3SJFA

X-ray structure of human glutamate carboxypeptidase ii in complex with a urea-based inhibitor (a25)
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel Substrate-Based Inhibitors of Human Glutamate Carboxypeptidase II with Enhanced Lipophilicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 266
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3sjfA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3sjfA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3sjfA02
1BLLE 3KGQA 2GU2A 2V8HA 4ZI6A 1DE4C 4PQAA 3B3WA 4FUUA 2CTCA 4P45A 2C6GA 3IFEA 4UIAA 5IB9A 3RAMA 1BPNA 3V38A 3KI9A 4NGMA 1F2OA 4ZX8A 2F8HA 4OC0A 4C9EA 4C86A 3NH4A 2I3CA 2CTBA 4KNGE 3H8GA 4C85A 4PXDA 1TKHA 1CP7A 3VH9A 4CDKA 2NYQA 4P4JA 3FJUA 3RZAA 3PEIA 4ZY0A 3S9LA 2FVGA 5HVFA 2ZEEA 2CF4A 2PJ0A 4B6ZA 3SI0A 4IHMA 4UEEA 4JZ0A 4MHPA 5ELYA 3KQXA 3I74A 4ZY2A 3MRUA 2XEGA 4F9VA 4P44A 4FBEA 2PVWA 4O23A 3PRTA 3L2NA 4MCRA 3DLJA 3TC8A 1EE3P 1YLOA 4C8TA 3IO1A 4PXCA 4R6TA 3WC6A 2ZENA 5LYFA 2EK8A 1TXRA 2HB6A 3B35A 3WABA 3FEDA 2Q43A 3PBBA 1LFWA 3IWWA 4P10A 3SJXA 4X8IA 3K9TA 4C8CA 3BHXA 4P4EA 3B7IA 2GLFA 2ZOFA 1XF1A 5D29A 3I6SA 1CP6A 4CDJA 4R7MA 4P4FA 3D7HA 3ISXA 3TX8A 2PCUA 2QJ8A 4GM5A 4PXBA 3PB8X 4C9RA 3SI1A 1LAMA 1AMPA 5HVGA 1ZLHA 1YSJA 3ISZA 1TF9A 1HEEA 3SJFA 3WT4A 2HC9A 3JRUA 1F57A 2IMOA 4KSIA 4EFDA 1JQGA 2ZEDA 1ELMP 2PJ6A 2V77A 3B3SA 4LQGA 3N5FA 4A38A 3RBUA 3KHZA 1ELLP 2F7VA 3PFOA 1VHEA 2XEJA 3LMSA 4NFRA 4ZY1A 3BXMA 2BOAA 4A37A 4UEFA 2C1CA 2WZNA 4FWUA 3KASA 1R43A 3LWUA 4NJRA 4X2TA 5DS0A 4RUHA 4X3RA 3D4UA 4OC4A 5JM6A 3KHXA 3EIFA 5CPAA 5D8NA 2PJ3A 4IK2A 1R3NA 1ZG9A 2AFXA 4WJBA 5LRGA 4Z65A 1LANA 6CPAA 3CT9A 2VL1A 2ZEHA 4DJLA 5K8MA 2QYVA 1OBRA 5LRKA 3IC1A 2ZEFA 4NGQA 3KL9A 2RFHA 1BAVA 1IY7A 8CPAA 3SJEA 3QNVA 1M4LA 2C6CA 2QVPA 3BI1A 4DYOA 2GLJA 1HDQA 2PJ9A 5K8OA 4MHNA 1AYEA 1WVMA 2ANPA 3D66A 1TF8A 4MXUA 1CPSA 1BPMA 1CPXA 2BO9A 3S9NA 1TKFA 4NGRA 1FNOA 3H8EA 4CPAA 1Y9ZA 4NGNA 4F8ZA 4MRIA 1PYTB 2PJ4A 3B3TA 2AFUA 2PJCA 3IEHA 5F09A 3FX6A 1ZG8A 2AFOA 4OKOA 4OMEA 3V7ZA 4Q7AA 4ZYQA 2EK9A 1IGBA 2V8DA 5JGFA 4P4IA 3B3CA 2V8GA 1Y7EA 4IAVA 5LYLA 1YW6A 3KZWA 5THWA 3I1UA 2AFWA 2PIZA 2DEAA 4PXEA 2NSMA 3D67A 2EWBA 2PVVA 1YMEA 2AFMA 4C9UA 3IIBA 4W9YA 2PJ8A 4ONWA 4UIBA 1ZLIA 4F9UA 3D7FA 2OOTA 3S9MA 3CDXA 3CPXA 2JBJA 1KWMA 3VATA 1H8LA 4OC5A 1F2PA 4OIWA 3FEEA 1QQ9A 4G1PA 4UF4A 4FAIA 3KR5A 3PB4X 1CG2A 2OR4A 3K2KA 3T8WA 2Q4ZA 5J1QA 4C8FA 2IJZA 3CPAA 3GLJA 4MMOA 2PJ7A 2IQ6A 4TNUA 3VARA 1TKJA 4MHZA 4EMEA 2ZEOA 4WWVA 3BI0A 2JEWA 2PJ1A 3D7GA 4C84A 3IJ3A 4EWTA 1HDUA 1VGYA 3DGVA 4OP4A 2AFSA 1Z2LA 2PE3A 2ZEMA 5K8NA 2BCOA 3PB7X 2C6PA 2XEFA 4C99A 1LOKA 3KR4A 4MCSA 4YN3A 4MCPA 4OC3A 5LYDA 4UEZA 3FVLA 4OIDA 1RTQA 1Y0YA 3SJGA 1YW4A 1FT7A 2PJ2A 2JBKA 2WYRA 4PPZA 4OC1A 4A39A 4ZX9A 3PB6X 2RB7A 1LAPA 1XBUA 1XMBA 3B2YA 3MN8A 4NGSA 2J9AA 4YU9A 4C9VA 1Z5RA 5LRJA 5I4MA 4P4BA 2AFZA 1ARLA 3NH8A 3HLPA 1PCAA 5HVHA 4MCQA 1Y0RA 2ABZA 3FH4A 3ICUA 1XRYA 3NH5A 3D7DA 4C8UA 1V6CA 3H8FA 4A94A 1Q7LA 1DTDA 5LYIA 7CPAA 1GYTA 2Q51A 4DUKA 4AXVA 2XEIA 4NGPA 3SI2A 3WC7A 2PIYA 4R76A 3B3VA 2O4HA 4H2KA 5CBMA 4JYWA 4C8AA 4P6YA 1VHOA 1CBXA 3PB9X 2ZELA 4TJVA 4R8FA 4TWEA 4YWYA 2PJ5A 3FMCA 1XFOA 2ZEPA 3VTAA 4NJQA 2O53A 5HXDA 1ARMA 2CIJA 5K8PA 2GREA 3D68A 4C9AA 1NSAA 4BD9A 2PRQA 1ZG7A 1QMUA 1UWYA 1Z8LA 4MHYA 3FF3A 2PJBA 3HUVA 5JH9A 3NA6A 3WC5A 4NGTA 3KQZA 4K3NA 4TJXA 2POKA 4OC2A 1CX8A 3PFEA 1VIXA 3GB0A 3PBEA 3GUXA 3NFZA 2ZOGA 3FECA 2V8VA 1XJOA 2ZEGA 2PJAA 4C8PA 2G9DA 1LCPA 4P4DA
chains in the Genus database with same CATH superfamily
1BLLE 3D2MA 1Z9UA 3CXQA 3FRMA 3KGQA 2GU2A 2V8HA 4ZI6A 1DE4C 4JWPA 3UY5A 1XE4A 4PQAA 3H5ZA 4E5SA 3B3WA 4KOSA 4M6HA 3T90A 4JXQA 4FUUA 4KOWA 4EYSA 2CTCA 3G8WA 4P45A 2C6GA 2WUUA 3IFEA 4UIAA 5IB9A 1T36B 4H6UA 3CXSA 5JYBA 2FIWA 1BPNA 3RAMA 5J8FA 4JLYA 3V38A 1GGOA 1EO0A 2HWGA 5FD8A 3BJ7A 2PC1A 4C8PA 3KI9A 3BUOB 4A4BA 3PZJA 4B5OA 3O8ZA 4NGMA 2ZW7A 2D4PA 4FD7A 4HNXB 4J0NA 5F5XA 1F2OA 1YVHA 3A9LA 4ZX8A 2F8HA 1YVKA 3NE7A 4FD6A 4PSWA 4OC0A 4YRHA 4F0XA 5FVJA 2EZBA 4C86A 2CNTA 4AVAA 1NXJA 4C9EA 3DNSA 3NH4A 4NCZA 5IV0A 3QAHA 2I3CA 2CTBA 4UFXA 3V8IA 2EZAA 4KNGE 3H8GA 3T07A 4C85A 4PXDA 4CGNA 1Z9EA 4KLWA 3EY5A 1TKHA 3S6HA 2K5TA 4A4CA 3PFVA 1CP7A 4NXYA 3S6KA 1A2ZA 3TO6A 4CAVA 1MJ9A 4UCMA 3HPGG 3VH9A 3TLEA 3CXPA 4FD5A 2HROA 4COBA 2ATRA 3IGRA 2PQ8A 1YVOA 1Z4EA 1X10A 2NYQA 4KVXA 2ZPAA 4P4JA 4CDKA 2GP4A 1YQEA 2BL1A 3FJUA 3RZAA 1QSNA 3PEIA 2Z3MA 2B4DA 3TO7A 4ZY0A 4R57A 2AUNA 2ODFA 1YLEA 3S9LA 2FVGA 4AG9A 5HVFA 2ZEEA 3R1KA 2CF4A 2PJ0A 4Y49C 4B6ZA 2OU2A 3SI0A 4IHMA 3BUXB 4MJ8A 1ON0A 4UEEA 5F46A 4KOTA 5HKWA 2KCWA 3VWEA 3NOJA 3PLFB 4JZ0A 3E0KA 2J8MA 4MHPA 3FXTA 5ELYA 3KQXA 2Q44A 5JQ4A 2B0AA 4MI1A 2XPPA 3I74A 4ZY2A 3MRUA 1XEBA 2B4JC 2XEGA 2Y1MA 4F9VA 4P44A 4FBEA 4A95A 3SXOA 3VGOA 2PVWA 5HKZA 4O23A 4B14A 3FB3A 3FYNA 3IU1A 4M6IA 1X12A 3PRTA 3L2NA 3K4IA 4MCRA 4QB9A 3EFAA 3DLJA 4C2XA 3TLYA 3TC8A 4JVOA 1EE3P 2AUMA 2N3AB 1YLOA 3FNCA 3IO1A 4PXCA 4R6TA 3WC6A 4B11A 4C8TA 2ZENA 1S7LA 5G21A 1IU8A 4IF5A 5LYFA 2EK8A 4INJA 1Z4RA 1VBHA 5AG6A 5EMIA 1TXRA 2HB6A 5GCNA 3B35A 3WABA 1J3LA 3FEDA 1KZFA 3GY9A 2O28A 2Q43A 3PBBA 4H1HA 1LFWA 3IWWA 2UV8G 4BPUB 4QVTA 4P10A 5AXIA 3SJXA 1M44A 3EC4A 4X8IA 2QECA 5CNPA 3K9TA 4C8CA 1YX0A 2XPLA 4KSAA 3BHXA 2YNEA 2D0PA 4P4EA 3R96A 2Z11A 1I12A 4QUSA 1VBGA 1QSTA 3B7IA 2GLFA 2CNMA 4RR2B 2I79A 2ZOFA 5D29A 1XF1A 3I6SA 1CP6A 4CDJA 4R7MA 2BSWA 2BUEA 2J8RA 4P4FA 4FD4A 3IWEA 3D7HA 4MHDA 5KTCA 3TLAA 3ISXA 3TX8A 2PCUA 3TO9A 1IOFA 1VI4A 2QJ8A 3BUMB 4JXRA 2FM4A 4GM5A 4E2AA 2DXQA 3I9SA 4PSXA 4PXBA 4GXHA 3PB8X 4C7IA 4C9RA 3SI1A 1LAMA 1AMPA 1P4NA 5HVGA 1ZLHA 4UWIA 2HI6A 4Q38A 1NE9A 1Q2DA 1YSJA 1TF9A 1HEEA 3ISZA 1KC7A 3SJFA 2IL4A 2HC9A 3WT4A 4HNYB 2PSWA 3IWGA 2EBJA 3JRUA 1F57A 2Q0YA 2IMOA 3P2FA 2B3VA 4KSIA 4EFDA 1YR0A 2P6GA 1JQGA 2ZEDA 1ELMP 2PJ6A 2R98A 2V77A 3B3SA 4HNWB 4R3LA 4LQGA 1S7NA 3LACA 3N5FA 4U9ZA 3R9FA 4A38A 3RBUA 3KHZA 1CE8B 1BOBA 1CM0A 2CY2A 1ELLP 2F7VA 3PFOA 2EZCA 1CJWA 1VHEA 2WPWA 3EZAA 3W6XA 2XEJA 3I3GA 4XPLA 2B5GB 3LMSA 4NFRA 2XPNA 3BXMA 2BOAA 4NSQA 4A37A 2YNCC 4UEFA 2C1CA 3F5BA 5F47A 2Q7BA 2WZNA 4FWUA 4AB7A 3KASA 1R43A 1MJAA 1WK4A 4IIYA 3LWUA 4NJRA 1U6MA 3EZBA 2GFQA 4GPLB 2OZGA 4X2TA 5DS0A 4B12A 4BMHA 4RUHA 4X3RA 3D4UA 4OC4A 1K4JA 2FCKA 3KHXA 4QC6A 1Q2YA 5CPAA 4MY0A 4YGOA 2PJ3A 5D8NA 4II9A 3EIFA 4IK2A 4RI1A 4L8AA 4B5PA 1R3NA 1IIDA 3KKWA 3U1BA 2Y1NA 1ZG9A 4NEXA 3D2PA 4R9MA 2AFXA 1EZBA 4C2YA 4CYPA 2Y0MA 5H84A 4WJBA 5LRGA 4BBHA 4Z65A 1LANA 6CPAA 4YFJA 4JJXA 1IICA 5ISVA 3CT9A 4BTFA 2VL1A 4ZGYB 3R9EA 2ZEHA 2JDDA 4DJLA 5K8MA 2QYVA 4M8DA 1OBRA 3ZNIA 5LRKA 1B87A 3IC1A 1IYKA 2G3AA 1B47A 2ARHA 4A32A 2ZEFA 2ZXVA 2FXFA 4M3SA 4NGQA 3KL9A 2RFHA 3GJZA 1BAVA 1ZL0A 1TIQA 1XIXA 1IY7A 1IYLA 3TTHA 3HMJG 8CPAA 5HVHA 5IR2A 3SJEA 3QNVA 1M4LA 2Z3LA 2C6CA 2QVPA 1YK3A 3LD2A 1S5KA 4R87A 3SXNA 3BI1A 2VI7A 4J3GA 4KVME 4DYOA 4UA3A 4CYQA 2GLJA 1HDQA 2PJ9A 4Q36A 5K8OA 1XF8A 4MHNA 4ONUA 4CYNA 1AYEA 3GKRA 2REEA 4CGLA 1WVMA 2ANPA 3D66A 1Q5XA 4KORA 1TF8A 1CPSA 4MXUA 1BPMA 1CPXA 1KUYA 2BO9A 3PP9A 2Q7SA 2C5QA 3TYXA 4UWJA 2VEZA 3S9NA 4MI4A 1TKFA 2B5GA 3D8PA 4E8OA 3F9KC 3B8GA 3K9UA 5JM6A 3KRVA 4NGRA 1FNOA 1WWZA 2EVNA 2HQYA 3H8EA 4PK2A 4XNHB 2PR8A 3T0TA 4CPAA 2B3UA 2EO8A 2YGWA 1Y9ZA 2VXKA 4NGNA 1QSMA 3U88C 4F8ZA 1Y9KA 4MRIA 2PRBA 1PYTB 2PJ4A 3B3TA 2FE7A 2CNSA 3DDDA 2AFUA 2FT0A 3EZEA 2PJCA 3IEHA 5F09A 3FX6A 1ZG8A 4X5KA 1S3ZA 2QMLA 4B5PB 3DR8A 2AFOA 1FY7A 4OKOA 4AVCA 4OMEA 1C3OB 3V7ZA 4Q7AA 4ZYQA 2FS5A 2EK9A 1IGBA 1EZAA 4BPWB 2Q4VA 2V8DA 3BJ8A 2ZW6A 3T9YA 4P4IA 5JGFA 3B3CA 2V8GA 1Y7EA 4IAVA 4UFWA 3OWCA 4B13A 5LYLA 4IIXA 3JVNA 3W6SA 1YW6A 3KZWA 2D4OA 2R8VA 4DNCA 1OZPA 4H89A 5AG4A 2AJ6A 2CBLA 5THWA 2WSAA 3I1UA 5DWNA 2AFWA 2GANA 2PIZA 2RC4A 5J8CA 1NBWA 2H5MA 4CGOA 2YJVA 1AUGA 2JEVA 2Z10A 1KUXA 1N71A 2NMTA 2DEAA 2YNDA 2GIVA 2G0BA 1S7FA 2NSMA 3D67A 1Z8WA 4PXEA 2EWBA 1YREA 2A4NA 1YMEA 2PVVA 2XPOA 2AFMA 4AVBA 5A27A 1CS0B 4C9UA 3IIBA 4W9YA 2PJ8A 5F1YA 1PU9A 1B6BA 4KSFA 4CAWA 1LRZA 4ONWA 1BXRB 4UIBA 5EBVA 3GIUA 2REFA 3TOBA 1GHEA 1ZLIA 2J8NA 4F9UA 4CO9A 3D7FA 2OOTA 4E0AA 3S9MA 1QSRA 2B4DB 2HUZA 3CDXA 1QSOA 3CPXA 2JBJA 4OAEA 1KWMA 3VATA 1P0HA 2D0OA 1H8LA 4PK3A 3C26A 1VHSA 3MGDA 3R9GA 3TE4A 1C30B 4OC5A 1F2PA 4MY3A 3FEEA 4OIWA 4BPXB 1QQ9A 3GYAA 4KLVA 2BEIA 2OLSA 4G1PA 5BWAB 4UF4A 4FAIA 2I00A 4KOUA 3KR5A 3PB4X 4CAEA 1CG2A 2OR4A 3EXNA 3K2KA 4KUBA 4A31A 5AG5A 3T8WA 2JLMA 3ZJ0A 2PCNA 2Q4ZA 3JTKA 4H6ZA 5AGEA 5J1QA 4C8FA 5HKYA 1IB1E 2IJZA 3CPAA 3GLJA 2OZUA 5JVLA 4NF1A 2B58A 4MMOA 4QBJA 2AE6A 2PJ7A 5EC4A 4KOYA 1Q2CA 1UFHA 4CAFA 1S60A 2P6EA 2IQ6A 2R1IA 4TNUA 3TLGA 1M6VB 4UBRA 3VARA 3JUWA 4UCNA 4UFVA 1TKJA 3D3SA 3QAYA 5DWMA 4A30A 4MHZA 2OB0A 4U9YA 4XPDB 4B10A 4EMEA 3TLCA 4COGA 2VZZA 2R7HA 5K99A 2ZEOA 3IU2A 5F13A 1PUAA 2C27A 4OLLA 3BI0A 4WWVA 1RO5A 5AG7A 2JEWA 3SHPA 2PJ1A 4F0YA 4M6GA 4C2ZA 3D7GA 3VROA 4XPDC 4C84A 5KTAA 5BY0A 5KTDA 3IJ3A 4EWTA 1HDUA 1VGYA 2JDCA 3DGVA 2E28A 2ZW5A 2B4BA 3ZZIA 4C68A 3VRQA 4MBUA 4OP4A 2AFSA 5C82A 1Z2LA 1A9XB 1ZRSA 2R82A 3DR6A 2PE3A 4EVYA 5HMNA 1SQHA 1I1DA 2ZEMA 5K8NA 3BUWB 2BCOA 3H4QA 3PB7X 4LQ6A 2C6PA 5E96A 2XEFA 5F9MA 4C99A 3N7ZA 1LOKA 4JD6A 4BINA 3KR4A 2ZW4A 4MCSA 4UCPA 4YN3A 4MCPA 4MFJA 4KUAA 4XNHC 3SR3A 1KBLA 4KOVA 4OC3A 5LYDA 2F5IA 3VRNA 2FIAA 4UEZA 3FVLA 4OIDA 1RTQA 2VZYA 3TLGB 2Q04A 3QB8A 1Y0YA 3FBUA 3HPHE 3T5MA 3SJGA 1YW4A 1FT7A 3BLNA 4PV6A 2PJ2A 2VQYA 2JBKA 2WYRA 4CRZB 4HPSA 1I21A 4PPZA 3WR7A 1M4DA 4OC1A 5J3XA 4A39A 1BO4A 3PB6X 4ZX9A 2RB7A 4KZTA 4CYOA 1LAPA 2FL4A 1XBUA 1Y9WA 1XMBA 3VRRA 3B2YA 3MN8A 3VRPA 4MFKA 4XPKA 5F48A 4NGSA 3RYOA 4CZ1A 3DSBA 2J9AA 4YU9A 4C9VA 5JPHA 1Z5RA 4LX9A 4A33A 5LRJA 4CRYB 5I4MA 3S6GA 3OP0A 4P4BA 5C88A 2AFZA 1ARLA 4AG7A 3OB1B 2G3TA 3NH8A 4L89A 4MFZA 4OADA 3PGPA 1NSLA 3HLPA 1JDEA 2Z3KA 3TLBA 1PCAA 3BUNB 4ZY1A 4MCQA 1M4GA 1Y0RA 1Y7RA 2ABZA 3TOAA 2DPTA 3FH4A 4GS4A 4KS9A 5H86A 2MP0A 1XRYA 3ICUA 3NH5A 2FSRA 2P6FA 2YNCA 3F8KA 3PT1A 3D7DA 4C8UA 1V6CA 3H8FA 4A94A 1Q7LA 1DTDA 5LYIA 5IB0A 1ZO0A 3C8OA 1KEEB 7CPAA 1GYTA 1L0CA 1Z8XA 1S7KA 2QIRA 3W91A 5G22A 2Q51A 4DUKA 4MFLA 4HKFA 1M4IA 2EUIA 4KVOE 4AXVA 2XEIA 4ORFA 2DPSA 4CGMA 1IOIA 4NGPA 1V0CA 3SI2A 3CZXA 3WC7A 3TLZA 2PIYA 4MJXA 2Q4YA 4CS0B 2P0WA 2PDOA 4R76A 3B3VA 2GE3A 4RN7A 3NFQA 3NE8A 4CGPA 2O4HA 4H2KA 3TT2A 5CBMA 4JYWA 1JWQA 5I0CA 4C8AA 3OAKA 4P6YA 1VHOA 1CBXA 3G3SA 3PB9X 4CAXA 3F0AA 2ZELA 1R61A 1MJBA 2DIKA 1YGHA 4TJVA 4U5YA 4R8FA 2CXAA 5G20A 2DLAA 3TCVA 3FIXA 4TWEA 4A2ZA 4YWYA 1KUVA 2PJ5A 2Z3PA 2VKZG 3FMCA 4E94A 1NMTA 3G23A 2OZHA 1FBVA 1XFOA 3P2HA 4IUSA 4K30A 5HH1A 5F49A 2ZEPA 2DF5A 4RS2A 1WJTA 3TFYA 1Z8TA 2X0SA 4ZBGA 2VBQA 3VTAA 1R57A 2YJTA 4NJQA 2O53A 3RO0A 5HXDA 1ARMA 1VKCA 2CIJA 3VWDA 5K8PA 2GREA 3D68A 4C9AA 4MFQA 4Y49B 1NSAA 3R95A 4BD9A 2PRQA 2Z3NA 1ZG7A 4F6AA 4MFPA 1QMUA 1UWYA 1Z8LA 4MHYA 1ZYMA 2PR1A 3FF3A 2PJBA 2OH1A 3HUVA 5JH9A 3T05A 5G1ZA 3NA6A 3WC5A 4NGTA 2X7BA 2Z0ZA 4LUAA 3KQZA 4K3NA 1XOVA 4R3KA 3S6FA 4TJXA 2POKA 4OC2A 1J4JA 3OB2B 1CX8A 3PFEA 1RXTA 4C7HA 1VIXA 1JDBC 1MK4A 3GB0A 4M85A 3PBEA 5A28A 3RNZA 2Z3OA 3GUXA 3LODA 3NFZA 2HV2A 2ZOGA 3FECA 4KOXA 1M1DA 1DIKA 2V8VA 1XJOA 2ZEGA 2PJAA 2WPXA 3EO4A 4I49A 2G9DA 1LCPA 1XMTA 5IX3A 4P4DA
chains in the Genus database with same CATH topology
1BLLE 3KGQA 2GU2A 2V8HA 4ZI6A 1DE4C 4PQAA 3B3WA 4FUUA 2CTCA 4P45A 2C6GA 3IFEA 4UIAA 5IB9A 3RAMA 1BPNA 3V38A 3KI9A 4NGMA 1F2OA 4ZX8A 2F8HA 4OC0A 4C9EA 4C86A 3NH4A 2I3CA 2CTBA 4KNGE 3H8GA 4C85A 4PXDA 1TKHA 1CP7A 3VH9A 4CDKA 2NYQA 4P4JA 2GP4A 3FJUA 3RZAA 3PEIA 4ZY0A 3S9LA 2FVGA 5HVFA 2ZEEA 2CF4A 2PJ0A 4B6ZA 3SI0A 4IHMA 4UEEA 4JZ0A 4MHPA 5ELYA 3KQXA 3I74A 4ZY2A 3MRUA 2XEGA 4F9VA 4P44A 4FBEA 2PVWA 4O23A 3PRTA 3L2NA 4MCRA 3DLJA 3TC8A 1EE3P 1YLOA 4C8TA 3IO1A 4PXCA 4R6TA 3WC6A 2ZENA 5LYFA 2EK8A 1TXRA 2HB6A 3B35A 3WABA 3FEDA 2Q43A 3PBBA 1LFWA 3IWWA 4P10A 3SJXA 4X8IA 3K9TA 4C8CA 3BHXA 4P4EA 3B7IA 2GLFA 2ZOFA 1XF1A 5D29A 3I6SA 1CP6A 4CDJA 4R7MA 4P4FA 3D7HA 3ISXA 3TX8A 2PCUA 2QJ8A 4GM5A 4PXBA 3PB8X 4C9RA 3SI1A 1LAMA 1AMPA 5HVGA 1ZLHA 1YSJA 3ISZA 1TF9A 1HEEA 3SJFA 3WT4A 2HC9A 3JRUA 1F57A 2IMOA 4KSIA 4EFDA 1JQGA 2ZEDA 1ELMP 2PJ6A 2V77A 3B3SA 4LQGA 3N5FA 4A38A 3RBUA 3KHZA 1ELLP 2F7VA 3PFOA 1VHEA 2XEJA 3LMSA 4NFRA 4ZY1A 3BXMA 2BOAA 4A37A 4UEFA 2C1CA 2WZNA 4FWUA 3KASA 1R43A 3LWUA 4NJRA 4X2TA 5DS0A 4RUHA 4X3RA 3D4UA 4OC4A 5JM6A 3KHXA 3EIFA 5CPAA 5D8NA 2PJ3A 4IK2A 1R3NA 1ZG9A 2AFXA 4WJBA 5LRGA 4Z65A 1LANA 6CPAA 3CT9A 2VL1A 2ZEHA 4DJLA 5K8MA 2QYVA 1OBRA 5LRKA 3IC1A 2ZEFA 4NGQA 3KL9A 2RFHA 1BAVA 1IY7A 8CPAA 5IR2A 3SJEA 3QNVA 1M4LA 2C6CA 2QVPA 3BI1A 4DYOA 2GLJA 1HDQA 2PJ9A 5K8OA 4MHNA 1AYEA 1WVMA 2ANPA 3D66A 1TF8A 4MXUA 1CPSA 1BPMA 1CPXA 2BO9A 2C5QA 3S9NA 1TKFA 4NGRA 1FNOA 3H8EA 4CPAA 1Y9ZA 4NGNA 4F8ZA 4MRIA 1PYTB 2PJ4A 3B3TA 2AFUA 2PJCA 3IEHA 5F09A 3FX6A 1ZG8A 2AFOA 4OKOA 4OMEA 3V7ZA 4Q7AA 4ZYQA 2EK9A 1IGBA 2V8DA 5JGFA 4P4IA 3B3CA 2V8GA 1Y7EA 4IAVA 5LYLA 1YW6A 3KZWA 5THWA 3I1UA 2AFWA 2PIZA 2DEAA 4PXEA 2NSMA 3D67A 2EWBA 2PVVA 1YMEA 2AFMA 4C9UA 3IIBA 4W9YA 2PJ8A 4ONWA 4UIBA 1ZLIA 4F9UA 3D7FA 2OOTA 3S9MA 3CDXA 3CPXA 2JBJA 1KWMA 3VATA 1H8LA 4OC5A 1F2PA 4OIWA 3FEEA 1QQ9A 4G1PA 4UF4A 4FAIA 3KR5A 3PB4X 1CG2A 2OR4A 3K2KA 3T8WA 2Q4ZA 5J1QA 4C8FA 2IJZA 3CPAA 3GLJA 4MMOA 2PJ7A 2IQ6A 4TNUA 3VARA 1TKJA 4MHZA 4EMEA 2ZEOA 4WWVA 3BI0A 2JEWA 2PJ1A 3D7GA 4C84A 3IJ3A 4EWTA 1HDUA 1VGYA 3DGVA 4OP4A 2AFSA 1Z2LA 2PE3A 2ZEMA 5K8NA 2BCOA 3PB7X 2C6PA 2XEFA 4C99A 1LOKA 3KR4A 4MCSA 4YN3A 4MCPA 4OC3A 5LYDA 4UEZA 3FVLA 4OIDA 1RTQA 1Y0YA 3SJGA 1YW4A 1FT7A 2PJ2A 2JBKA 2WYRA 4PPZA 4OC1A 4A39A 4ZX9A 3PB6X 2RB7A 1LAPA 1XBUA 1XMBA 3B2YA 3MN8A 4NGSA 2J9AA 4YU9A 4C9VA 1Z5RA 5LRJA 5I4MA 4P4BA 2AFZA 1ARLA 3NH8A 3HLPA 1PCAA 5HVHA 4MCQA 1Y0RA 2ABZA 3FH4A 3ICUA 1XRYA 3NH5A 3D7DA 4C8UA 1V6CA 3H8FA 4A94A 1Q7LA 1DTDA 5LYIA 7CPAA 1GYTA 2Q51A 4DUKA 4AXVA 2XEIA 4NGPA 3SI2A 3WC7A 2PIYA 4R76A 3B3VA 2O4HA 4H2KA 5CBMA 4JYWA 4C8AA 4P6YA 1VHOA 1CBXA 3PB9X 2ZELA 4TJVA 4R8FA 4TWEA 4YWYA 2PJ5A 3FMCA 1XFOA 2ZEPA 3VTAA 4NJQA 2O53A 5HXDA 1ARMA 2CIJA 5K8PA 2GREA 3D68A 4C9AA 1NSAA 4BD9A 2PRQA 1ZG7A 1QMUA 1UWYA 1Z8LA 4MHYA 3FF3A 2PJBA 3HUVA 5JH9A 3NA6A 3WC5A 4NGTA 3KQZA 4K3NA 4TJXA 2POKA 4OC2A 1CX8A 3PFEA 1VIXA 3GB0A 3PBEA 3GUXA 3NFZA 2ZOGA 3FECA 2V8VA 1XJOA 2ZEGA 2PJAA 4C8PA 2G9DA 1LCPA 4P4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLL E;  3KGQ A;  2GU2 A;  2V8H A;  4ZI6 A;  1DE4 C;  4PQA A;  3B3W A;  4FUU A;  2CTC A;  4P45 A;  2C6G A;  3IFE A;  4UIA A;  5IB9 A;  3RAM A;  1BPN A;  3V38 A;  3KI9 A;  4NGM A;  1F2O A;  4ZX8 A;  2F8H A;  4OC0 A;  4C9E A;  4C86 A;  3NH4 A;  2I3C A;  2CTB A;  4KNG E;  3H8G A;  4C85 A;  4PXD A;  1TKH A;  1CP7 A;  3VH9 A;  4CDK A;  2NYQ A;  4P4J A;  3FJU A;  3RZA A;  3PEI A;  4ZY0 A;  3S9L A;  2FVG A;  5HVF A;  2ZEE A;  2CF4 A;  2PJ0 A;  4B6Z A;  3SI0 A;  4IHM A;  4UEE A;  4JZ0 A;  4MHP A;  5ELY A;  3KQX A;  3I74 A;  4ZY2 A;  3MRU A;  2XEG A;  4F9V A;  4P44 A;  4FBE A;  2PVW A;  4O23 A;  3PRT A;  3L2N A;  4MCR A;  3DLJ A;  3TC8 A;  1EE3 P;  1YLO A;  4C8T A;  3IO1 A;  4PXC A;  4R6T A;  3WC6 A;  2ZEN A;  5LYF A;  2EK8 A;  1TXR A;  2HB6 A;  3B35 A;  3WAB A;  3FED A;  2Q43 A;  3PBB A;  1LFW A;  3IWW A;  4P10 A;  3SJX A;  4X8I A;  3K9T A;  4C8C A;  3BHX A;  4P4E A;  3B7I A;  2GLF A;  2ZOF A;  1XF1 A;  5D29 A;  3I6S A;  1CP6 A;  4CDJ A;  4R7M A;  4P4F A;  3D7H A;  3ISX A;  3TX8 A;  2PCU A;  2QJ8 A;  4GM5 A;  4PXB A;  3PB8 X;  4C9R A;  3SI1 A;  1LAM A;  1AMP A;  5HVG A;  1ZLH A;  1YSJ A;  3ISZ A;  1TF9 A;  1HEE A;  3SJF A;  3WT4 A;  2HC9 A;  3JRU A;  1F57 A;  2IMO A;  4KSI A;  4EFD A;  1JQG A;  2ZED A;  1ELM P;  2PJ6 A;  2V77 A;  3B3S A;  4LQG A;  3N5F A;  4A38 A;  3RBU A;  3KHZ A;  1ELL P;  2F7V A;  3PFO A;  1VHE A;  2XEJ A;  3LMS A;  4NFR A;  4ZY1 A;  3BXM A;  2BOA A;  4A37 A;  4UEF A;  2C1C A;  2WZN A;  4FWU A;  3KAS A;  1R43 A;  3LWU A;  4NJR A;  4X2T A;  5DS0 A;  4RUH A;  4X3R A;  3D4U A;  4OC4 A;  5JM6 A;  3KHX A;  3EIF A;  5CPA A;  5D8N A;  2PJ3 A;  4IK2 A;  1R3N A;  1ZG9 A;  2AFX A;  4WJB A;  5LRG A;  4Z65 A;  1LAN A;  6CPA A;  3CT9 A;  2VL1 A;  2ZEH A;  4DJL A;  5K8M A;  2QYV A;  1OBR A;  5LRK A;  3IC1 A;  2ZEF A;  4NGQ A;  3KL9 A;  2RFH A;  1BAV A;  1IY7 A;  8CPA A;  3SJE A;  3QNV A;  1M4L A;  2C6C A;  2QVP A;  3BI1 A;  4DYO A;  2GLJ A;  1HDQ A;  2PJ9 A;  5K8O A;  4MHN A;  1AYE A;  1WVM A;  2ANP A;  3D66 A;  1TF8 A;  4MXU A;  1CPS A;  1BPM A;  1CPX A;  2BO9 A;  3S9N A;  1TKF A;  4NGR A;  1FNO A;  3H8E A;  4CPA A;  1Y9Z A;  4NGN A;  4F8Z A;  4MRI A;  1PYT B;  2PJ4 A;  3B3T A;  2AFU A;  2PJC A;  3IEH A;  5F09 A;  3FX6 A;  1ZG8 A;  2AFO A;  4OKO A;  4OME A;  3V7Z A;  4Q7A A;  4ZYQ A;  2EK9 A;  1IGB A;  2V8D A;  5JGF A;  4P4I A;  3B3C A;  2V8G A;  1Y7E A;  4IAV A;  5LYL A;  1YW6 A;  3KZW A;  5THW A;  3I1U A;  2AFW A;  2PIZ A;  2DEA A;  4PXE A;  2NSM A;  3D67 A;  2EWB A;  2PVV A;  1YME A;  2AFM A;  4C9U A;  3IIB A;  4W9Y A;  2PJ8 A;  4ONW A;  4UIB A;  1ZLI A;  4F9U A;  3D7F A;  2OOT A;  3S9M A;  3CDX A;  3CPX A;  2JBJ A;  1KWM A;  3VAT A;  1H8L A;  4OC5 A;  1F2P A;  4OIW A;  3FEE A;  1QQ9 A;  4G1P A;  4UF4 A;  4FAI A;  3KR5 A;  3PB4 X;  1CG2 A;  2OR4 A;  3K2K A;  3T8W A;  2Q4Z A;  5J1Q A;  4C8F A;  2IJZ A;  3CPA A;  3GLJ A;  4MMO A;  2PJ7 A;  2IQ6 A;  4TNU A;  3VAR A;  1TKJ A;  4MHZ A;  4EME A;  2ZEO A;  4WWV A;  3BI0 A;  2JEW A;  2PJ1 A;  3D7G A;  4C84 A;  3IJ3 A;  4EWT A;  1HDU A;  1VGY A;  3DGV A;  4OP4 A;  2AFS A;  1Z2L A;  2PE3 A;  2ZEM A;  5K8N A;  2BCO A;  3PB7 X;  2C6P A;  2XEF A;  4C99 A;  1LOK A;  3KR4 A;  4MCS A;  4YN3 A;  4MCP A;  4OC3 A;  5LYD A;  4UEZ A;  3FVL A;  4OID A;  1RTQ A;  1Y0Y A;  3SJG A;  1YW4 A;  1FT7 A;  2PJ2 A;  2JBK A;  2WYR A;  4PPZ A;  4OC1 A;  4A39 A;  4ZX9 A;  3PB6 X;  2RB7 A;  1LAP A;  1XBU A;  1XMB A;  3B2Y A;  3MN8 A;  4NGS A;  2J9A A;  4YU9 A;  4C9V A;  1Z5R A;  5LRJ A;  5I4M A;  4P4B A;  2AFZ A;  1ARL A;  3NH8 A;  3HLP A;  1PCA A;  5HVH A;  4MCQ A;  1Y0R A;  2ABZ A;  3FH4 A;  3ICU A;  1XRY A;  3NH5 A;  3D7D A;  4C8U A;  1V6C A;  3H8F A;  4A94 A;  1Q7L A;  1DTD A;  5LYI A;  7CPA A;  1GYT A;  2Q51 A;  4DUK A;  4AXV A;  2XEI A;  4NGP A;  3SI2 A;  3WC7 A;  2PIY A;  4R76 A;  3B3V A;  2O4H A;  4H2K A;  5CBM A;  4JYW A;  4C8A A;  4P6Y A;  1VHO A;  1CBX A;  3PB9 X;  2ZEL A;  4TJV A;  4R8F A;  4TWE A;  4YWY A;  2PJ5 A;  3FMC A;  1XFO A;  2ZEP A;  3VTA A;  4NJQ A;  2O53 A;  5HXD A;  1ARM A;  2CIJ A;  5K8P A;  2GRE A;  3D68 A;  4C9A A;  1NSA A;  4BD9 A;  2PRQ A;  1ZG7 A;  1QMU A;  1UWY A;  1Z8L A;  4MHY A;  3FF3 A;  2PJB A;  3HUV A;  5JH9 A;  3NA6 A;  3WC5 A;  4NGT A;  3KQZ A;  4K3N A;  4TJX A;  2POK A;  4OC2 A;  1CX8 A;  3PFE A;  1VIX A;  3GB0 A;  3PBE A;  3GUX A;  3NFZ A;  2ZOG A;  3FEC A;  2V8V A;  1XJO A;  2ZEG A;  2PJA A;  4C8P A;  2G9D A;  1LCP A;  4P4D A; 
#chains in the Genus database with same CATH topology
 1BLL E;  3D2M A;  1Z9U A;  3CXQ A;  3FRM A;  3KGQ A;  2GU2 A;  2V8H A;  4ZI6 A;  1DE4 C;  4JWP A;  3UY5 A;  1XE4 A;  4PQA A;  3H5Z A;  4E5S A;  3B3W A;  4KOS A;  4M6H A;  3T90 A;  4JXQ A;  4FUU A;  4KOW A;  4EYS A;  2CTC A;  3G8W A;  4P45 A;  2C6G A;  2WUU A;  3IFE A;  4UIA A;  5IB9 A;  1T36 B;  4H6U A;  3CXS A;  5JYB A;  2FIW A;  1BPN A;  3RAM A;  5J8F A;  4JLY A;  3V38 A;  1GGO A;  1EO0 A;  2HWG A;  5FD8 A;  3BJ7 A;  2PC1 A;  4C8P A;  3KI9 A;  3BUO B;  4A4B A;  3PZJ A;  4B5O A;  3O8Z A;  4NGM A;  2ZW7 A;  2D4P A;  4FD7 A;  4HNX B;  4J0N A;  5F5X A;  1F2O A;  1YVH A;  3A9L A;  4ZX8 A;  2F8H A;  1YVK A;  3NE7 A;  4FD6 A;  4PSW A;  4OC0 A;  4YRH A;  4F0X A;  5FVJ A;  2EZB A;  4C86 A;  2CNT A;  4AVA A;  1NXJ A;  4C9E A;  3DNS A;  3NH4 A;  4NCZ A;  5IV0 A;  3QAH A;  2I3C A;  2CTB A;  4UFX A;  3V8I A;  2EZA A;  4KNG E;  3H8G A;  3T07 A;  4C85 A;  4PXD A;  4CGN A;  1Z9E A;  4KLW A;  3EY5 A;  1TKH A;  3S6H A;  2K5T A;  4A4C A;  3PFV A;  1CP7 A;  4NXY A;  3S6K A;  1A2Z A;  3TO6 A;  4CAV A;  1MJ9 A;  4UCM A;  3HPG G;  3VH9 A;  3TLE A;  3CXP A;  4FD5 A;  2HRO A;  4COB A;  2ATR A;  3IGR A;  2PQ8 A;  1YVO A;  1Z4E A;  1X10 A;  2NYQ A;  4KVX A;  2ZPA A;  4P4J A;  4CDK A;  2GP4 A;  1YQE A;  2BL1 A;  3FJU A;  3RZA A;  1QSN A;  3PEI A;  2Z3M A;  2B4D A;  3TO7 A;  4ZY0 A;  4R57 A;  2AUN A;  2ODF A;  1YLE A;  3S9L A;  2FVG A;  4AG9 A;  5HVF A;  2ZEE A;  3R1K A;  2CF4 A;  2PJ0 A;  4Y49 C;  4B6Z A;  2OU2 A;  3SI0 A;  4IHM A;  3BUX B;  4MJ8 A;  1ON0 A;  4UEE A;  5F46 A;  4KOT A;  5HKW A;  2KCW A;  3VWE A;  3NOJ A;  3PLF B;  4JZ0 A;  3E0K A;  2J8M A;  4MHP A;  3FXT A;  5ELY A;  3KQX A;  2Q44 A;  5JQ4 A;  2B0A A;  4MI1 A;  2XPP A;  3I74 A;  4ZY2 A;  3MRU A;  1XEB A;  2B4J C;  2XEG A;  2Y1M A;  4F9V A;  4P44 A;  4FBE A;  4A95 A;  3SXO A;  3VGO A;  2PVW A;  5HKZ A;  4O23 A;  4B14 A;  3FB3 A;  3FYN A;  3IU1 A;  4M6I A;  1X12 A;  3PRT A;  3L2N A;  3K4I A;  4MCR A;  4QB9 A;  3EFA A;  3DLJ A;  4C2X A;  3TLY A;  3TC8 A;  4JVO A;  1EE3 P;  2AUM A;  2N3A B;  1YLO A;  3FNC A;  3IO1 A;  4PXC A;  4R6T A;  3WC6 A;  4B11 A;  4C8T A;  2ZEN A;  1S7L A;  5G21 A;  1IU8 A;  4IF5 A;  5LYF A;  2EK8 A;  4INJ A;  1Z4R A;  1VBH A;  5AG6 A;  5EMI A;  1TXR A;  2HB6 A;  5GCN A;  3B35 A;  3WAB A;  1J3L A;  3FED A;  1KZF A;  3GY9 A;  2O28 A;  2Q43 A;  3PBB A;  4H1H A;  1LFW A;  3IWW A;  2UV8 G;  4BPU B;  4QVT A;  4P10 A;  5AXI A;  3SJX A;  1M44 A;  3EC4 A;  4X8I A;  2QEC A;  5CNP A;  3K9T A;  4C8C A;  1YX0 A;  2XPL A;  4KSA A;  3BHX A;  2YNE A;  2D0P A;  4P4E A;  3R96 A;  2Z11 A;  1I12 A;  4QUS A;  1VBG A;  1QST A;  3B7I A;  2GLF A;  2CNM A;  4RR2 B;  2I79 A;  2ZOF A;  5D29 A;  1XF1 A;  3I6S A;  1CP6 A;  4CDJ A;  4R7M A;  2BSW A;  2BUE A;  2J8R A;  4P4F A;  4FD4 A;  3IWE A;  3D7H A;  4MHD A;  5KTC A;  3TLA A;  3ISX A;  3TX8 A;  2PCU A;  3TO9 A;  1IOF A;  1VI4 A;  2QJ8 A;  3BUM B;  4JXR A;  2FM4 A;  4GM5 A;  4E2A A;  2DXQ A;  3I9S A;  4PSX A;  4PXB A;  4GXH A;  3PB8 X;  4C7I A;  4C9R A;  3SI1 A;  1LAM A;  1AMP A;  1P4N A;  5HVG A;  1ZLH A;  4UWI A;  2HI6 A;  4Q38 A;  1NE9 A;  1Q2D A;  1YSJ A;  1TF9 A;  1HEE A;  3ISZ A;  1KC7 A;  3SJF A;  2IL4 A;  2HC9 A;  3WT4 A;  4HNY B;  2PSW A;  3IWG A;  2EBJ A;  3JRU A;  1F57 A;  2Q0Y A;  2IMO A;  3P2F A;  2B3V A;  4KSI A;  4EFD A;  1YR0 A;  2P6G A;  1JQG A;  2ZED A;  1ELM P;  2PJ6 A;  2R98 A;  2V77 A;  3B3S A;  4HNW B;  4R3L A;  4LQG A;  1S7N A;  3LAC A;  3N5F A;  4U9Z A;  3R9F A;  4A38 A;  3RBU A;  3KHZ A;  1CE8 B;  1BOB A;  1CM0 A;  2CY2 A;  1ELL P;  2F7V A;  3PFO A;  2EZC A;  1CJW A;  1VHE A;  2WPW A;  3EZA A;  3W6X A;  2XEJ A;  3I3G A;  4XPL A;  2B5G B;  3LMS A;  4NFR A;  2XPN A;  3BXM A;  2BOA A;  4NSQ A;  4A37 A;  2YNC C;  4UEF A;  2C1C A;  3F5B A;  5F47 A;  2Q7B A;  2WZN A;  4FWU A;  4AB7 A;  3KAS A;  1R43 A;  1MJA A;  1WK4 A;  4IIY A;  3LWU A;  4NJR A;  1U6M A;  3EZB A;  2GFQ A;  4GPL B;  2OZG A;  4X2T A;  5DS0 A;  4B12 A;  4BMH A;  4RUH A;  4X3R A;  3D4U A;  4OC4 A;  1K4J A;  2FCK A;  3KHX A;  4QC6 A;  1Q2Y A;  5CPA A;  4MY0 A;  4YGO A;  2PJ3 A;  5D8N A;  4II9 A;  3EIF A;  4IK2 A;  4RI1 A;  4L8A A;  4B5P A;  1R3N A;  1IID A;  3KKW A;  3U1B A;  2Y1N A;  1ZG9 A;  4NEX A;  3D2P A;  4R9M A;  2AFX A;  1EZB A;  4C2Y A;  4CYP A;  2Y0M A;  5H84 A;  4WJB A;  5LRG A;  4BBH A;  4Z65 A;  1LAN A;  6CPA A;  4YFJ A;  4JJX A;  1IIC A;  5ISV A;  3CT9 A;  4BTF A;  2VL1 A;  4ZGY B;  3R9E A;  2ZEH A;  2JDD A;  4DJL A;  5K8M A;  2QYV A;  4M8D A;  1OBR A;  3ZNI A;  5LRK A;  1B87 A;  3IC1 A;  1IYK A;  2G3A A;  1B47 A;  2ARH A;  4A32 A;  2ZEF A;  2ZXV A;  2FXF A;  4M3S A;  4NGQ A;  3KL9 A;  2RFH A;  3GJZ A;  1BAV A;  1ZL0 A;  1TIQ A;  1XIX A;  1IY7 A;  1IYL A;  3TTH A;  3HMJ G;  8CPA A;  5HVH A;  5IR2 A;  3SJE A;  3QNV A;  1M4L A;  2Z3L A;  2C6C A;  2QVP A;  1YK3 A;  3LD2 A;  1S5K A;  4R87 A;  3SXN A;  3BI1 A;  2VI7 A;  4J3G A;  4KVM E;  4DYO A;  4UA3 A;  4CYQ A;  2GLJ A;  1HDQ A;  2PJ9 A;  4Q36 A;  5K8O A;  1XF8 A;  4MHN A;  4ONU A;  4CYN A;  1AYE A;  3GKR A;  2REE A;  4CGL A;  1WVM A;  2ANP A;  3D66 A;  1Q5X A;  4KOR A;  1TF8 A;  1CPS A;  4MXU A;  1BPM A;  1CPX A;  1KUY A;  2BO9 A;  3PP9 A;  2Q7S A;  2C5Q A;  3TYX A;  4UWJ A;  2VEZ A;  3S9N A;  4MI4 A;  1TKF A;  2B5G A;  3D8P A;  4E8O A;  3F9K C;  3B8G A;  3K9U A;  5JM6 A;  3KRV A;  4NGR A;  1FNO A;  1WWZ A;  2EVN A;  2HQY A;  3H8E A;  4PK2 A;  4XNH B;  2PR8 A;  3T0T A;  4CPA A;  2B3U A;  2EO8 A;  2YGW A;  1Y9Z A;  2VXK A;  4NGN A;  1QSM A;  3U88 C;  4F8Z A;  1Y9K A;  4MRI A;  2PRB A;  1PYT B;  2PJ4 A;  3B3T A;  2FE7 A;  2CNS A;  3DDD A;  2AFU A;  2FT0 A;  3EZE A;  2PJC A;  3IEH A;  5F09 A;  3FX6 A;  1ZG8 A;  4X5K A;  1S3Z A;  2QML A;  4B5P B;  3DR8 A;  2AFO A;  1FY7 A;  4OKO A;  4AVC A;  4OME A;  1C3O B;  3V7Z A;  4Q7A A;  4ZYQ A;  2FS5 A;  2EK9 A;  1IGB A;  1EZA A;  4BPW B;  2Q4V A;  2V8D A;  3BJ8 A;  2ZW6 A;  3T9Y A;  4P4I A;  5JGF A;  3B3C A;  2V8G A;  1Y7E A;  4IAV A;  4UFW A;  3OWC A;  4B13 A;  5LYL A;  4IIX A;  3JVN A;  3W6S A;  1YW6 A;  3KZW A;  2D4O A;  2R8V A;  4DNC A;  1OZP A;  4H89 A;  5AG4 A;  2AJ6 A;  2CBL A;  5THW A;  2WSA A;  3I1U A;  5DWN A;  2AFW A;  2GAN A;  2PIZ A;  2RC4 A;  5J8C A;  1NBW A;  2H5M A;  4CGO A;  2YJV A;  1AUG A;  2JEV A;  2Z10 A;  1KUX A;  1N71 A;  2NMT A;  2DEA A;  2YND A;  2GIV A;  2G0B A;  1S7F A;  2NSM A;  3D67 A;  1Z8W A;  4PXE A;  2EWB A;  1YRE A;  2A4N A;  1YME A;  2PVV A;  2XPO A;  2AFM A;  4AVB A;  5A27 A;  1CS0 B;  4C9U A;  3IIB A;  4W9Y A;  2PJ8 A;  5F1Y A;  1PU9 A;  1B6B A;  4KSF A;  4CAW A;  1LRZ A;  4ONW A;  1BXR B;  4UIB A;  5EBV A;  3GIU A;  2REF A;  3TOB A;  1GHE A;  1ZLI A;  2J8N A;  4F9U A;  4CO9 A;  3D7F A;  2OOT A;  4E0A A;  3S9M A;  1QSR A;  2B4D B;  2HUZ A;  3CDX A;  1QSO A;  3CPX A;  2JBJ A;  4OAE A;  1KWM A;  3VAT A;  1P0H A;  2D0O A;  1H8L A;  4PK3 A;  3C26 A;  1VHS A;  3MGD A;  3R9G A;  3TE4 A;  1C30 B;  4OC5 A;  1F2P A;  4MY3 A;  3FEE A;  4OIW A;  4BPX B;  1QQ9 A;  3GYA A;  4KLV A;  2BEI A;  2OLS A;  4G1P A;  5BWA B;  4UF4 A;  4FAI A;  2I00 A;  4KOU A;  3KR5 A;  3PB4 X;  4CAE A;  1CG2 A;  2OR4 A;  3EXN A;  3K2K A;  4KUB A;  4A31 A;  5AG5 A;  3T8W A;  2JLM A;  3ZJ0 A;  2PCN A;  2Q4Z A;  3JTK A;  4H6Z A;  5AGE A;  5J1Q A;  4C8F A;  5HKY A;  1IB1 E;  2IJZ A;  3CPA A;  3GLJ A;  2OZU A;  5JVL A;  4NF1 A;  2B58 A;  4MMO A;  4QBJ A;  2AE6 A;  2PJ7 A;  5EC4 A;  4KOY A;  1Q2C A;  1UFH A;  4CAF A;  1S60 A;  2P6E A;  2IQ6 A;  2R1I A;  4TNU A;  3TLG A;  1M6V B;  4UBR A;  3VAR A;  3JUW A;  4UCN A;  4UFV A;  1TKJ A;  3D3S A;  3QAY A;  5DWM A;  4A30 A;  4MHZ A;  2OB0 A;  4U9Y A;  4XPD B;  4B10 A;  4EME A;  3TLC A;  4COG A;  2VZZ A;  2R7H A;  5K99 A;  2ZEO A;  3IU2 A;  5F13 A;  1PUA A;  2C27 A;  4OLL A;  3BI0 A;  4WWV A;  1RO5 A;  5AG7 A;  2JEW A;  3SHP A;  2PJ1 A;  4F0Y A;  4M6G A;  4C2Z A;  3D7G A;  3VRO A;  4XPD C;  4C84 A;  5KTA A;  5BY0 A;  5KTD A;  3IJ3 A;  4EWT A;  1HDU A;  1VGY A;  2JDC A;  3DGV A;  2E28 A;  2ZW5 A;  2B4B A;  3ZZI A;  4C68 A;  3VRQ A;  4MBU A;  4OP4 A;  2AFS A;  5C82 A;  1Z2L A;  1A9X B;  1ZRS A;  2R82 A;  3DR6 A;  2PE3 A;  4EVY A;  5HMN A;  1SQH A;  1I1D A;  2ZEM A;  5K8N A;  3BUW B;  2BCO A;  3H4Q A;  3PB7 X;  4LQ6 A;  2C6P A;  5E96 A;  2XEF A;  5F9M A;  4C99 A;  3N7Z A;  1LOK A;  4JD6 A;  4BIN A;  3KR4 A;  2ZW4 A;  4MCS A;  4UCP A;  4YN3 A;  4MCP A;  4MFJ A;  4KUA A;  4XNH C;  3SR3 A;  1KBL A;  4KOV A;  4OC3 A;  5LYD A;  2F5I A;  3VRN A;  2FIA A;  4UEZ A;  3FVL A;  4OID A;  1RTQ A;  2VZY A;  3TLG B;  2Q04 A;  3QB8 A;  1Y0Y A;  3FBU A;  3HPH E;  3T5M A;  3SJG A;  1YW4 A;  1FT7 A;  3BLN A;  4PV6 A;  2PJ2 A;  2VQY A;  2JBK A;  2WYR A;  4CRZ B;  4HPS A;  1I21 A;  4PPZ A;  3WR7 A;  1M4D A;  4OC1 A;  5J3X A;  4A39 A;  1BO4 A;  3PB6 X;  4ZX9 A;  2RB7 A;  4KZT A;  4CYO A;  1LAP A;  2FL4 A;  1XBU A;  1Y9W A;  1XMB A;  3VRR A;  3B2Y A;  3MN8 A;  3VRP A;  4MFK A;  4XPK A;  5F48 A;  4NGS A;  3RYO A;  4CZ1 A;  3DSB A;  2J9A A;  4YU9 A;  4C9V A;  5JPH A;  1Z5R A;  4LX9 A;  4A33 A;  5LRJ A;  4CRY B;  5I4M A;  3S6G A;  3OP0 A;  4P4B A;  5C88 A;  2AFZ A;  1ARL A;  4AG7 A;  3OB1 B;  2G3T A;  3NH8 A;  4L89 A;  4MFZ A;  4OAD A;  3PGP A;  1NSL A;  3HLP A;  1JDE A;  2Z3K A;  3TLB A;  1PCA A;  3BUN B;  4ZY1 A;  4MCQ A;  1M4G A;  1Y0R A;  1Y7R A;  2ABZ A;  3TOA A;  2DPT A;  3FH4 A;  4GS4 A;  4KS9 A;  5H86 A;  2MP0 A;  1XRY A;  3ICU A;  3NH5 A;  2FSR A;  2P6F A;  2YNC A;  3F8K A;  3PT1 A;  3D7D A;  4C8U A;  1V6C A;  3H8F A;  4A94 A;  1Q7L A;  1DTD A;  5LYI A;  5IB0 A;  1ZO0 A;  3C8O A;  1KEE B;  7CPA A;  1GYT A;  1L0C A;  1Z8X A;  1S7K A;  2QIR A;  3W91 A;  5G22 A;  2Q51 A;  4DUK A;  4MFL A;  4HKF A;  1M4I A;  2EUI A;  4KVO E;  4AXV A;  2XEI A;  4ORF A;  2DPS A;  4CGM A;  1IOI A;  4NGP A;  1V0C A;  3SI2 A;  3CZX A;  3WC7 A;  3TLZ A;  2PIY A;  4MJX A;  2Q4Y A;  4CS0 B;  2P0W A;  2PDO A;  4R76 A;  3B3V A;  2GE3 A;  4RN7 A;  3NFQ A;  3NE8 A;  4CGP A;  2O4H A;  4H2K A;  3TT2 A;  5CBM A;  4JYW A;  1JWQ A;  5I0C A;  4C8A A;  3OAK A;  4P6Y A;  1VHO A;  1CBX A;  3G3S A;  3PB9 X;  4CAX A;  3F0A A;  2ZEL A;  1R61 A;  1MJB A;  2DIK A;  1YGH A;  4TJV A;  4U5Y A;  4R8F A;  2CXA A;  5G20 A;  2DLA A;  3TCV A;  3FIX A;  4TWE A;  4A2Z A;  4YWY A;  1KUV A;  2PJ5 A;  2Z3P A;  2VKZ G;  3FMC A;  4E94 A;  1NMT A;  3G23 A;  2OZH A;  1FBV A;  1XFO A;  3P2H A;  4IUS A;  4K30 A;  5HH1 A;  5F49 A;  2ZEP A;  2DF5 A;  4RS2 A;  1WJT A;  3TFY A;  1Z8T A;  2X0S A;  4ZBG A;  2VBQ A;  3VTA A;  1R57 A;  2YJT A;  4NJQ A;  2O53 A;  3RO0 A;  5HXD A;  1ARM A;  1VKC A;  2CIJ A;  3VWD A;  5K8P A;  2GRE A;  3D68 A;  4C9A A;  4MFQ A;  4Y49 B;  1NSA A;  3R95 A;  4BD9 A;  2PRQ A;  2Z3N A;  1ZG7 A;  4F6A A;  4MFP A;  1QMU A;  1UWY A;  1Z8L A;  4MHY A;  1ZYM A;  2PR1 A;  3FF3 A;  2PJB A;  2OH1 A;  3HUV A;  5JH9 A;  3T05 A;  5G1Z A;  3NA6 A;  3WC5 A;  4NGT A;  2X7B A;  2Z0Z A;  4LUA A;  3KQZ A;  4K3N A;  1XOV A;  4R3K A;  3S6F A;  4TJX A;  2POK A;  4OC2 A;  1J4J A;  3OB2 B;  1CX8 A;  3PFE A;  1RXT A;  4C7H A;  1VIX A;  1JDB C;  1MK4 A;  3GB0 A;  4M85 A;  3PBE A;  5A28 A;  3RNZ A;  2Z3O A;  3GUX A;  3LOD A;  3NFZ A;  2HV2 A;  2ZOG A;  3FEC A;  4KOX A;  1M1D A;  1DIK A;  2V8V A;  1XJO A;  2ZEG A;  2PJA A;  2WPX A;  3EO4 A;  4I49 A;  2G9D A;  1LCP A;  1XMT A;  5IX3 A;  4P4D A; 
#chains in the Genus database with same CATH homology
 1BLL E;  3KGQ A;  2GU2 A;  2V8H A;  4ZI6 A;  1DE4 C;  4PQA A;  3B3W A;  4FUU A;  2CTC A;  4P45 A;  2C6G A;  3IFE A;  4UIA A;  5IB9 A;  3RAM A;  1BPN A;  3V38 A;  3KI9 A;  4NGM A;  1F2O A;  4ZX8 A;  2F8H A;  4OC0 A;  4C9E A;  4C86 A;  3NH4 A;  2I3C A;  2CTB A;  4KNG E;  3H8G A;  4C85 A;  4PXD A;  1TKH A;  1CP7 A;  3VH9 A;  4CDK A;  2NYQ A;  4P4J A;  2GP4 A;  3FJU A;  3RZA A;  3PEI A;  4ZY0 A;  3S9L A;  2FVG A;  5HVF A;  2ZEE A;  2CF4 A;  2PJ0 A;  4B6Z A;  3SI0 A;  4IHM A;  4UEE A;  4JZ0 A;  4MHP A;  5ELY A;  3KQX A;  3I74 A;  4ZY2 A;  3MRU A;  2XEG A;  4F9V A;  4P44 A;  4FBE A;  2PVW A;  4O23 A;  3PRT A;  3L2N A;  4MCR A;  3DLJ A;  3TC8 A;  1EE3 P;  1YLO A;  4C8T A;  3IO1 A;  4PXC A;  4R6T A;  3WC6 A;  2ZEN A;  5LYF A;  2EK8 A;  1TXR A;  2HB6 A;  3B35 A;  3WAB A;  3FED A;  2Q43 A;  3PBB A;  1LFW A;  3IWW A;  4P10 A;  3SJX A;  4X8I A;  3K9T A;  4C8C A;  3BHX A;  4P4E A;  3B7I A;  2GLF A;  2ZOF A;  1XF1 A;  5D29 A;  3I6S A;  1CP6 A;  4CDJ A;  4R7M A;  4P4F A;  3D7H A;  3ISX A;  3TX8 A;  2PCU A;  2QJ8 A;  4GM5 A;  4PXB A;  3PB8 X;  4C9R A;  3SI1 A;  1LAM A;  1AMP A;  5HVG A;  1ZLH A;  1YSJ A;  3ISZ A;  1TF9 A;  1HEE A;  3SJF A;  3WT4 A;  2HC9 A;  3JRU A;  1F57 A;  2IMO A;  4KSI A;  4EFD A;  1JQG A;  2ZED A;  1ELM P;  2PJ6 A;  2V77 A;  3B3S A;  4LQG A;  3N5F A;  4A38 A;  3RBU A;  3KHZ A;  1ELL P;  2F7V A;  3PFO A;  1VHE A;  2XEJ A;  3LMS A;  4NFR A;  4ZY1 A;  3BXM A;  2BOA A;  4A37 A;  4UEF A;  2C1C A;  2WZN A;  4FWU A;  3KAS A;  1R43 A;  3LWU A;  4NJR A;  4X2T A;  5DS0 A;  4RUH A;  4X3R A;  3D4U A;  4OC4 A;  5JM6 A;  3KHX A;  3EIF A;  5CPA A;  5D8N A;  2PJ3 A;  4IK2 A;  1R3N A;  1ZG9 A;  2AFX A;  4WJB A;  5LRG A;  4Z65 A;  1LAN A;  6CPA A;  3CT9 A;  2VL1 A;  2ZEH A;  4DJL A;  5K8M A;  2QYV A;  1OBR A;  5LRK A;  3IC1 A;  2ZEF A;  4NGQ A;  3KL9 A;  2RFH A;  1BAV A;  1IY7 A;  8CPA A;  5IR2 A;  3SJE A;  3QNV A;  1M4L A;  2C6C A;  2QVP A;  3BI1 A;  4DYO A;  2GLJ A;  1HDQ A;  2PJ9 A;  5K8O A;  4MHN A;  1AYE A;  1WVM A;  2ANP A;  3D66 A;  1TF8 A;  4MXU A;  1CPS A;  1BPM A;  1CPX A;  2BO9 A;  2C5Q A;  3S9N A;  1TKF A;  4NGR A;  1FNO A;  3H8E A;  4CPA A;  1Y9Z A;  4NGN A;  4F8Z A;  4MRI A;  1PYT B;  2PJ4 A;  3B3T A;  2AFU A;  2PJC A;  3IEH A;  5F09 A;  3FX6 A;  1ZG8 A;  2AFO A;  4OKO A;  4OME A;  3V7Z A;  4Q7A A;  4ZYQ A;  2EK9 A;  1IGB A;  2V8D A;  5JGF A;  4P4I A;  3B3C A;  2V8G A;  1Y7E A;  4IAV A;  5LYL A;  1YW6 A;  3KZW A;  5THW A;  3I1U A;  2AFW A;  2PIZ A;  2DEA A;  4PXE A;  2NSM A;  3D67 A;  2EWB A;  2PVV A;  1YME A;  2AFM A;  4C9U A;  3IIB A;  4W9Y A;  2PJ8 A;  4ONW A;  4UIB A;  1ZLI A;  4F9U A;  3D7F A;  2OOT A;  3S9M A;  3CDX A;  3CPX A;  2JBJ A;  1KWM A;  3VAT A;  1H8L A;  4OC5 A;  1F2P A;  4OIW A;  3FEE A;  1QQ9 A;  4G1P A;  4UF4 A;  4FAI A;  3KR5 A;  3PB4 X;  1CG2 A;  2OR4 A;  3K2K A;  3T8W A;  2Q4Z A;  5J1Q A;  4C8F A;  2IJZ A;  3CPA A;  3GLJ A;  4MMO A;  2PJ7 A;  2IQ6 A;  4TNU A;  3VAR A;  1TKJ A;  4MHZ A;  4EME A;  2ZEO A;  4WWV A;  3BI0 A;  2JEW A;  2PJ1 A;  3D7G A;  4C84 A;  3IJ3 A;  4EWT A;  1HDU A;  1VGY A;  3DGV A;  4OP4 A;  2AFS A;  1Z2L A;  2PE3 A;  2ZEM A;  5K8N A;  2BCO A;  3PB7 X;  2C6P A;  2XEF A;  4C99 A;  1LOK A;  3KR4 A;  4MCS A;  4YN3 A;  4MCP A;  4OC3 A;  5LYD A;  4UEZ A;  3FVL A;  4OID A;  1RTQ A;  1Y0Y A;  3SJG A;  1YW4 A;  1FT7 A;  2PJ2 A;  2JBK A;  2WYR A;  4PPZ A;  4OC1 A;  4A39 A;  4ZX9 A;  3PB6 X;  2RB7 A;  1LAP A;  1XBU A;  1XMB A;  3B2Y A;  3MN8 A;  4NGS A;  2J9A A;  4YU9 A;  4C9V A;  1Z5R A;  5LRJ A;  5I4M A;  4P4B A;  2AFZ A;  1ARL A;  3NH8 A;  3HLP A;  1PCA A;  5HVH A;  4MCQ A;  1Y0R A;  2ABZ A;  3FH4 A;  3ICU A;  1XRY A;  3NH5 A;  3D7D A;  4C8U A;  1V6C A;  3H8F A;  4A94 A;  1Q7L A;  1DTD A;  5LYI A;  7CPA A;  1GYT A;  2Q51 A;  4DUK A;  4AXV A;  2XEI A;  4NGP A;  3SI2 A;  3WC7 A;  2PIY A;  4R76 A;  3B3V A;  2O4H A;  4H2K A;  5CBM A;  4JYW A;  4C8A A;  4P6Y A;  1VHO A;  1CBX A;  3PB9 X;  2ZEL A;  4TJV A;  4R8F A;  4TWE A;  4YWY A;  2PJ5 A;  3FMC A;  1XFO A;  2ZEP A;  3VTA A;  4NJQ A;  2O53 A;  5HXD A;  1ARM A;  2CIJ A;  5K8P A;  2GRE A;  3D68 A;  4C9A A;  1NSA A;  4BD9 A;  2PRQ A;  1ZG7 A;  1QMU A;  1UWY A;  1Z8L A;  4MHY A;  3FF3 A;  2PJB A;  3HUV A;  5JH9 A;  3NA6 A;  3WC5 A;  4NGT A;  3KQZ A;  4K3N A;  4TJX A;  2POK A;  4OC2 A;  1CX8 A;  3PFE A;  1VIX A;  3GB0 A;  3PBE A;  3GUX A;  3NFZ A;  2ZOG A;  3FEC A;  2V8V A;  1XJO A;  2ZEG A;  2PJA A;  4C8P A;  2G9D A;  1LCP A;  4P4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...