3 A;  4OC3 A;  5JH9 A;  3RAM A;  1R43 A;  2PJ9 A;  4TJV A;  5THW A;  4UEE A;  4MRI A;  5CPA A;  2PCU A;  3L2N A;  1RTQ A;  4FWU A;  4OID A;  4FUU A;  7CPA A;  2VL1 A;  6CPA A;  3NA6 A;  4PXE A;  3IIB A;  2AFW A;  1BPN A;  4F9V A;  1XJO A;  1OBR A;  2PE3 A;  4P45 A;  2BCO A;  4OIW A;  1CG2 A;  2GLF A;  1CPS A;  2QYV A;  4UEZ A;  3IEH A;  3WC6 A;  2GRE A;  5CBM A;  1LAP A;  4IHM A;  4ZX8 A;  4KNG E;  4C9A A;  3GLJ A;  2XEG A;  3B3W A;  2BO9 A;  3SI1 A;  4NGN A;  4OKO A;  2FVG A;  4MCR A;  1ARM A;  1QQ9 A;  1EE3 P;  4MHZ A;  3CPA A;  2V77 A;  3PB9 X;  2Q51 A;  1YW6 A;  3IJ3 A;  4C9V A;  2NSM A;  3WAB A;  4PXB A;  4ZY2 A;  4P4I A;  3JRU A;  5LRG A;  3SJG A;  5JGF A;  4EME A;  4RUH A;  3IC1 A;  3PB8 X;  4NGM A;  1TKF A;  2CTC A;  4ZY1 A;  1ZG8 A;  4PQA A;  1XF1 A;  2C6P A;  1BPM A;  4GM5 A;  2ZEF A;  4R7M A;  4TNU A;  4X3R A;  2ABZ A;  2PIZ A;  4WWV A;  1Z8L A;  2JBK A;  4P4B A;  4LQG A;  4MHN A;  3S9N A;  1DTD A;  3I1U A;  2PJ6 A;  1HDU A;  2ZOF A;  1KWM A;  3PRT A;  4P10 A;  4C85 A;  1CX8 A;  5IB9 A;  1LAN A;  1ARL A;  3IWW A;  4MMO A;  4K3N A;  1IGB A;  3PBE A;  3FVL A;  2CTB A;  1ZLI A;  4NFR A;  5LYF A;  3WT4 A;  2CIJ A;  3SI0 A;  2PJ1 A;  3SI2 A;  1DE4 C;  2OR4 A;  1GYT A;  2EK8 A;  3B3T A;  4UF4 A;  2PJ8 A;  5DS0 A;  1PCA A;  4OC2 A;  1XFO A;  2POK A;  3I74 A;  2V8G A;  4MCQ A;  4C9U A;  4C8A A;  3FED A;  2V8D A;  3KR4 A;  5K8O A;  4C8P A;  2OOT A;  2QVP A;  4ZY0 A;  4W9Y A;  4R76 A;  5D29 A;  1CP6 A;  3B3S A;  3V38 A;  2ZED A;  1Z2L A;  4Z65 A;  4P44 A;  3SJF A;  3VAT A;  1ELL P;  2PJ4 A;  3H8G A;  2O4H A;  2ZEP A;  3S9L A;  1LOK A;  2AFM A;  3SJE A;  2XEF A;  1YSJ A;  2JBJ A;  3VH9 A;  3BI1 A;  3H8F A;  1Z5R A;  2PJB A;  4R8F A;  2NYQ A;  2WZN A;  1BAV A;  1F2P A;  4OME A;  4C99 A;  3PEI A;  1LFW A;  3D7F A;  4IK2 A;  5HVH A;  1TXR A;  1AYE A;  2AFZ A;  4MCS A;  2O53 A;  3K9T A;  1VHE A;  3PFO A;  4A94 A;  4R6T A;  2Q4Z A;  5D8N A;  1TF9 A;  4MCP A;  2IJZ A;  4P4J A;  2C1C A;  3IFE A;  1YME A;  1TKH A;  5JM6 A;  4EFD A;  5LRK A;  1CBX A;  1VIX A;  2AFO A;  3D4U A;  3FH4 A;  3FMC A;  4H2K A;  5LYL A;  3QNV A;  4C8C A;  1TF8 A;  4F9U A;  3RBU A;  1VGY A;  4CDJ A;  5F09 A;  3KHZ A;  4PXD A;  5LRJ A;  4Q7A A;  3NH5 A;  4P4D A;  3V7Z A;  3D7D A;  2DEA A;  3FX6 A;  3PB6 X;  4FBE A;  1PYT B;  1ZLH A;  5LYI A;  3I6S A;  2CF4 A;  5J1Q A;  3KR5 A;  2AFX A;  2EWB A;  4PXC A;  1UWY A;  1FT7 A;  4ONW A;  2IQ6 A;  4C86 A;  5HVF A;  2ZEO A;  3CT9 A;  4ZI6 A;  4G1P A;  4WJB A;  4DYO A;  3WC5 A;  1Y0Y A;  3S9M A;  2F8H A;  2BOA A;  4NGS A;  3H8E A;  4PPZ A;  4MHY A;  3MRU A;  2V8V A;  2PRQ A;  2XEJ A;  2F7V A;  4MHP A;  3D67 A;  3NFZ A;  4X8I A;  4CPA A;  4TJX A;  2AFU A;  2HC9 A;  4C8F A;  2PJ0 A;  2ZEN A;  3EIF A;  3HUV A;  2C6G A;  4C8T A;  2WYR A;  4B6Z A;  4FAI A;  4NGT A;  3KHX A;  4UIA A;  3BI0 A;  1V6C A;  2Q43 A;  4JZ0 A;  1LCP A;  2G9D A;  1Y7E A;  4EWT A;  4NJQ A;  4OC5 A;  5ELY A;  3SJX A;  3FJU A;  2ANP A;  2J9A A;  2PJ3 A;  1ELM P;  1XBU A;  4YN3 A;  3T8W A;  3D66 A;  4C8U A;  3B3V A;  4OC0 A;  1LAM A;  1Y0R A;  3ISZ A;  1Y9Z A;  3WC7 A;  1YW4 A;  2GU2 A;  1AMP A;  4X2T A;  3PB4 X;  4A38 A;  3TC8 A;  2C6C A;  4BD9 A;  1JQG A;  5K8P A;  4F8Z A;  3DLJ A;  3KQZ A;  1M4L A;  2ZEM A;  1ZG9 A;  3KL9 A;  4A39 A;  4CDK A;  3LWU A;  5K8M A;  4NJR A;  8CPA A;  4KSI A;  2PVW A;  1FNO A;  3CDX A;  2PJA A;  3K2K A;  3D68 A;  1NSA A;  3BXM A;  4AXV A;  4ZX9 A;  3PFE A;  4IAV A;  3FEC A;  4TWE A;  4C9R A;  2RFH A;  4OC1 A;  5HXD A;  2I3C A;  5HVG A;  3D7G A;  4C9E A;  2PIY A;  3NH8 A;  1BLL E;  4DJL A;  3IO1 A;  2ZEE A;  4DUK A;  1CP7 A;  3B7I A;  2JEW A;  4ZYQ A;  3ISX A;  4C84 A;  2IMO A;  5LYD A;  1TKJ A; 
#chains in the Genus database with same CATH topology
 2D0P A;  3GIU A;  4P6Y A;  1OZP A;  1VHO A;  3PB7 X;  4R57 A;  1HEE A;  1B87 A;  1KUV A;  3RZA A;  3ICU A;  4NCZ A;  1WVM A;  3VAR A;  1ZO0 A;  4DJL A;  1KUX A;  3N5F A;  1CJW A;  2MP0 A;  2HV2 A;  1S7L A;  3GB0 A;  3CPX A;  4P4E A;  1FY7 A;  1VBH A;  5F5X A;  2PQ8 A;  3KZW A;  1R3N A;  1ZG7 A;  4QBJ A;  3BHX A;  2HB6 A;  4NF1 A;  4NGR A;  1QSM A;  5H86 A;  4KSA A;  4QUS A;  4UEF A;  2ZXV A;  4CAF A;  4UIB A;  3PLF B;  2Q44 A;  3F8K A;  3KGQ A;  5I4M A;  4J0N A;  3PGP A;  2PJ2 A;  3D7H A;  4YWY A;  5JQ4 A;  3OWC A;  4P4F A;  2AFS A;  2ZW6 A;  4OP4 A;  2P6F A;  4A37 A;  3FEE A;  4JJX A;  3MN8 A;  4HKF A;  2OB0 A;  1KZF A;  2EK9 A;  3EXN A;  3NH4 A;  4A31 A;  1M6V B;  2JLM A;  4H1H A;  1VI4 A;  2B4B A;  2X7B A;  4MXU A;  4AVC A;  3B3C A;  3FRM A;  2OLS A;  5AGE A;  4NGP A;  1F57 A;  1Z4E A;  1YR0 A;  1MJB A;  1F2O A;  3PBB A;  1H8L A;  4CYO A;  2EZB A;  3EC4 A;  3UY5 A;  2GE3 A;  3VRQ A;  1NXJ A;  4FD4 A;  1Q7L A;  2VZZ A;  1P0H A;  1NE9 A;  2ZEL A;  2ZOG A;  2ZEG A;  2G3T A;  2ZEH A;  4KVX A;  1IY7 A;  3KI9 A;  4CRZ B;  3F5B A;  4I49 A;  2N3A B;  2B5G B;  2PJ7 A;  3B35 A;  3EZB A;  5IR2 A;  3VTA A;  2PSW A;  4OAE A;  5J3X A;  5DWM A;  4NGQ A;  2OZH A;  4MI1 A;  3TLC A;  4O23 A;  3CXP A;  3DDD A;  2FE7 A;  5FVJ A;  2NMT A;  4FD6 A;  5K8N A;  4MFQ A;  4JWP A;  1QMU A;  2PRB A;  3B2Y A;  3LMS A;  2PJC A;  1YX0 A;  2PVV A;  4AG7 A;  1S5K A;  2V8H A;  1SQH A;  1YVH A;  2XEI A;  1XMT A;  3S6G A;  1R61 A;  3T0T A;  4OC4 A;  2ARH A;  3TE4 A;  4CO9 A;  2PJ5 A;  1MK4 A;  4YU9 A;  5F46 A;  5JPH A;  2YGW A;  3TX8 A;  2WPW A;  2EO8 A;  3OB1 B;  3OP0 A;  3KQX A;  2YND A;  3LAC A;  2RB7 A;  1YLO A;  2WSA A;  2GLJ A;  4UFX A;  1YK3 A;  1X10 A;  3HLP A;  1J3L A;  1HDQ A;  3GUX A;  4JXR A;  1QSO A;  3RYO A;  3DGV A;  1XMB A;  1CPX A;  2QJ8 A;  4XPD B;  1XRY A;  4C68 A;  4JYW A;  2HQY A;  3KAS A;  3FF3 A;  4OC3 A;  4U9Z A;  5JH9 A;  3RAM A;  1R43 A;  2PJ9 A;  4EVY A;  4TJV A;  3H5Z A;  3VRO A;  2PR8 A;  5THW A;  4UEE A;  4CS0 B;  3NOJ A;  4FD5 A;  4MRI A;  4H6Z A;  5IX3 A;  3TLG A;  4YRH A;  2REE A;  5CPA A;  5E96 A;  1A9X B;  1IU8 A;  2BL1 A;  2EBJ A;  2PCU A;  2Z3P A;  4JD6 A;  4KVM E;  3SXO A;  3L2N A;  5FD8 A;  4Q36 A;  3TLZ A;  1S3Z A;  1RTQ A;  4FWU A;  4OID A;  4FUU A;  3D3S A;  7CPA A;  3T07 A;  2PC1 A;  4U5Y A;  2VL1 A;  5BWA B;  3A9L A;  5C88 A;  3DR8 A;  3VWD A;  4C7H A;  2I79 A;  6CPA A;  2FXF A;  3F0A A;  3NA6 A;  4PXE A;  3FBU A;  4PSW A;  1M44 A;  4X5K A;  4XPL A;  2Z3O A;  3IIB A;  2AFW A;  1BPN A;  4UBR A;  4F9V A;  1ZL0 A;  3VRP A;  2P6G A;  3V8I A;  1BXR B;  2DIK A;  1XJO A;  1OBR A;  2XPL A;  1XOV A;  4P45 A;  2PE3 A;  3HPH E;  4A4C A;  2BCO A;  2WUU A;  4OIW A;  1CG2 A;  2GLF A;  3LOD A;  4UWJ A;  1CPS A;  2QYV A;  4UEZ A;  3IEH A;  5GCN A;  3WC6 A;  2GRE A;  2R7H A;  5CBM A;  3IWG A;  1LAP A;  1Y9K A;  4IHM A;  3D2P A;  4ZX8 A;  4KOX A;  4K30 A;  2VXK A;  1M4D A;  4KNG E;  5HKY A;  3TO7 A;  2EZC A;  4C9A A;  1K4J A;  2D4O A;  4R87 A;  2ZW5 A;  3PP9 A;  3IU2 A;  5C82 A;  3GLJ A;  2XEG A;  4QC6 A;  3B3W A;  4MJX A;  2BO9 A;  2ATR A;  2BSW A;  4MY3 A;  3SI1 A;  4KOR A;  4NGN A;  2HUZ A;  2GIV A;  1C30 B;  1GGO A;  4OKO A;  3P2F A;  2FVG A;  5CNP A;  4MCR A;  1ARM A;  1QQ9 A;  3LD2 A;  4MI4 A;  1EE3 P;  4MHZ A;  4R3L A;  4E0A A;  1I1D A;  3GJZ A;  3CPA A;  5G21 A;  2CNT A;  2V77 A;  3PB9 X;  3W91 A;  2AUM A;  2Q51 A;  1YW6 A;  3IJ3 A;  1MJ9 A;  2Q7B A;  4CAW A;  4C9V A;  2NSM A;  3R9G A;  4PXB A;  3WAB A;  2X0S A;  5AG7 A;  3T5M A;  4ZY2 A;  5G22 A;  4C2Z A;  4YFJ A;  2VEZ A;  4UA3 A;  4P4I A;  4KOV A;  3JRU A;  5LRG A;  3SJG A;  2Z10 A;  4JXQ A;  4YGO A;  5JGF A;  2R8V A;  2XPO A;  3IGR A;  3EY5 A;  4UFW A;  4XNH B;  2CBL A;  4EME A;  1XE4 A;  2I00 A;  3IC1 A;  5G1Z A;  4RUH A;  1B6B A;  3DNS A;  3PB8 X;  4DUK A;  4GPL B;  4BPX B;  4NGM A;  5HH1 A;  4A33 A;  2EZA A;  2CY2 A;  3TO9 A;  4E5S A;  4Q38 A;  4UCP A;  3GYA A;  1Z9U A;  2Q4V A;  1TKF A;  2CTC A;  4KUA A;  4M6I A;  1ZG8 A;  4PQA A;  4ZY1 A;  1I12 A;  1XF1 A;  2C6P A;  4IIY A;  2B3V A;  2HWG A;  1BPM A;  4GM5 A;  4BBH A;  1IIC A;  3T90 A;  2ZEF A;  3FYN A;  4R7M A;  4TNU A;  3C26 A;  4X3R A;  4ZGY B;  1KC7 A;  2ABZ A;  1IB1 E;  2PIZ A;  3OAK A;  4WWV A;  3OB2 B;  1RXT A;  1Z8L A;  2JBK A;  4C2Y A;  4PK3 A;  4F0Y A;  3N7Z A;  4LQG A;  4P4B A;  2B4D A;  5A27 A;  2UV8 G;  4MHN A;  3S9N A;  1S7F A;  2AUN A;  2FM4 A;  2BUE A;  1UFH A;  1DTD A;  3I1U A;  4HPS A;  4CGL A;  4RI1 A;  2PJ6 A;  1IYK A;  1HDU A;  2ZOF A;  2IL4 A;  3NFQ A;  1KWM A;  3PRT A;  4P10 A;  4FD7 A;  5KTD A;  4KLV A;  1CX8 A;  4BTF A;  5IV0 A;  1JDB C;  4C85 A;  5AG6 A;  5IB9 A;  3TOB A;  1LAN A;  2Q04 A;  1YQE A;  1WJT A;  1ARL A;  4A32 A;  3IWW A;  2FIW A;  4KOU A;  4MFJ A;  4M6G A;  4MMO A;  4K3N A;  1J4J A;  1IGB A;  2IMO A;  3PBE A;  2C27 A;  3FVL A;  2CTB A;  3BUN B;  3SXN A;  1ZLI A;  1Q2Y A;  2Z3L A;  4CRY B;  4JVO A;  1VKC A;  4NFR A;  2OZU A;  1JDE A;  3ZZI A;  4BPW B;  4B5P B;  2Z3M A;  4NSQ A;  5LYF A;  3WT4 A;  2CIJ A;  1Q2C A;  4B10 A;  1A2Z A;  4MFL A;  1V0C A;  1Z4R A;  3GY9 A;  4KLW A;  3SI0 A;  2PJ1 A;  3SI2 A;  1DE4 C;  2ZPA A;  2OR4 A;  2FL4 A;  1N71 A;  3T05 A;  2R98 A;  4PK2 A;  4B5O A;  1GYT A;  2EK8 A;  3B3T A;  3DR6 A;  3JUW A;  4H6U A;  4LUA A;  4OLL A;  4UF4 A;  2PJ8 A;  5DS0 A;  2VBQ A;  1PCA A;  1EO0 A;  3GKR A;  3RO0 A;  5AG4 A;  4OC2 A;  1XFO A;  3P2H A;  3TLA A;  2POK A;  3I74 A;  2B4J C;  2CNS A;  1XEB A;  2V8G A;  4MCQ A;  1M4G A;  2C5Q A;  3VWE A;  4C9U A;  4CYP A;  4C8A A;  3FED A;  1R57 A;  2V8D A;  3KR4 A;  5K8O A;  4F6A A;  2OOT A;  3VRR A;  2QVP A;  2FIA A;  4W9Y A;  2P6E A;  4R76 A;  5D29 A;  5F13 A;  4LQ6 A;  1CP6 A;  1VHS A;  4ZY0 A;  2P0W A;  3B3S A;  2XPP A;  4UWI A;  5A28 A;  3FXT A;  2QIR A;  4JLY A;  1TIQ A;  3V38 A;  3TYX A;  2ZED A;  1Z2L A;  3NE7 A;  4Z65 A;  4P44 A;  3ZNI A;  3SJF A;  3VAT A;  2JDD A;  3FB3 A;  3I9S A;  4B14 A;  4CYQ A;  1ELL P;  3TLB A;  2PJ4 A;  2B5G A;  3H8G A;  4ZBG A;  3VRN A;  4L89 A;  2E28 A;  2O4H A;  2F5I A;  2ZEP A;  3T9Y A;  1CS0 B;  4CGN A;  2REF A;  1RO5 A;  2Y1M A;  4AG9 A;  2R82 A;  3S9L A;  1LOK A;  2YNE A;  3EZA A;  2Q7S A;  3O8Z A;  2AFM A;  3SJE A;  3QB8 A;  3R9F A;  5HKW A;  2XEF A;  5BY0 A;  4BPU B;  1YSJ A;  3HPG G;  4COB A;  2Z3N A;  1Z8T A;  2JBJ A;  2GAN A;  1NMT A;  3R96 A;  5KTA A;  3VH9 A;  3BI1 A;  3H4Q A;  3IU1 A;  3H8F A;  1M1D A;  1Z5R A;  4HNY B;  5F48 A;  2PJB A;  1S7K A;  1ON0 A;  3G23 A;  2FT0 A;  4CAE A;  4R8F A;  2NYQ A;  2A4N A;  4OAD A;  5KTC A;  1S7N A;  3EZE A;  3S6F A;  2PCN A;  2FSR A;  4H89 A;  3U1B A;  2KCW A;  2WZN A;  1BAV A;  2VKZ G;  1F2P A;  4II9 A;  1ZRS A;  4UFV A;  4OME A;  3FIX A;  1NBW A;  4C99 A;  1P4N A;  3PEI A;  5J8F A;  2JDC A;  4NEX A;  1M4I A;  1KEE B;  1LFW A;  3D7F A;  4IK2 A;  5HVH A;  5IB0 A;  4E94 A;  1TXR A;  1AYE A;  2AFZ A;  4MCS A;  2O53 A;  3K9T A;  4KZT A;  4CAX A;  4ONU A;  1AUG A;  1VHE A;  1VBG A;  2HI6 A;  3PFO A;  4A94 A;  4R6T A;  2Q4Z A;  4RS2 A;  5D8N A;  4HNX B;  5EC4 A;  3BUX B;  1TF9 A;  5HMN A;  2HRO A;  4MCP A;  2XPN A;  2DPS A;  1YRE A;  1L0C A;  2AJ6 A;  2DPT A;  1Z9E A;  4B11 A;  2IJZ A;  4P4J A;  2C1C A;  3IFE A;  4MFK A;  1WWZ A;  4CAV A;  2J8N A;  1GHE A;  2J8R A;  1PU9 A;  1T36 B;  1YME A;  1TKH A;  5JM6 A;  4U9Y A;  4EFD A;  2DLA A;  5LRK A;  4IIX A;  1CBX A;  1QST A;  5JYB A;  1VIX A;  2AFO A;  3D4U A;  3B8G A;  3FH4 A;  4A95 A;  1EZB A;  3FMC A;  4H2K A;  5LYL A;  1XF8 A;  1XIX A;  3QNV A;  4C8C A;  2Z11 A;  4LX9 A;  4R9M A;  4CZ1 A;  4M8D A;  3KKW A;  5I0C A;  1TF8 A;  4KUB A;  3D2M A;  2GFQ A;  4MBU A;  2D0O A;  4F0X A;  4F9U A;  3RBU A;  2FCK A;  1VGY A;  2EUI A;  4MFZ A;  1U6M A;  4CDJ A;  5F09 A;  1Y9W A;  4NXY A;  5AXI A;  3TCV A;  3KHZ A;  4PXD A;  2DF5 A;  4Q7A A;  4KOY A;  5LRJ A;  3NH5 A;  4P4D A;  2YNC A;  3QAH A;  3BUO B;  3V7Z A;  3D7D A;  4XPK A;  5K99 A;  2DEA A;  4KVO E;  3FX6 A;  5AG5 A;  4QVT A;  3BJ7 A;  4B12 A;  3PB6 X;  3TLE A;  4FBE A;  2J8M A;  5F49 A;  1PYT B;  1ZLH A;  4PV6 A;  4AVB A;  4UCM A;  1IID A;  1S60 A;  5LYI A;  3I6S A;  3ZJ0 A;  2CF4 A;  4CGO A;  5J1Q A;  3KR5 A;  2AFX A;  2EWB A;  4PXC A;  4C8P A;  1UWY A;  1FT7 A;  2ZW4 A;  4ONW A;  1WK4 A;  4AVA A;  4E8O A;  1DIK A;  4INJ A;  4BIN A;  4B13 A;  3TTH A;  1Y7R A;  1C3O B;  2IQ6 A;  1I21 A;  5HVF A;  3S6H A;  4C86 A;  2ZEO A;  3KRV A;  3CT9 A;  4ZI6 A;  4G1P A;  4WJB A;  4UCN A;  1Q2D A;  3JTK A;  4XPD C;  2ODF A;  4HNW B;  1CM0 A;  4DYO A;  3WC5 A;  3WR7 A;  1Y0Y A;  4A30 A;  3SHP A;  2VQY A;  3S9M A;  2F8H A;  2BOA A;  4NGS A;  3H8E A;  4BMH A;  4PPZ A;  3VGO A;  2G3A A;  3MRU A;  2V8V A;  4MHY A;  5DWN A;  3K9U A;  2PRQ A;  1IOF A;  1QSR A;  4MY0 A;  2XEJ A;  4CGM A;  2F7V A;  5JVL A;  4MHP A;  1KUY A;  1IYL A;  2Q0Y A;  2RC4 A;  3D67 A;  5J8C A;  3NFZ A;  4X8I A;  4CPA A;  4MHD A;  2G0B A;  4TJX A;  4EYS A;  2AFU A;  2HC9 A;  3TO6 A;  4C8F A;  3I3G A;  3TLG B;  2K5T A;  1PUA A;  2PJ0 A;  2ZEN A;  1YVK A;  2PDO A;  5F1Y A;  1B47 A;  4M6H A;  4QB9 A;  2Q4Y A;  3EIF A;  4RR2 B;  3DSB A;  2Y1N A;  3HUV A;  3F9K C;  4Y49 C;  2C6G A;  2QEC A;  2FS5 A;  3G3S A;  4C8T A;  1Z8W A;  2WYR A;  1ZYM A;  4B6Z A;  4FAI A;  4NGT A;  3KHX A;  4UIA A;  1YGH A;  3BI0 A;  2D4P A;  1V6C A;  2Q43 A;  3S6K A;  4JZ0 A;  3D8P A;  1LCP A;  2G9D A;  1Y7E A;  4EWT A;  4NJQ A;  4OC5 A;  1Z8X A;  5ELY A;  3R95 A;  4KS9 A;  3TOA A;  4B5P A;  3SJX A;  2YNC C;  5EMI A;  3FJU A;  2ANP A;  2Z3K A;  2J9A A;  3R9E A;  2PJ3 A;  1ELM P;  2VZY A;  1XBU A;  2OZG A;  4YN3 A;  3CXS A;  2CNM A;  1NSL A;  2GP4 A;  3T8W A;  3D66 A;  3HMJ G;  4KOS A;  3BUM B;  3E0K A;  3RNZ A;  3BJ8 A;  2B58 A;  1IOI A;  1BOB A;  3B3V A;  4C8U A;  3G8W A;  2QML A;  4MFP A;  4GS4 A;  4PSX A;  3EFA A;  4OC0 A;  5F9M A;  1LAM A;  1JWQ A;  1Y0R A;  3ISZ A;  4C7I A;  1Y9Z A;  3R1K A;  4A2Z A;  3WC7 A;  1YW4 A;  2GU2 A;  1AMP A;  1X12 A;  3PB4 X;  3BUW B;  4X2T A;  4A38 A;  3TC8 A;  2C6C A;  3TT2 A;  4BD9 A;  2OU2 A;  2B0A A;  4XNH C;  1JQG A;  3EO4 A;  4AB7 A;  4CYN A;  4KSF A;  4DNC A;  2Y0M A;  4F8Z A;  5K8P A;  5ISV A;  3DLJ A;  3KQZ A;  2B3U A;  4A4B A;  2WPX A;  1M4L A;  2ZEM A;  4IF5 A;  5G20 A;  2YJT A;  2AE6 A;  1ZG9 A;  3KL9 A;  5H84 A;  4A39 A;  4CDK A;  3LWU A;  5K8M A;  4NJR A;  8CPA A;  4COG A;  3CXQ A;  4Y49 B;  3K4I A;  2BEI A;  4KSI A;  2PVW A;  1EZA A;  3MGD A;  4J3G A;  4C2X A;  1FNO A;  1YLE A;  2PJA A;  3CDX A;  3FNC A;  3K2K A;  3D68 A;  4KOT A;  1NSA A;  2YJV A;  3BLN A;  4GXH A;  2PR1 A;  2Z0Z A;  4L8A A;  3IWE A;  3BXM A;  1FBV A;  4M85 A;  2CXA A;  4M3S A;  4AXV A;  3C8O A;  3TLY A;  3SR3 A;  3PT1 A;  3PFE A;  4ZX9 A;  4MJ8 A;  1Q5X A;  4IAV A;  3W6S A;  3FEC A;  2H5M A;  2VI7 A;  3JVN A;  3U88 C;  3NE8 A;  5HKZ A;  4ORF A;  2RFH A;  4OC1 A;  4TWE A;  5HXD A;  4C9R A;  1QSN A;  2I3C A;  1KBL A;  3PFV A;  1BO4 A;  1CE8 B;  1LRZ A;  5HVG A;  3D7G A;  4IUS A;  2DXQ A;  4E2A A;  3PZJ A;  4C9E A;  2PIY A;  3NH8 A;  1BLL E;  1MJA A;  2O28 A;  2B4D B;  2ZW7 A;  4R3K A;  4KOW A;  3IO1 A;  2JEV A;  2ZEE A;  4RN7 A;  5F47 A;  1CP7 A;  4CGP A;  2EVN A;  3B7I A;  2JEW A;  2OH1 A;  3TFY A;  4ZYQ A;  5EBV A;  3ISX A;  3CZX A;  4C84 A;  2R1I A;  3W6X A;  1YVO A;  5LYD A;  3QAY A;  1TKJ A; 
#chains in the Genus database with same CATH homology
 4P6Y A;  3RZA A;  1VHO A;  3PB7 X;  3ICU A;  1HEE A;  1WVM A;  3VAR A;  3N5F A;  3GB0 A;  3CPX A;  4P4E A;  3KZW A;  1R3N A;  1ZG7 A;  3BHX A;  2HB6 A;  4NGR A;  4UEF A;  4UIB A;  3KGQ A;  5I4M A;  2PJ2 A;  3D7H A;  4YWY A;  4P4F A;  2AFS A;  4OP4 A;  4A37 A;  3FEE A;  3MN8 A;  3NH4 A;  2EK9 A;  4MXU A;  3B3C A;  4NGP A;  1F57 A;  3PBB A;  1F2O A;  1H8L A;  1Q7L A;  2ZEL A;  2ZOG A;  2ZEG A;  2ZEH A;  1IY7 A;  3KI9 A;  5IR2 A;  2PJ7 A;  3B35 A;  3VTA A;  4NGQ A;  4O23 A;  5K8N A;  1QMU A;  3B2Y A;  3LMS A;  2PJC A;  2PVV A;  2V8H A;  2XEI A;  4OC4 A;  2PJ5 A;  4YU9 A;  3TX8 A;  3KQX A;  2RB7 A;  1YLO A;  2GLJ A;  3HLP A;  1HDQ A;  3GUX A;  3DGV A;  1XMB A;  1CPX A;  2QJ8 A;  1XRY A;  4JYW A;  3KAS A;  3FF3 A;  4OC3 A;  5JH9 A;  3RAM A;  1R43 A;  2PJ9 A;  4TJV A;  5THW A;  4UEE A;  4MRI A;  5CPA A;  2PCU A;  3L2N A;  1RTQ A;  4FWU A;  4OID A;  4FUU A;  7CPA A;  2VL1 A;  6CPA A;  3NA6 A;  4PXE A;  3IIB A;  2AFW A;  1BPN A;  4F9V A;  1XJO A;  1OBR A;  2PE3 A;  4P45 A;  2BCO A;  4OIW A;  1CG2 A;  2GLF A;  1CPS A;  2QYV A;  4UEZ A;  3IEH A;  3WC6 A;  2GRE A;  5CBM A;  1LAP A;  4IHM A;  4ZX8 A;  4KNG E;  4C9A A;  3GLJ A;  2XEG A;  3B3W A;  2BO9 A;  3SI1 A;  4NGN A;  4OKO A;  2FVG A;  4MCR A;  1ARM A;  1QQ9 A;  1EE3 P;  4MHZ A;  3CPA A;  2V77 A;  3PB9 X;  2Q51 A;  1YW6 A;  3IJ3 A;  4C9V A;  2NSM A;  3WAB A;  4PXB A;  4ZY2 A;  4P4I A;  3JRU A;  5LRG A;  3SJG A;  5JGF A;  4EME A;  4RUH A;  3IC1 A;  3PB8 X;  4NGM A;  1TKF A;  2CTC A;  4ZY1 A;  1ZG8 A;  4PQA A;  1XF1 A;  2C6P A;  1BPM A;  4GM5 A;  2ZEF A;  4R7M A;  4TNU A;  4X3R A;  2ABZ A;  2PIZ A;  4WWV A;  1Z8L A;  2JBK A;  4P4B A;  4LQG A;  4MHN A;  3S9N A;  1DTD A;  3I1U A;  2PJ6 A;  1HDU A;  2ZOF A;  1KWM A;  3PRT A;  4P10 A;  4C85 A;  1CX8 A;  5IB9 A;  1LAN A;  1ARL A;  3IWW A;  4MMO A;  4K3N A;  1IGB A;  3PBE A;  3FVL A;  2CTB A;  1ZLI A;  4NFR A;  5LYF A;  3WT4 A;  2CIJ A;  3SI0 A;  2PJ1 A;  3SI2 A;  1DE4 C;  2OR4 A;  1GYT A;  2EK8 A;  3B3T A;  4UF4 A;  2PJ8 A;  5DS0 A;  1PCA A;  4OC2 A;  1XFO A;  2POK A;  3I74 A;  2C5Q A;  2V8G A;  4MCQ A;  4C9U A;  4C8A A;  3FED A;  2V8D A;  3KR4 A;  5K8O A;  4C8P A;  2OOT A;  2QVP A;  4ZY0 A;  4W9Y A;  4R76 A;  5D29 A;  1CP6 A;  3B3S A;  3V38 A;  2ZED A;  1Z2L A;  4Z65 A;  4P44 A;  3SJF A;  3VAT A;  1ELL P;  2PJ4 A;  3H8G A;  2O4H A;  2ZEP A;  3S9L A;  1LOK A;  2AFM A;  3SJE A;  2XEF A;  1YSJ A;  2JBJ A;  3VH9 A;  3BI1 A;  3H8F A;  1Z5R A;  2PJB A;  4R8F A;  2NYQ A;  2WZN A;  1BAV A;  1F2P A;  4OME A;  4C99 A;  3PEI A;  1LFW A;  3D7F A;  4IK2 A;  5HVH A;  1TXR A;  1AYE A;  2AFZ A;  4MCS A;  2O53 A;  3K9T A;  1VHE A;  3PFO A;  4A94 A;  4R6T A;  2Q4Z A;  5D8N A;  1TF9 A;  4MCP A;  2IJZ A;  4P4J A;  2C1C A;  3IFE A;  1YME A;  1TKH A;  5JM6 A;  4EFD A;  5LRK A;  1CBX A;  1VIX A;  2AFO A;  3D4U A;  3FH4 A;  3FMC A;  4H2K A;  5LYL A;  3QNV A;  4C8C A;  1TF8 A;  4F9U A;  3RBU A;  1VGY A;  4CDJ A;  5F09 A;  3KHZ A;  4PXD A;  5LRJ A;  4Q7A A;  3NH5 A;  4P4D A;  3V7Z A;  3D7D A;  2DEA A;  3FX6 A;  3PB6 X;  4FBE A;  1PYT B;  1ZLH A;  5LYI A;  3I6S A;  2CF4 A;  5J1Q A;  3KR5 A;  2AFX A;  2EWB A;  4PXC A;  1UWY A;  1FT7 A;  4ONW A;  2IQ6 A;  4C86 A;  5HVF A;  2ZEO A;  3CT9 A;  4ZI6 A;  4G1P A;  4WJB A;  4DYO A;  3WC5 A;  1Y0Y A;  3S9M A;  2F8H A;  2BOA A;  4NGS A;  3H8E A;  4PPZ A;  4MHY A;  3MRU A;  2V8V A;  2PRQ A;  2XEJ A;  2F7V A;  4MHP A;  3D67 A;  3NFZ A;  4X8I A;  4CPA A;  4TJX A;  2AFU A;  2HC9 A;  4C8F A;  2PJ0 A;  2ZEN A;  3EIF A;  3HUV A;  2C6G A;  4C8T A;  2WYR A;  4B6Z A;  4FAI A;  4NGT A;  3KHX A;  4UIA A;  3BI0 A;  1V6C A;  2Q43 A;  4JZ0 A;  1LCP A;  2G9D A;  1Y7E A;  4EWT A;  4NJQ A;  4OC5 A;  5ELY A;  3SJX A;  3FJU A;  2ANP A;  2J9A A;  2PJ3 A;  1ELM P;  1XBU A;  4YN3 A;  2GP4 A;  3T8W A;  3D66 A;  4C8U A;  3B3V A;  4OC0 A;  1LAM A;  1Y0R A;  3ISZ A;  1Y9Z A;  3WC7 A;  1YW4 A;  2GU2 A;  1AMP A;  4X2T A;  3PB4 X;  4A38 A;  3TC8 A;  2C6C A;  4BD9 A;  1JQG A;  5K8P A;  4F8Z A;  3DLJ A;  3KQZ A;  1M4L A;  2ZEM A;  1ZG9 A;  3KL9 A;  4A39 A;  4CDK A;  3LWU A;  5K8M A;  4NJR A;  8CPA A;  4KSI A;  2PVW A;  1FNO A;  3CDX A;  2PJA A;  3K2K A;  3D68 A;  1NSA A;  3BXM A;  4AXV A;  4ZX9 A;  3PFE A;  4IAV A;  3FEC A;  4TWE A;  4C9R A;  2RFH A;  4OC1 A;  5HXD A;  2I3C A;  5HVG A;  3D7G A;  4C9E A;  2PIY A;  3NH8 A;  1BLL E;  4DJL A;  3IO1 A;  2ZEE A;  4DUK A;  1CP7 A;  3B7I A;  2JEW A;  4ZYQ A;  3ISX A;  4C84 A;  2IMO A;  5LYD A;  1TKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...