3SJFA

X-ray structure of human glutamate carboxypeptidase ii in complex with a urea-based inhibitor (a25)
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Novel Substrate-Based Inhibitors of Human Glutamate Carboxypeptidase II with Enhanced Lipophilicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 266
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3sjfA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3sjfA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3sjfA02
4ZY2A 1PCAA 4P10A 4YU9A 4H2KA 3KZWA 2PRQA 3KL9A 2XEJA 2BCOA 3WABA 4NJQA 4OC4A 2ZEPA 2GU2A 3D66A 4MXUA 1QMUA 4P4BA 4OC2A 4MHNA 3TX8A 3FEDA 2BOAA 4KSIA 5HVFA 2EK9A 4ZX9A 4NGQA 4YWYA 4CDKA 2RFHA 2I3CA 2AFSA 1Z5RA 1WVMA 4X3RA 3B3VA 4F8ZA 1F2PA 2PE3A 4X8IA 1PYTB 3ISXA 4EFDA 2ZELA 3IJ3A 4NGRA 2PJ8A 1XF1A 4MCSA 3WC5A 5LYFA 4P44A 4PXDA 3KI9A 4P4IA 4TWEA 4OC5A 3KR4A 1FNOA 2QJ8A 5JM6A 3VARA 4C99A 1F2OA 4WWVA 1DE4C 2JBKA 4KNGE 4K3NA 1LANA 3B3SA 4Z65A 2PJBA 3SI2A 3S9MA 4C9EA 4DJLA 3PB6X 2AFXA 4NGMA 1FT7A 3D7DA 3BHXA 3SJGA 2ZOFA 4P4EA 3BXMA 5IB9A 1KWMA 4DUKA 1F57A 2EWBA 4DYOA 2PJ1A 1TKHA 3SI1A 5ELYA 2C1CA 1LAPA 3B3CA 5HXDA 4P45A 2ZOGA 3IIBA 1VIXA 2IQ6A 3KGQA 2DEAA 1QQ9A 2PJAA 2PJ3A 4R7MA 4IAVA 1BLLE 3SJFA 4OKOA 3DGVA 1ARMA 1LCPA 2NSMA 3LWUA 2O53A 5K8OA 2CTBA 2IMOA 2PJ0A 4R8FA 4UEEA 2ABZA 5I4MA 5LYDA 1TXRA 2Q51A 1EE3P 5LYIA 1TKFA 7CPAA 2ZEFA 3HUVA 4ZYQA 1VHOA 4MMOA 3QNVA 3IFEA 4C8FA 2QVPA 1R43A 1VGYA 2GLJA 4ZY0A 3LMSA 4C9AA 4UEZA 4CPAA 1DTDA 2GREA 3FH4A 3I1UA 4EWTA 1YLOA 2PJ6A 3PFEA 3VTAA 2AFMA 4NGNA 4TNUA 1H8LA 1CPXA 3KR5A 4IHMA 4PXEA 3WT4A 1ZG9A 1ZG7A 1YW6A 1V6CA 4TJXA 1M4LA 3MN8A 3I6SA 1ELMP 4NFRA 2AFOA 1UWYA 5D29A 4MHYA 3RAMA 4AXVA 4PXBA 2OR4A 5J1QA 2ZEHA 1Y0YA 4OIDA 3PBBA 4A37A 1Z8LA 2PCUA 1OBRA 4MCRA 2ZEOA 2FVGA 2JBJA 2Q43A 5HVGA 3CT9A 3NH5A 3PB4X 2V8DA 1TF9A 4MCPA 2NYQA 4R76A 3FEEA 2XEGA 3PFOA 3V38A 4FBEA 5HVHA 2BO9A 4A94A 1CX8A 4PPZA 1XJOA 1Z2LA 2O4HA 3FMCA 3NH8A 1ARLA 1IY7A 2PIZA 2PJ5A 3TC8A 2PJ2A 3GUXA 1LAMA 1TF8A 1ZLHA 3D4UA 5LYLA 5LRJA 3S9LA 3S9NA 2CF4A 4Q7AA 2OOTA 4YN3A 4PXCA 1JQGA 1CP6A 1Y7EA 4GM5A 3D7FA 3FX6A 4OIWA 4NGPA 1R3NA 4LQGA 4A38A 3B2YA 3MRUA 1YW4A 4PQAA 3GLJA 4G1PA 2ZENA 4O23A 2C6CA 3SJXA 2PJ4A 4P4FA 2J9AA 3BI1A 4JYWA 1XRYA 3EIFA 3IO1A 4ONWA 4P6YA 4MCQA 2PIYA 4F9UA 4OC1A 3SI0A 3PB8X 3N5FA 4OMEA 3IWWA 2G9DA 2CTCA 1AMPA 1ZLIA 1YMEA 3BI0A 4NGTA 2F7VA 1CPSA 3SJEA 3RBUA 1HDQA 1TKJA 1BAVA 4C9UA 2VL1A 3CPAA 2ZEGA 8CPAA 4FUUA 4C9RA 1YSJA 3CDXA 2V77A 3D67A 4UF4A 4ZY1A 3D68A 1ELLP 3PRTA 5DS0A 3KASA 1HEEA 5K8MA 2V8VA 4A39A 4P4JA 3IC1A 4NGSA 4C86A 2PVWA 4C9VA 4F9VA 1RTQA 2AFWA 3B7IA 2V8HA 2JEWA 4FWUA 4C85A 6CPAA 3CPXA 1BPNA 3NH4A 3KQXA 4CDJA 4R6TA 1Q7LA 4BD9A 2V8GA 2QYVA 2HC9A 5D8NA 3FJUA 4ZI6A 4WJBA 1LOKA 5CPAA 3K2KA 3K9TA 5K8NA 3PEIA 4JZ0A 3I74A 5JH9A 3H8GA 3NA6A 1VHEA 3B35A 3WC7A 2AFZA 1XMBA 3WC6A 3H8EA 2C6GA 1NSAA 4W9YA 4P4DA 2WYRA 3IEHA 3KHXA 4EMEA 3KQZA 2ZEEA 2IJZA 3D7HA 2Q4ZA 2PJ9A 3NFZA 4C8PA 3DLJA 5K8PA 2C6PA 4C8TA 3KHZA 4B6ZA 3FVLA 1Y0RA 1GYTA 5THWA 3ICUA 4OC3A 5CBMA 1IGBA 3B3WA 2EK8A 2AFUA 3RZAA 1Y9ZA 3VH9A 5LRKA 2F8HA 2XEFA 4C8UA 1LFWA 2PJCA 2PJ7A 4FAIA 4X2TA 3H8FA 4UIAA 4OC0A 2POKA 1HDUA 4C84A 3JRUA 3PB9X 3FECA 4C8CA 4IK2A 1CBXA 3FF3A 4UEFA 3T8WA 2RB7A 2ZEMA 2WZNA 3L2NA 1CP7A 2HB6A 2ZEDA 4MHZA 2XEIA 1XFOA 3HLPA 3ISZA 2ANPA 2PVVA 3PBEA 1AYEA 1ZG8A 4NJRA 2GLFA 3PB7X 5F09A 4TJVA 4RUHA 1XBUA 1BPMA 4ZX8A 4MHPA 5LRGA 3D7GA 3VATA 3B3TA 2CIJA 4MRIA 4C8AA 4UIBA 3GB0A 3V7ZA 4OP4A 5JGFA 1CG2A
chains in the Genus database with same CATH superfamily
3PFVA 4ZY2A 3BUOB 1PCAA 3SHPA 2NMTA 2REFA 2X0SA 2Q7SA 1I21A 3EFAA 2Z11A 2Y1NA 5JYBA 4P10A 4YU9A 4BBHA 4CAFA 4H2KA 4KUBA 3KZWA 4OADA 1BO4A 2PRQA 3KL9A 2XEJA 1P4NA 2DXQA 2PSWA 2BCOA 4UBRA 1B47A 1GGOA 3P2FA 4AG7A 3WABA 3GKRA 1XE4A 2EZCA 4NJQA 4PV6A 4Y49B 5F1YA 2DPTA 4OC4A 4ONUA 3LD2A 4ZGYB 2ZEPA 4XPKA 2ZXVA 5J8CA 2GU2A 1YVKA 3D66A 4MXUA 1QMUA 1Y7RA 4P4BA 4OC2A 4MHNA 3TX8A 2QECA 3R9FA 4KUAA 1Q5XA 3FEDA 1KZFA 1YREA 4JD6A 2BOAA 1AUGA 2OU2A 3F5BA 2EK9A 4KSIA 4NGQA 4ZX9A 4YWYA 5HVFA 2VZZA 3TOAA 3TOBA 2RC4A 4F6AA 3IU2A 1CS0B 4C99A 1B6BA 1N71A 2RFHA 4NEXA 2I3CA 4CRZB 2C5QA 2AFSA 1Z5RA 1WVMA 4X3RA 5AG7A 3LODA 4BPWB 3B3VA 3VRNA 4UCPA 5H84A 4F8ZA 4LX9A 3FRMA 1F2PA 2PE3A 4X8IA 2REEA 1PYTB 3ISXA 2B4DB 4KOTA 1NSLA 2ZELA 4EFDA 3IJ3A 2P0WA 4NGRA 2P6EA 2PJ8A 1JDEA 1XF1A 4MCSA 4HPSA 2ZPAA 3WC5A 5LYFA 3IWGA 4P44A 4PXDA 3W6SA 3KI9A 2Q7BA 4C7IA 1NBWA 4P4IA 4TWEA 2HI6A 4IUSA 4OC5A 3KR4A 4KSFA 4MFPA 1FNOA 2QJ8A 3S6KA 4C68A 4LQ6A 5JM6A 3VARA 4JXRA 1F2OA 2BEIA 2N3AB 2R1IA 4Q36A 4WWVA 3VWDA 4U9YA 4E8OA 4J0NA 1RO5A 1DE4C 1MJBA 1YK3A 2JBKA 2H5MA 2Z3NA 5HMNA 5DWNA 4KNGE 2OH1A 4JVOA 1IU8A 5F13A 4K3NA 1LANA 4EVYA 3B3SA 5HKYA 1QSOA 2BL1A 4Z65A 2D0OA 2Z0ZA 1UFHA 2PJBA 4UFXA 4UCNA 3SI2A 4J3GA 2YJVA 4AVBA 3S9MA 4C9EA 3R96A 1Y9KA 3TT2A 4DJLA 3PB6X 3N7ZA 2AFXA 4MFLA 3TE4A 4NGMA 2FS5A 4PSXA 4XPDC 2O28A 3SXOA 1FT7A 3D7DA 4JLYA 5JPHA 2PRBA 3BHXA 4R57A 3SJGA 3G3SA 4QBJA 4R87A 1QSTA 1S7NA 2ZOFA 4P4EA 1C3OB 2J8NA 5GCNA 1QSRA 3BXMA 5IB9A 1IOIA 4IIXA 1A2ZA 1KWMA 4KZTA 4DUKA 4INJA 2I79A 2FM4A 1YQEA 2ZW6A 1F57A 3TTHA 2EWBA 4DYOA 2PJ1A 3W6XA 1R57A 1TKHA 5ELYA 2VXKA 3SI1A 1KEEB 2C1CA 4C2XA 2B5GA 1Z9UA 1LAPA 1Z9EA 3B3CA 5HXDA 4P45A 2ZOGA 3IIBA 4A32A 2VI7A 2JDDA 2KCWA 2UV8G 1VIXA 3NE7A 1I1DA 3PLFB 2IQ6A 3BJ7A 4KVXA 4UWJA 3KGQA 1Z8TA 1M1DA 2DEAA 1QQ9A 2PJAA 1NE9A 2PJ3A 4MI4A 1WJTA 4R7MA 5AG4A 2YJTA 1FY7A 2EZAA 3BLNA 1M44A 3SR3A 3OP0A 3OWCA 4IAVA 1BLLE 4YFJA 3SJFA 2R82A 2WPWA 4OKOA 2E28A 3DGVA 1ARMA 2DLAA 1LCPA 1K4JA 1TIQA 2FCKA 2NSMA 1XEBA 3RNZA 4KOWA 3LWUA 4CGMA 2D0PA 2G3AA 2O53A 5K8OA 2CTBA 3TLYA 2IMOA 2PJ0A 3CXPA 4R8FA 3EZAA 4UEEA 4B5PB 2ABZA 2MP0A 5I4MA 5F5XA 4C2YA 3FXTA 5LYDA 1TXRA 3FB3A 4CAEA 4RR2B 2PR1A 2Q51A 4KLVA 2WUUA 5DWMA 1EE3P 1Z4RA 5H86A 5LYIA 4A95A 1TKFA 2Z3OA 5AGEA 7CPAA 2ZEFA 2X7BA 2B4BA 3HUVA 4ZYQA 4RS2A 1VHOA 3D3SA 3QB8A 4MMOA 1NMTA 3QNVA 3IFEA 1S7FA 4X5KA 2FIAA 2R8VA 4C8FA 4Q38A 2QVPA 3R1KA 1R43A 1VGYA 4H1HA 4CO9A 3HPHE 4GPLB 2GLJA 3U1BA 2FSRA 3S6FA 4MFKA 4ZY0A 2Z3LA 2Z3KA 2PC1A 3GY9A 3DR8A 4H6UA 3TO6A 3PZJA 3DDDA 3LMSA 4C9AA 4UEZA 1JDBC 4CPAA 4Y49C 1DTDA 2GE3A 2GREA 2Q0YA 3FH4A 3I1UA 5EC4A 4EWTA 1YLOA 2PJ6A 3K4IA 3PFEA 4COBA 2FIWA 5G20A 3V8IA 3TLZA 3VTAA 5F46A 2AFMA 2C27A 1J4JA 3OB1B 4M6GA 1PUAA 2VKZG 4NGNA 4TNUA 2BSWA 1FBVA 1H8LA 4MJ8A 1CPXA 2ZW7A 3H4QA 3KR5A 2CXAA 4IHMA 4PXEA 3WT4A 1ZG9A 1ZG7A 4H6ZA 5I0CA 1CJWA 1YGHA 1KC7A 1YR0A 1YW6A 2QIRA 3EXNA 4PSWA 5AXIA 4CGNA 3IU1A 1V6CA 2PCNA 3TFYA 5EMIA 1M4LA 3MN8A 4TJXA 3I6SA 1U6MA 5KTCA 3I3GA 1ELMP 4KOXA 4MFZA 4NFRA 2AFOA 1VHSA 1YVOA 4II9A 3QAHA 3WR7A 1MJ9A 5D29A 1UWYA 4MHYA 1MK4A 4PXBA 2OR4A 3RAMA 4AXVA 4B13A 1GHEA 1YLEA 2ZEHA 5J1QA 1Y0YA 5HH1A 4OIDA 3PBBA 4U9ZA 4A37A 1Z8LA 2PCUA 4JJXA 1OBRA 4A4BA 2YGWA 4MCRA 4FD6A 1C30B 2ZEOA 2JEVA 2FVGA 5CNPA 3NOJA 3TLBA 2JBJA 2Q43A 5HVGA 3CT9A 3NH5A 5BY0A 2PQ8A 3GIUA 3PB4X 2V8DA 1TF9A 4MCPA 2NYQA 4R76A 1IOFA 1DIKA 3PP9A 2Z3MA 4C8AA 3FEEA 5A28A 2XEGA 4AG9A 3PFOA 4XNHB 4DNCA 3V38A 3MGDA 2PDOA 5FVJA 4CDKA 3TLGA 2CNMA 4QC6A 3T05A 4LUAA 4FBEA 5HVHA 3OB2B 2OZGA 2BO9A 4HNWB 2Q04A 4A94A 1CX8A 3W91A 4PPZA 3SXNA 1XJOA 1IYLA 1Z2LA 5AG6A 5A27A 2XPNA 2O4HA 3FMCA 1ARLA 3D8PA 3NH8A 1IY7A 2D4PA 2PIZA 4OAEA 1EZAA 2PJ5A 3TC8A 4A31A 2B3VA 2PJ2A 3GUXA 4F0XA 1LAMA 1TF8A 3BJ8A 1ZLHA 3D4UA 1X10A 3S6HA 5LYLA 5LRJA 1T36B 3S9LA 5F47A 5J3XA 3S9NA 4ORFA 4IIYA 3T0TA 3G8WA 2EO8A 2AJ6A 1X12A 2CF4A 4OLLA 3IGRA 4XPLA 3R9GA 2GANA 4Q7AA 3C8OA 2OOTA 1Q2CA 4PXCA 3S6GA 1JQGA 3UY5A 5HKWA 4B10A 4YN3A 2XPPA 4KLWA 4BINA 4MY0A 1CP6A 1Y7EA 4GM5A 3T90A 4R3LA 4R3KA 4AB7A 3D7FA 3FX6A 2YNCC 4MJXA 3T07A 4QVTA 1YX0A 2VQYA 4OIWA 5JQ4A 4KOSA 4UA3A 3EZEA 4NGPA 1R3NA 3OAKA 4LQGA 2Q4VA 2CNSA 4A38A 4AVCA 3TLEA 4C2ZA 3B2YA 3MRUA 4MFQA 4E2AA 4CAXA 1YW4A 3C26A 4PQAA 4M8DA 3GLJA 4G1PA 2ZENA 3G23A 1Z8WA 4O23A 1IIDA 1IYKA 1EZBA 4BPUB 2Q4YA 3DNSA 3IWEA 4NXYA 2C6CA 1VI4A 3DSBA 3SJXA 4BTFA 1IICA 2PJ4A 4M6HA 4MHDA 4B11A 1VKCA 3JVNA 3HMJG 3T9YA 4CGLA 4EYSA 5IB0A 4P4FA 2J9AA 2B5GB 3QAYA 3BI1A 4JYWA 1XRYA 4KSAA 3TLCA 4UFVA 4IF5A 3NE8A 3EIFA 3IO1A 3R9EA 1OZPA 2J8MA 1XIXA 2I00A 4ONWA 2EUIA 4P6YA 2GP4A 5ISVA 4HKFA 1M4IA 4MCQA 2XPLA 2GIVA 2PIYA 4F9UA 1J3LA 3GJZA 4OC1A 1MJAA 1S60A 4KOVA 4C85A 2YNDA 4CS0B 1ZO0A 3SI0A 3PB8X 1Y9WA 4A33A 3N5FA 4OMEA 3IWWA 2G9DA 4E0AA 5C82A 2CTCA 1AMPA 4CAWA 4UWIA 1ZLIA 2DIKA 2HQYA 1NXJA 1V0CA 4RN7A 5E96A 1YMEA 3BI0A 4NGTA 2F7VA 1CPSA 3SJEA 3RBUA 1ON0A 1BXRB 4R9MA 1HDQA 4JWPA 1TKJA 1BAVA 4C9UA 2VL1A 3CPAA 4QB9A 3KKWA 2Y1MA 2ZEGA 4PK2A 4A4CA 8CPAA 1P0HA 4FUUA 4HNXB 2PR8A 4CYPA 4C9RA 1YSJA 2VZYA 4CYNA 3CDXA 2V77A 3D67A 2Z3PA 4BMHA 4UF4A 4ZY1A 3D68A 4RI1A 4MBUA 1ELLP 3PRTA 5DS0A 1A9XB 1Q2DA 2EBJA 5KTDA 3KASA 1HEEA 4KOYA 1M4GA 4UFWA 5K8MA 2V8VA 4A39A 3FNCA 4P4JA 1QSMA 4NGSA 3IC1A 2VBQA 4C86A 4CYQA 2PVWA 4C9VA 1KBLA 1XOVA 4F9VA 1RTQA 2AFWA 3LACA 4B12A 3D2PA 2P6FA 2YNEA 4MI1A 3O8ZA 2A4NA 3U88C 2ODFA 2G3TA 1CM0A 2B3UA 2JEWA 2V8HA 3B7IA 4FWUA 4B14A 6CPAA 5IV0A 3CPXA 1CE8B 1BPNA 2ZW4A 3NH4A 1M4DA 3KQXA 1M6VB 4CDJA 3F0AA 4CZ1A 5BWAB 5HKZA 4CGPA 4R6TA 3I9SA 2DF5A 3EY5A 1Q7LA 2B4DA 5G1ZA 1ZL0A 3FIXA 2V8GA 4BD9A 2QYVA 3D2MA 1PU9A 5JVLA 1KUVA 2IL4A 2HROA 3PT1A 2HV2A 2ATRA 2HC9A 3F9KC 3B8GA 3FJUA 3JUWA 5D8NA 4ZI6A 4A30A 3VWEA 3DR6A 4WJBA 1LOKA 3FBUA 5CPAA 3BUNB 3VROA 3K2KA 3K9TA 4XNHC 5G21A 5K8NA 3A9LA 2WPXA 3PEIA 4JZ0A 3K9UA 1S3ZA 4K30A 1KUYA 1LRZA 2FXFA 4UCMA 2AUNA 4E94A 4CGOA 1VBHA 5JH9A 3I74A 3H5ZA 3R95A 1KUXA 3H8GA 1VHEA 3NA6A 1ZRSA 3B35A 3WC7A 5C88A 3CXSA 1R61A 3TO9A 2AFZA 3BUXB 1JWQA 1IB1E 1XMBA 2K5TA 3VRQA 3E0KA 4I49A 3WC6A 3F8KA 3P2HA 3H8EA 1EO0A 2C6GA 1NSAA 4W9YA 4P4DA 1S5KA 2AE6A 1WK4A 2FT0A 2J8RA 2WYRA 3IEHA 3KHXA 4KS9A 3KQZA 2DPSA 4EMEA 2HWGA 2CNTA 3EZBA 1S7LA 2BUEA 1ZYMA 2ZEEA 3HPGG 2IJZA 3TLGB 3RO0A 3D7HA 2Q4ZA 2CY2A 4M85A 2QMLA 1RXTA 4L89A 1YVHA 2PJ9A 3BUWB 3NFQA 3TCVA 3NFZA 4C8PA 3DLJA 5K8PA 2C6PA 2ZW5A 2OLSA 4C8TA 1XMTA 3KHZA 5F49A 3FVLA 1Y0RA 1GYTA 2Z10A 5THWA 4B5OA 4B6ZA 3ICUA 4YGOA 4OC3A 5CBMA 1Z4EA 1IGBA 3B3WA 2EK8A 1BOBA 2VEZA 3VRRA 2AFUA 3CZXA 3RZAA 2GFQA 1Y9ZA 2B4JC 2OB0A 2YNCA 3VH9A 2F8HA 4L8AA 5LRKA 2XEFA 4FD5A 4C8UA 2Y0MA 1L0CA 1LFWA 3RYOA 2AUMA 3KRVA 4CYOA 3BUMB 2PJCA 4XPDB 5IR2A 1S7KA 4KOUA 4KVME 2B58A 4KORA 2PJ7A 2CBLA 2D4OA 4FAIA 4M3SA 4X2TA 3TLAA 3H8FA 4UIAA 4M6IA 1Z8XA 1QSNA 4JXQA 4OC0A 4MY3A 2OZUA 4U5YA 4H89A 2POKA 3TO7A 2R7HA 3JTKA 1HDUA 4C7HA 5K99A 4A2ZA 4C84A 4E5SA 3ZNIA 3JRUA 4PK3A 5FD8A 3PGPA 4HNYB 3PB9X 4GS4A 3FECA 3CXQA 4C8CA 4IK2A 3TYXA 2JLMA 1CBXA 2Q44A 2EVNA 1Q2YA 4B5PA 3FF3A 4YRHA 4ZBGA 4UEFA 3T8WA 2RB7A 4BPXB 2ZEMA 4MFJA 4CAVA 2WZNA 4QUSA 2FE7A 3L2NA 1CP7A 2HB6A 2ZEDA 4MHZA 2XEIA 2ARHA 1XFOA 4NCZA 3GYAA 3HLPA 3ISZA 1I12A 4CRYB 4COGA 2P6GA 3EO4A 2JDCA 2ANPA 3VRPA 2PVVA 3PBEA 1AYEA 5G22A 1B87A 1WWZA 2B0AA 3T5MA 3ZZIA 4NF1A 1ZG8A 4NJRA 2EZBA 2GLFA 3PB7X 2R98A 5F09A 3ZJ0A 1SQHA 4TJVA 5F9MA 4RUHA 2HUZA 2G0BA 1XBUA 4GXHA 5EBVA 4AVAA 5IX3A 1BPMA 4ZX8A 2XPOA 2OZHA 4MHPA 5LRGA 4F0YA 3D7GA 1XF8A 4FD4A 3VATA 4FD7A 3B3TA 2CIJA 2FL4A 3VGOA 4NSQA 3FYNA 4MRIA 5AG5A 2F5IA 2WSAA 4UIBA 5J8FA 5KTAA 3EC4A 4KVOE 3GB0A 1VBGA 5F48A 3V7ZA 4OP4A 5JGFA 1CG2A
chains in the Genus database with same CATH topology
4ZY2A 1PCAA 4P10A 4YU9A 4H2KA 3KZWA 2PRQA 3KL9A 2XEJA 2BCOA 3WABA 4NJQA 4OC4A 2ZEPA 2GU2A 3D66A 4MXUA 1QMUA 4P4BA 4OC2A 4MHNA 3TX8A 3FEDA 2BOAA 4KSIA 5HVFA 2EK9A 4ZX9A 4NGQA 4YWYA 4CDKA 2RFHA 2C5QA 2I3CA 2AFSA 1Z5RA 1WVMA 4X3RA 3B3VA 4F8ZA 1F2PA 2PE3A 4X8IA 1PYTB 3ISXA 4EFDA 2ZELA 3IJ3A 4NGRA 2PJ8A 1XF1A 4MCSA 3WC5A 5LYFA 4P44A 4PXDA 3KI9A 4P4IA 4TWEA 4OC5A 3KR4A 1FNOA 2QJ8A 5JM6A 3VARA 4C99A 1F2OA 4WWVA 1DE4C 2JBKA 4KNGE 4K3NA 1LANA 3B3SA 4Z65A 2PJBA 3SI2A 3S9MA 4C9EA 4DJLA 3PB6X 2AFXA 4NGMA 1FT7A 3D7DA 3BHXA 3SJGA 2ZOFA 4P4EA 3BXMA 5IB9A 1KWMA 4DUKA 1F57A 2EWBA 4DYOA 2PJ1A 1TKHA 3SI1A 5ELYA 2C1CA 1LAPA 3B3CA 5HXDA 4P45A 2ZOGA 3IIBA 1VIXA 2IQ6A 3KGQA 2DEAA 1QQ9A 2PJAA 2PJ3A 4R7MA 4IAVA 1BLLE 3SJFA 4OKOA 3DGVA 1ARMA 1LCPA 2NSMA 3LWUA 2O53A 5K8OA 2CTBA 2IMOA 2PJ0A 4R8FA 4UEEA 2ABZA 5I4MA 5LYDA 1TXRA 2Q51A 1EE3P 5LYIA 1TKFA 7CPAA 2ZEFA 3HUVA 4ZYQA 1VHOA 4MMOA 3QNVA 3IFEA 4C8FA 2QVPA 1R43A 1VGYA 2GLJA 4ZY0A 3LMSA 4C9AA 4UEZA 4CPAA 1DTDA 2GREA 3FH4A 3I1UA 4EWTA 1YLOA 2PJ6A 3PFEA 3VTAA 2AFMA 4NGNA 4TNUA 1H8LA 1CPXA 3KR5A 4IHMA 4PXEA 3WT4A 1ZG9A 1ZG7A 1YW6A 1V6CA 4TJXA 1M4LA 3MN8A 3I6SA 1ELMP 4NFRA 2AFOA 1UWYA 5D29A 4MHYA 3RAMA 4AXVA 4PXBA 2OR4A 5J1QA 2ZEHA 1Y0YA 4OIDA 3PBBA 4A37A 1Z8LA 2PCUA 1OBRA 4MCRA 2ZEOA 2FVGA 2JBJA 2Q43A 5HVGA 3CT9A 3NH5A 3PB4X 2V8DA 1TF9A 4MCPA 2NYQA 4R76A 3FEEA 2XEGA 3PFOA 3V38A 4FBEA 5HVHA 2BO9A 4A94A 1CX8A 4PPZA 1XJOA 1Z2LA 2O4HA 3FMCA 3NH8A 1ARLA 1IY7A 2PIZA 2PJ5A 3TC8A 2PJ2A 3GUXA 1LAMA 1TF8A 1ZLHA 3D4UA 5LYLA 5LRJA 3S9LA 3S9NA 2CF4A 4Q7AA 2OOTA 4YN3A 4PXCA 1JQGA 1CP6A 1Y7EA 4GM5A 3D7FA 3FX6A 4OIWA 4NGPA 1R3NA 4LQGA 4A38A 3B2YA 3MRUA 1YW4A 4PQAA 3GLJA 4G1PA 2ZENA 4O23A 2C6CA 3SJXA 2PJ4A 4P4FA 2J9AA 3BI1A 4JYWA 1XRYA 3EIFA 3IO1A 2GP4A 4ONWA 4P6YA 4MCQA 2PIYA 4F9UA 4OC1A 3SI0A 3PB8X 3N5FA 4OMEA 3IWWA 2G9DA 2CTCA 1AMPA 1ZLIA 1YMEA 3BI0A 4NGTA 2F7VA 1CPSA 3SJEA 3RBUA 1HDQA 1TKJA 1BAVA 4C9UA 2VL1A 3CPAA 2ZEGA 8CPAA 4FUUA 4C9RA 1YSJA 3CDXA 2V77A 3D67A 4UF4A 4ZY1A 3D68A 1ELLP 3PRTA 5DS0A 3KASA 1HEEA 5K8MA 2V8VA 4A39A 4P4JA 3IC1A 4NGSA 4C86A 2PVWA 4C9VA 4F9VA 1RTQA 2AFWA 3B7IA 2V8HA 2JEWA 4FWUA 4C85A 6CPAA 3CPXA 1BPNA 3NH4A 3KQXA 4CDJA 4R6TA 1Q7LA 4BD9A 2V8GA 2QYVA 2HC9A 5D8NA 3FJUA 4ZI6A 4WJBA 1LOKA 5CPAA 3K2KA 3K9TA 5K8NA 3PEIA 4JZ0A 3I74A 5JH9A 3H8GA 3NA6A 1VHEA 3B35A 3WC7A 2AFZA 1XMBA 3WC6A 3H8EA 2C6GA 1NSAA 4W9YA 4P4DA 2WYRA 3IEHA 3KHXA 4EMEA 3KQZA 2ZEEA 2IJZA 3D7HA 2Q4ZA 2PJ9A 3NFZA 4C8PA 3DLJA 5K8PA 2C6PA 4C8TA 3KHZA 4B6ZA 3FVLA 1Y0RA 1GYTA 5THWA 3ICUA 4OC3A 5CBMA 1IGBA 3B3WA 2EK8A 2AFUA 3RZAA 1Y9ZA 3VH9A 5LRKA 2F8HA 2XEFA 4C8UA 1LFWA 2PJCA 5IR2A 2PJ7A 4FAIA 4X2TA 3H8FA 4UIAA 4OC0A 2POKA 1HDUA 4C84A 3JRUA 3PB9X 3FECA 4C8CA 4IK2A 1CBXA 3FF3A 4UEFA 3T8WA 2RB7A 2ZEMA 2WZNA 3L2NA 1CP7A 2HB6A 2ZEDA 4MHZA 2XEIA 1XFOA 3HLPA 3ISZA 2ANPA 2PVVA 3PBEA 1AYEA 1ZG8A 4NJRA 2GLFA 3PB7X 5F09A 4TJVA 4RUHA 1XBUA 1BPMA 4ZX8A 4MHPA 5LRGA 3D7GA 3VATA 3B3TA 2CIJA 4MRIA 4C8AA 4UIBA 3GB0A 3V7ZA 4OP4A 5JGFA 1CG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZY2 A;  1PCA A;  4P10 A;  4YU9 A;  4H2K A;  3KZW A;  2PRQ A;  3KL9 A;  2XEJ A;  2BCO A;  3WAB A;  4NJQ A;  4OC4 A;  2ZEP A;  2GU2 A;  3D66 A;  4MXU A;  1QMU A;  4P4B A;  4OC2 A;  4MHN A;  3TX8 A;  3FED A;  2BOA A;  4KSI A;  5HVF A;  2EK9 A;  4ZX9 A;  4NGQ A;  4YWY A;  4CDK A;  2RFH A;  2I3C A;  2AFS A;  1Z5R A;  1WVM A;  4X3R A;  3B3V A;  4F8Z A;  1F2P A;  2PE3 A;  4X8I A;  1PYT B;  3ISX A;  4EFD A;  2ZEL A;  3IJ3 A;  4NGR A;  2PJ8 A;  1XF1 A;  4MCS A;  3WC5 A;  5LYF A;  4P44 A;  4PXD A;  3KI9 A;  4P4I A;  4TWE A;  4OC5 A;  3KR4 A;  1FNO A;  2QJ8 A;  5JM6 A;  3VAR A;  4C99 A;  1F2O A;  4WWV A;  1DE4 C;  2JBK A;  4KNG E;  4K3N A;  1LAN A;  3B3S A;  4Z65 A;  2PJB A;  3SI2 A;  3S9M A;  4C9E A;  4DJL A;  3PB6 X;  2AFX A;  4NGM A;  1FT7 A;  3D7D A;  3BHX A;  3SJG A;  2ZOF A;  4P4E A;  3BXM A;  5IB9 A;  1KWM A;  4DUK A;  1F57 A;  2EWB A;  4DYO A;  2PJ1 A;  1TKH A;  3SI1 A;  5ELY A;  2C1C A;  1LAP A;  3B3C A;  5HXD A;  4P45 A;  2ZOG A;  3IIB A;  1VIX A;  2IQ6 A;  3KGQ A;  2DEA A;  1QQ9 A;  2PJA A;  2PJ3 A;  4R7M A;  4IAV A;  1BLL E;  3SJF A;  4OKO A;  3DGV A;  1ARM A;  1LCP A;  2NSM A;  3LWU A;  2O53 A;  5K8O A;  2CTB A;  2IMO A;  2PJ0 A;  4R8F A;  4UEE A;  2ABZ A;  5I4M A;  5LYD A;  1TXR A;  2Q51 A;  1EE3 P;  5LYI A;  1TKF A;  7CPA A;  2ZEF A;  3HUV A;  4ZYQ A;  1VHO A;  4MMO A;  3QNV A;  3IFE A;  4C8F A;  2QVP A;  1R43 A;  1VGY A;  2GLJ A;  4ZY0 A;  3LMS A;  4C9A A;  4UEZ A;  4CPA A;  1DTD A;  2GRE A;  3FH4 A;  3I1U A;  4EWT A;  1YLO A;  2PJ6 A;  3PFE A;  3VTA A;  2AFM A;  4NGN A;  4TNU A;  1H8L A;  1CPX A;  3KR5 A;  4IHM A;  4PXE A;  3WT4 A;  1ZG9 A;  1ZG7 A;  1YW6 A;  1V6C A;  4TJX A;  1M4L A;  3MN8 A;  3I6S A;  1ELM P;  4NFR A;  2AFO A;  1UWY A;  5D29 A;  4MHY A;  3RAM A;  4AXV A;  4PXB A;  2OR4 A;  5J1Q A;  2ZEH A;  1Y0Y A;  4OID A;  3PBB A;  4A37 A;  1Z8L A;  2PCU A;  1OBR A;  4MCR A;  2ZEO A;  2FVG A;  2JBJ A;  2Q43 A;  5HVG A;  3CT9 A;  3NH5 A;  3PB4 X;  2V8D A;  1TF9 A;  4MCP A;  2NYQ A;  4R76 A;  3FEE A;  2XEG A;  3PFO A;  3V38 A;  4FBE A;  5HVH A;  2BO9 A;  4A94 A;  1CX8 A;  4PPZ A;  1XJO A;  1Z2L A;  2O4H A;  3FMC A;  3NH8 A;  1ARL A;  1IY7 A;  2PIZ A;  2PJ5 A;  3TC8 A;  2PJ2 A;  3GUX A;  1LAM A;  1TF8 A;  1ZLH A;  3D4U A;  5LYL A;  5LRJ A;  3S9L A;  3S9N A;  2CF4 A;  4Q7A A;  2OOT A;  4YN3 A;  4PXC A;  1JQG A;  1CP6 A;  1Y7E A;  4GM5 A;  3D7F A;  3FX6 A;  4OIW A;  4NGP A;  1R3N A;  4LQG A;  4A38 A;  3B2Y A;  3MRU A;  1YW4 A;  4PQA A;  3GLJ A;  4G1P A;  2ZEN A;  4O23 A;  2C6C A;  3SJX A;  2PJ4 A;  4P4F A;  2J9A A;  3BI1 A;  4JYW A;  1XRY A;  3EIF A;  3IO1 A;  4ONW A;  4P6Y A;  4MCQ A;  2PIY A;  4F9U A;  4OC1 A;  3SI0 A;  3PB8 X;  3N5F A;  4OME A;  3IWW A;  2G9D A;  2CTC A;  1AMP A;  1ZLI A;  1YME A;  3BI0 A;  4NGT A;  2F7V A;  1CPS A;  3SJE A;  3RBU A;  1HDQ A;  1TKJ A;  1BAV A;  4C9U A;  2VL1 A;  3CPA A;  2ZEG A;  8CPA A;  4FUU A;  4C9R A;  1YSJ A;  3CDX A;  2V77 A;  3D67 A;  4UF4 A;  4ZY1 A;  3D68 A;  1ELL P;  3PRT A;  5DS0 A;  3KAS A;  1HEE A;  5K8M A;  2V8V A;  4A39 A;  4P4J A;  3IC1 A;  4NGS A;  4C86 A;  2PVW A;  4C9V A;  4F9V A;  1RTQ A;  2AFW A;  3B7I A;  2V8H A;  2JEW A;  4FWU A;  4C85 A;  6CPA A;  3CPX A;  1BPN A;  3NH4 A;  3KQX A;  4CDJ A;  4R6T A;  1Q7L A;  4BD9 A;  2V8G A;  2QYV A;  2HC9 A;  5D8N A;  3FJU A;  4ZI6 A;  4WJB A;  1LOK A;  5CPA A;  3K2K A;  3K9T A;  5K8N A;  3PEI A;  4JZ0 A;  3I74 A;  5JH9 A;  3H8G A;  3NA6 A;  1VHE A;  3B35 A;  3WC7 A;  2AFZ A;  1XMB A;  3WC6 A;  3H8E A;  2C6G A;  1NSA A;  4W9Y A;  4P4D A;  2WYR A;  3IEH A;  3KHX A;  4EME A;  3KQZ A;  2ZEE A;  2IJZ A;  3D7H A;  2Q4Z A;  2PJ9 A;  3NFZ A;  4C8P A;  3DLJ A;  5K8P A;  2C6P A;  4C8T A;  3KHZ A;  4B6Z A;  3FVL A;  1Y0R A;  1GYT A;  5THW A;  3ICU A;  4OC3 A;  5CBM A;  1IGB A;  3B3W A;  2EK8 A;  2AFU A;  3RZA A;  1Y9Z A;  3VH9 A;  5LRK A;  2F8H A;  2XEF A;  4C8U A;  1LFW A;  2PJC A;  2PJ7 A;  4FAI A;  4X2T A;  3H8F A;  4UIA A;  4OC0 A;  2POK A;  1HDU A;  4C84 A;  3JRU A;  3PB9 X;  3FEC A;  4C8C A;  4IK2 A;  1CBX A;  3FF3 A;  4UEF A;  3T8W A;  2RB7 A;  2ZEM A;  2WZN A;  3L2N A;  1CP7 A;  2HB6 A;  2ZED A;  4MHZ A;  2XEI A;  1XFO A;  3HLP A;  3ISZ A;  2ANP A;  2PVV A;  3PBE A;  1AYE A;  1ZG8 A;  4NJR A;  2GLF A;  3PB7 X;  5F09 A;  4TJV A;  4RUH A;  1XBU A;  1BPM A;  4ZX8 A;  4MHP A;  5LRG A;  3D7G A;  3VAT A;  3B3T A;  2CIJ A;  4MRI A;  4C8A A;  4UIB A;  3GB0 A;  3V7Z A;  4OP4 A;  5JGF A;  1CG2 A; 
#chains in the Genus database with same CATH topology
 3PFV A;  4ZY2 A;  3BUO B;  1PCA A;  3SHP A;  2NMT A;  2REF A;  2X0S A;  2Q7S A;  1I21 A;  3EFA A;  2Z11 A;  2Y1N A;  5JYB A;  4P10 A;  4YU9 A;  4BBH A;  4CAF A;  4H2K A;  4KUB A;  3KZW A;  4OAD A;  1BO4 A;  2PRQ A;  3KL9 A;  2XEJ A;  1P4N A;  2DXQ A;  2PSW A;  2BCO A;  4UBR A;  1B47 A;  1GGO A;  3P2F A;  4AG7 A;  3WAB A;  3GKR A;  1XE4 A;  2EZC A;  4NJQ A;  4PV6 A;  4Y49 B;  5F1Y A;  2DPT A;  4OC4 A;  4ONU A;  3LD2 A;  4ZGY B;  2ZEP A;  4XPK A;  2ZXV A;  5J8C A;  2GU2 A;  1YVK A;  3D66 A;  4MXU A;  1QMU A;  1Y7R A;  4P4B A;  4OC2 A;  4MHN A;  3TX8 A;  2QEC A;  3R9F A;  4KUA A;  1Q5X A;  3FED A;  1KZF A;  1YRE A;  4JD6 A;  2BOA A;  1AUG A;  2OU2 A;  3F5B A;  2EK9 A;  4KSI A;  4NGQ A;  4ZX9 A;  4YWY A;  5HVF A;  2VZZ A;  3TOA A;  3TOB A;  2RC4 A;  4F6A A;  3IU2 A;  1CS0 B;  4C99 A;  1B6B A;  1N71 A;  2RFH A;  4NEX A;  2I3C A;  4CRZ B;  2C5Q A;  2AFS A;  1Z5R A;  1WVM A;  4X3R A;  5AG7 A;  3LOD A;  4BPW B;  3B3V A;  3VRN A;  4UCP A;  5H84 A;  4F8Z A;  4LX9 A;  3FRM A;  1F2P A;  2PE3 A;  4X8I A;  2REE A;  1PYT B;  3ISX A;  2B4D B;  4KOT A;  1NSL A;  2ZEL A;  4EFD A;  3IJ3 A;  2P0W A;  4NGR A;  2P6E A;  2PJ8 A;  1JDE A;  1XF1 A;  4MCS A;  4HPS A;  2ZPA A;  3WC5 A;  5LYF A;  3IWG A;  4P44 A;  4PXD A;  3W6S A;  3KI9 A;  2Q7B A;  4C7I A;  1NBW A;  4P4I A;  4TWE A;  2HI6 A;  4IUS A;  4OC5 A;  3KR4 A;  4KSF A;  4MFP A;  1FNO A;  2QJ8 A;  3S6K A;  4C68 A;  4LQ6 A;  5JM6 A;  3VAR A;  4JXR A;  1F2O A;  2BEI A;  2N3A B;  2R1I A;  4Q36 A;  4WWV A;  3VWD A;  4U9Y A;  4E8O A;  4J0N A;  1RO5 A;  1DE4 C;  1MJB A;  1YK3 A;  2JBK A;  2H5M A;  2Z3N A;  5HMN A;  5DWN A;  4KNG E;  2OH1 A;  4JVO A;  1IU8 A;  5F13 A;  4K3N A;  1LAN A;  4EVY A;  3B3S A;  5HKY A;  1QSO A;  2BL1 A;  4Z65 A;  2D0O A;  2Z0Z A;  1UFH A;  2PJB A;  4UFX A;  4UCN A;  3SI2 A;  4J3G A;  2YJV A;  4AVB A;  3S9M A;  4C9E A;  3R96 A;  1Y9K A;  3TT2 A;  4DJL A;  3PB6 X;  3N7Z A;  2AFX A;  4MFL A;  3TE4 A;  4NGM A;  2FS5 A;  4PSX A;  4XPD C;  2O28 A;  3SXO A;  1FT7 A;  3D7D A;  4JLY A;  5JPH A;  2PRB A;  3BHX A;  4R57 A;  3SJG A;  3G3S A;  4QBJ A;  4R87 A;  1QST A;  1S7N A;  2ZOF A;  4P4E A;  1C3O B;  2J8N A;  5GCN A;  1QSR A;  3BXM A;  5IB9 A;  1IOI A;  4IIX A;  1A2Z A;  1KWM A;  4KZT A;  4DUK A;  4INJ A;  2I79 A;  2FM4 A;  1YQE A;  2ZW6 A;  1F57 A;  3TTH A;  2EWB A;  4DYO A;  2PJ1 A;  3W6X A;  1R57 A;  1TKH A;  5ELY A;  2VXK A;  3SI1 A;  1KEE B;  2C1C A;  4C2X A;  2B5G A;  1Z9U A;  1LAP A;  1Z9E A;  3B3C A;  5HXD A;  4P45 A;  2ZOG A;  3IIB A;  4A32 A;  2VI7 A;  2JDD A;  2KCW A;  2UV8 G;  1VIX A;  3NE7 A;  1I1D A;  3PLF B;  2IQ6 A;  3BJ7 A;  4KVX A;  4UWJ A;  3KGQ A;  1Z8T A;  1M1D A;  2DEA A;  1QQ9 A;  2PJA A;  1NE9 A;  2PJ3 A;  4MI4 A;  1WJT A;  4R7M A;  5AG4 A;  2YJT A;  1FY7 A;  2EZA A;  3BLN A;  1M44 A;  3SR3 A;  3OP0 A;  3OWC A;  4IAV A;  1BLL E;  4YFJ A;  3SJF A;  2R82 A;  2WPW A;  4OKO A;  2E28 A;  3DGV A;  1ARM A;  2DLA A;  1LCP A;  1K4J A;  1TIQ A;  2FCK A;  2NSM A;  1XEB A;  3RNZ A;  4KOW A;  3LWU A;  4CGM A;  2D0P A;  2G3A A;  2O53 A;  5K8O A;  2CTB A;  3TLY A;  2IMO A;  2PJ0 A;  3CXP A;  4R8F A;  3EZA A;  4UEE A;  4B5P B;  2ABZ A;  2MP0 A;  5I4M A;  5F5X A;  4C2Y A;  3FXT A;  5LYD A;  1TXR A;  3FB3 A;  4CAE A;  4RR2 B;  2PR1 A;  2Q51 A;  4KLV A;  2WUU A;  5DWM A;  1EE3 P;  1Z4R A;  5H86 A;  5LYI A;  4A95 A;  1TKF A;  2Z3O A;  5AGE A;  7CPA A;  2ZEF A;  2X7B A;  2B4B A;  3HUV A;  4ZYQ A;  4RS2 A;  1VHO A;  3D3S A;  3QB8 A;  4MMO A;  1NMT A;  3QNV A;  3IFE A;  1S7F A;  4X5K A;  2FIA A;  2R8V A;  4C8F A;  4Q38 A;  2QVP A;  3R1K A;  1R43 A;  1VGY A;  4H1H A;  4CO9 A;  3HPH E;  4GPL B;  2GLJ A;  3U1B A;  2FSR A;  3S6F A;  4MFK A;  4ZY0 A;  2Z3L A;  2Z3K A;  2PC1 A;  3GY9 A;  3DR8 A;  4H6U A;  3TO6 A;  3PZJ A;  3DDD A;  3LMS A;  4C9A A;  4UEZ A;  1JDB C;  4CPA A;  4Y49 C;  1DTD A;  2GE3 A;  2GRE A;  2Q0Y A;  3FH4 A;  3I1U A;  5EC4 A;  4EWT A;  1YLO A;  2PJ6 A;  3K4I A;  3PFE A;  4COB A;  2FIW A;  5G20 A;  3V8I A;  3TLZ A;  3VTA A;  5F46 A;  2AFM A;  2C27 A;  1J4J A;  3OB1 B;  4M6G A;  1PUA A;  2VKZ G;  4NGN A;  4TNU A;  2BSW A;  1FBV A;  1H8L A;  4MJ8 A;  1CPX A;  2ZW7 A;  3H4Q A;  3KR5 A;  2CXA A;  4IHM A;  4PXE A;  3WT4 A;  1ZG9 A;  1ZG7 A;  4H6Z A;  5I0C A;  1CJW A;  1YGH A;  1KC7 A;  1YR0 A;  1YW6 A;  2QIR A;  3EXN A;  4PSW A;  5AXI A;  4CGN A;  3IU1 A;  1V6C A;  2PCN A;  3TFY A;  5EMI A;  1M4L A;  3MN8 A;  4TJX A;  3I6S A;  1U6M A;  5KTC A;  3I3G A;  1ELM P;  4KOX A;  4MFZ A;  4NFR A;  2AFO A;  1VHS A;  1YVO A;  4II9 A;  3QAH A;  3WR7 A;  1MJ9 A;  5D29 A;  1UWY A;  4MHY A;  1MK4 A;  4PXB A;  2OR4 A;  3RAM A;  4AXV A;  4B13 A;  1GHE A;  1YLE A;  2ZEH A;  5J1Q A;  1Y0Y A;  5HH1 A;  4OID A;  3PBB A;  4U9Z A;  4A37 A;  1Z8L A;  2PCU A;  4JJX A;  1OBR A;  4A4B A;  2YGW A;  4MCR A;  4FD6 A;  1C30 B;  2ZEO A;  2JEV A;  2FVG A;  5CNP A;  3NOJ A;  3TLB A;  2JBJ A;  2Q43 A;  5HVG A;  3CT9 A;  3NH5 A;  5BY0 A;  2PQ8 A;  3GIU A;  3PB4 X;  2V8D A;  1TF9 A;  4MCP A;  2NYQ A;  4R76 A;  1IOF A;  1DIK A;  3PP9 A;  2Z3M A;  4C8A A;  3FEE A;  5A28 A;  2XEG A;  4AG9 A;  3PFO A;  4XNH B;  4DNC A;  3V38 A;  3MGD A;  2PDO A;  5FVJ A;  4CDK A;  3TLG A;  2CNM A;  4QC6 A;  3T05 A;  4LUA A;  4FBE A;  5HVH A;  3OB2 B;  2OZG A;  2BO9 A;  4HNW B;  2Q04 A;  4A94 A;  1CX8 A;  3W91 A;  4PPZ A;  3SXN A;  1XJO A;  1IYL A;  1Z2L A;  5AG6 A;  5A27 A;  2XPN A;  2O4H A;  3FMC A;  1ARL A;  3D8P A;  3NH8 A;  1IY7 A;  2D4P A;  2PIZ A;  4OAE A;  1EZA A;  2PJ5 A;  3TC8 A;  4A31 A;  2B3V A;  2PJ2 A;  3GUX A;  4F0X A;  1LAM A;  1TF8 A;  3BJ8 A;  1ZLH A;  3D4U A;  1X10 A;  3S6H A;  5LYL A;  5LRJ A;  1T36 B;  3S9L A;  5F47 A;  5J3X A;  3S9N A;  4ORF A;  4IIY A;  3T0T A;  3G8W A;  2EO8 A;  2AJ6 A;  1X12 A;  2CF4 A;  4OLL A;  3IGR A;  4XPL A;  3R9G A;  2GAN A;  4Q7A A;  3C8O A;  2OOT A;  1Q2C A;  4PXC A;  3S6G A;  1JQG A;  3UY5 A;  5HKW A;  4B10 A;  4YN3 A;  2XPP A;  4KLW A;  4BIN A;  4MY0 A;  1CP6 A;  1Y7E A;  4GM5 A;  3T90 A;  4R3L A;  4R3K A;  4AB7 A;  3D7F A;  3FX6 A;  2YNC C;  4MJX A;  3T07 A;  4QVT A;  1YX0 A;  2VQY A;  4OIW A;  5JQ4 A;  4KOS A;  4UA3 A;  3EZE A;  4NGP A;  1R3N A;  3OAK A;  4LQG A;  2Q4V A;  2CNS A;  4A38 A;  4AVC A;  3TLE A;  4C2Z A;  3B2Y A;  3MRU A;  4MFQ A;  4E2A A;  4CAX A;  1YW4 A;  3C26 A;  4PQA A;  4M8D A;  3GLJ A;  4G1P A;  2ZEN A;  3G23 A;  1Z8W A;  4O23 A;  1IID A;  1IYK A;  1EZB A;  4BPU B;  2Q4Y A;  3DNS A;  3IWE A;  4NXY A;  2C6C A;  1VI4 A;  3DSB A;  3SJX A;  4BTF A;  1IIC A;  2PJ4 A;  4M6H A;  4MHD A;  4B11 A;  1VKC A;  3JVN A;  3HMJ G;  3T9Y A;  4CGL A;  4EYS A;  5IB0 A;  4P4F A;  2J9A A;  2B5G B;  3QAY A;  3BI1 A;  4JYW A;  1XRY A;  4KSA A;  3TLC A;  4UFV A;  4IF5 A;  3NE8 A;  3EIF A;  3IO1 A;  3R9E A;  1OZP A;  2J8M A;  1XIX A;  2I00 A;  4ONW A;  2EUI A;  4P6Y A;  2GP4 A;  5ISV A;  4HKF A;  1M4I A;  4MCQ A;  2XPL A;  2GIV A;  2PIY A;  4F9U A;  1J3L A;  3GJZ A;  4OC1 A;  1MJA A;  1S60 A;  4KOV A;  4C85 A;  2YND A;  4CS0 B;  1ZO0 A;  3SI0 A;  3PB8 X;  1Y9W A;  4A33 A;  3N5F A;  4OME A;  3IWW A;  2G9D A;  4E0A A;  5C82 A;  2CTC A;  1AMP A;  4CAW A;  4UWI A;  1ZLI A;  2DIK A;  2HQY A;  1NXJ A;  1V0C A;  4RN7 A;  5E96 A;  1YME A;  3BI0 A;  4NGT A;  2F7V A;  1CPS A;  3SJE A;  3RBU A;  1ON0 A;  1BXR B;  4R9M A;  1HDQ A;  4JWP A;  1TKJ A;  1BAV A;  4C9U A;  2VL1 A;  3CPA A;  4QB9 A;  3KKW A;  2Y1M A;  2ZEG A;  4PK2 A;  4A4C A;  8CPA A;  1P0H A;  4FUU A;  4HNX B;  2PR8 A;  4CYP A;  4C9R A;  1YSJ A;  2VZY A;  4CYN A;  3CDX A;  2V77 A;  3D67 A;  2Z3P A;  4BMH A;  4UF4 A;  4ZY1 A;  3D68 A;  4RI1 A;  4MBU A;  1ELL P;  3PRT A;  5DS0 A;  1A9X B;  1Q2D A;  2EBJ A;  5KTD A;  3KAS A;  1HEE A;  4KOY A;  1M4G A;  4UFW A;  5K8M A;  2V8V A;  4A39 A;  3FNC A;  4P4J A;  1QSM A;  4NGS A;  3IC1 A;  2VBQ A;  4C86 A;  4CYQ A;  2PVW A;  4C9V A;  1KBL A;  1XOV A;  4F9V A;  1RTQ A;  2AFW A;  3LAC A;  4B12 A;  3D2P A;  2P6F A;  2YNE A;  4MI1 A;  3O8Z A;  2A4N A;  3U88 C;  2ODF A;  2G3T A;  1CM0 A;  2B3U A;  2JEW A;  2V8H A;  3B7I A;  4FWU A;  4B14 A;  6CPA A;  5IV0 A;  3CPX A;  1CE8 B;  1BPN A;  2ZW4 A;  3NH4 A;  1M4D A;  3KQX A;  1M6V B;  4CDJ A;  3F0A A;  4CZ1 A;  5BWA B;  5HKZ A;  4CGP A;  4R6T A;  3I9S A;  2DF5 A;  3EY5 A;  1Q7L A;  2B4D A;  5G1Z A;  1ZL0 A;  3FIX A;  2V8G A;  4BD9 A;  2QYV A;  3D2M A;  1PU9 A;  5JVL A;  1KUV A;  2IL4 A;  2HRO A;  3PT1 A;  2HV2 A;  2ATR A;  2HC9 A;  3F9K C;  3B8G A;  3FJU A;  3JUW A;  5D8N A;  4ZI6 A;  4A30 A;  3VWE A;  3DR6 A;  4WJB A;  1LOK A;  3FBU A;  5CPA A;  3BUN B;  3VRO A;  3K2K A;  3K9T A;  4XNH C;  5G21 A;  5K8N A;  3A9L A;  2WPX A;  3PEI A;  4JZ0 A;  3K9U A;  1S3Z A;  4K30 A;  1KUY A;  1LRZ A;  2FXF A;  4UCM A;  2AUN A;  4E94 A;  4CGO A;  1VBH A;  5JH9 A;  3I74 A;  3H5Z A;  3R95 A;  1KUX A;  3H8G A;  1VHE A;  3NA6 A;  1ZRS A;  3B35 A;  3WC7 A;  5C88 A;  3CXS A;  1R61 A;  3TO9 A;  2AFZ A;  3BUX B;  1JWQ A;  1IB1 E;  1XMB A;  2K5T A;  3VRQ A;  3E0K A;  4I49 A;  3WC6 A;  3F8K A;  3P2H A;  3H8E A;  1EO0 A;  2C6G A;  1NSA A;  4W9Y A;  4P4D A;  1S5K A;  2AE6 A;  1WK4 A;  2FT0 A;  2J8R A;  2WYR A;  3IEH A;  3KHX A;  4KS9 A;  3KQZ A;  2DPS A;  4EME A;  2HWG A;  2CNT A;  3EZB A;  1S7L A;  2BUE A;  1ZYM A;  2ZEE A;  3HPG G;  2IJZ A;  3TLG B;  3RO0 A;  3D7H A;  2Q4Z A;  2CY2 A;  4M85 A;  2QML A;  1RXT A;  4L89 A;  1YVH A;  2PJ9 A;  3BUW B;  3NFQ A;  3TCV A;  3NFZ A;  4C8P A;  3DLJ A;  5K8P A;  2C6P A;  2ZW5 A;  2OLS A;  4C8T A;  1XMT A;  3KHZ A;  5F49 A;  3FVL A;  1Y0R A;  1GYT A;  2Z10 A;  5THW A;  4B5O A;  4B6Z A;  3ICU A;  4YGO A;  4OC3 A;  5CBM A;  1Z4E A;  1IGB A;  3B3W A;  2EK8 A;  1BOB A;  2VEZ A;  3VRR A;  2AFU A;  3CZX A;  3RZA A;  2GFQ A;  1Y9Z A;  2B4J C;  2OB0 A;  2YNC A;  3VH9 A;  2F8H A;  4L8A A;  5LRK A;  2XEF A;  4FD5 A;  4C8U A;  2Y0M A;  1L0C A;  1LFW A;  3RYO A;  2AUM A;  3KRV A;  4CYO A;  3BUM B;  2PJC A;  4XPD B;  5IR2 A;  1S7K A;  4KOU A;  4KVM E;  2B58 A;  4KOR A;  2PJ7 A;  2CBL A;  2D4O A;  4FAI A;  4M3S A;  4X2T A;  3TLA A;  3H8F A;  4UIA A;  4M6I A;  1Z8X A;  1QSN A;  4JXQ A;  4OC0 A;  4MY3 A;  2OZU A;  4U5Y A;  4H89 A;  2POK A;  3TO7 A;  2R7H A;  3JTK A;  1HDU A;  4C7H A;  5K99 A;  4A2Z A;  4C84 A;  4E5S A;  3ZNI A;  3JRU A;  4PK3 A;  5FD8 A;  3PGP A;  4HNY B;  3PB9 X;  4GS4 A;  3FEC A;  3CXQ A;  4C8C A;  4IK2 A;  3TYX A;  2JLM A;  1CBX A;  2Q44 A;  2EVN A;  1Q2Y A;  4B5P A;  3FF3 A;  4YRH A;  4ZBG A;  4UEF A;  3T8W A;  2RB7 A;  4BPX B;  2ZEM A;  4MFJ A;  4CAV A;  2WZN A;  4QUS A;  2FE7 A;  3L2N A;  1CP7 A;  2HB6 A;  2ZED A;  4MHZ A;  2XEI A;  2ARH A;  1XFO A;  4NCZ A;  3GYA A;  3HLP A;  3ISZ A;  1I12 A;  4CRY B;  4COG A;  2P6G A;  3EO4 A;  2JDC A;  2ANP A;  3VRP A;  2PVV A;  3PBE A;  1AYE A;  5G22 A;  1B87 A;  1WWZ A;  2B0A A;  3T5M A;  3ZZI A;  4NF1 A;  1ZG8 A;  4NJR A;  2EZB A;  2GLF A;  3PB7 X;  2R98 A;  5F09 A;  3ZJ0 A;  1SQH A;  4TJV A;  5F9M A;  4RUH A;  2HUZ A;  2G0B A;  1XBU A;  4GXH A;  5EBV A;  4AVA A;  5IX3 A;  1BPM A;  4ZX8 A;  2XPO A;  2OZH A;  4MHP A;  5LRG A;  4F0Y A;  3D7G A;  1XF8 A;  4FD4 A;  3VAT A;  4FD7 A;  3B3T A;  2CIJ A;  2FL4 A;  3VGO A;  4NSQ A;  3FYN A;  4MRI A;  5AG5 A;  2F5I A;  2WSA A;  4UIB A;  5J8F A;  5KTA A;  3EC4 A;  4KVO E;  3GB0 A;  1VBG A;  5F48 A;  3V7Z A;  4OP4 A;  5JGF A;  1CG2 A; 
#chains in the Genus database with same CATH homology
 4ZY2 A;  1PCA A;  4P10 A;  4YU9 A;  4H2K A;  3KZW A;  2PRQ A;  3KL9 A;  2XEJ A;  2BCO A;  3WAB A;  4NJQ A;  4OC4 A;  2ZEP A;  2GU2 A;  3D66 A;  4MXU A;  1QMU A;  4P4B A;  4OC2 A;  4MHN A;  3TX8 A;  3FED A;  2BOA A;  4KSI A;  5HVF A;  2EK9 A;  4ZX9 A;  4NGQ A;  4YWY A;  4CDK A;  2RFH A;  2C5Q A;  2I3C A;  2AFS A;  1Z5R A;  1WVM A;  4X3R A;  3B3V A;  4F8Z A;  1F2P A;  2PE3 A;  4X8I A;  1PYT B;  3ISX A;  4EFD A;  2ZEL A;  3IJ3 A;  4NGR A;  2PJ8 A;  1XF1 A;  4MCS A;  3WC5 A;  5LYF A;  4P44 A;  4PXD A;  3KI9 A;  4P4I A;  4TWE A;  4OC5 A;  3KR4 A;  1FNO A;  2QJ8 A;  5JM6 A;  3VAR A;  4C99 A;  1F2O A;  4WWV A;  1DE4 C;  2JBK A;  4KNG E;  4K3N A;  1LAN A;  3B3S A;  4Z65 A;  2PJB A;  3SI2 A;  3S9M A;  4C9E A;  4DJL A;  3PB6 X;  2AFX A;  4NGM A;  1FT7 A;  3D7D A;  3BHX A;  3SJG A;  2ZOF A;  4P4E A;  3BXM A;  5IB9 A;  1KWM A;  4DUK A;  1F57 A;  2EWB A;  4DYO A;  2PJ1 A;  1TKH A;  3SI1 A;  5ELY A;  2C1C A;  1LAP A;  3B3C A;  5HXD A;  4P45 A;  2ZOG A;  3IIB A;  1VIX A;  2IQ6 A;  3KGQ A;  2DEA A;  1QQ9 A;  2PJA A;  2PJ3 A;  4R7M A;  4IAV A;  1BLL E;  3SJF A;  4OKO A;  3DGV A;  1ARM A;  1LCP A;  2NSM A;  3LWU A;  2O53 A;  5K8O A;  2CTB A;  2IMO A;  2PJ0 A;  4R8F A;  4UEE A;  2ABZ A;  5I4M A;  5LYD A;  1TXR A;  2Q51 A;  1EE3 P;  5LYI A;  1TKF A;  7CPA A;  2ZEF A;  3HUV A;  4ZYQ A;  1VHO A;  4MMO A;  3QNV A;  3IFE A;  4C8F A;  2QVP A;  1R43 A;  1VGY A;  2GLJ A;  4ZY0 A;  3LMS A;  4C9A A;  4UEZ A;  4CPA A;  1DTD A;  2GRE A;  3FH4 A;  3I1U A;  4EWT A;  1YLO A;  2PJ6 A;  3PFE A;  3VTA A;  2AFM A;  4NGN A;  4TNU A;  1H8L A;  1CPX A;  3KR5 A;  4IHM A;  4PXE A;  3WT4 A;  1ZG9 A;  1ZG7 A;  1YW6 A;  1V6C A;  4TJX A;  1M4L A;  3MN8 A;  3I6S A;  1ELM P;  4NFR A;  2AFO A;  1UWY A;  5D29 A;  4MHY A;  3RAM A;  4AXV A;  4PXB A;  2OR4 A;  5J1Q A;  2ZEH A;  1Y0Y A;  4OID A;  3PBB A;  4A37 A;  1Z8L A;  2PCU A;  1OBR A;  4MCR A;  2ZEO A;  2FVG A;  2JBJ A;  2Q43 A;  5HVG A;  3CT9 A;  3NH5 A;  3PB4 X;  2V8D A;  1TF9 A;  4MCP A;  2NYQ A;  4R76 A;  3FEE A;  2XEG A;  3PFO A;  3V38 A;  4FBE A;  5HVH A;  2BO9 A;  4A94 A;  1CX8 A;  4PPZ A;  1XJO A;  1Z2L A;  2O4H A;  3FMC A;  3NH8 A;  1ARL A;  1IY7 A;  2PIZ A;  2PJ5 A;  3TC8 A;  2PJ2 A;  3GUX A;  1LAM A;  1TF8 A;  1ZLH A;  3D4U A;  5LYL A;  5LRJ A;  3S9L A;  3S9N A;  2CF4 A;  4Q7A A;  2OOT A;  4YN3 A;  4PXC A;  1JQG A;  1CP6 A;  1Y7E A;  4GM5 A;  3D7F A;  3FX6 A;  4OIW A;  4NGP A;  1R3N A;  4LQG A;  4A38 A;  3B2Y A;  3MRU A;  1YW4 A;  4PQA A;  3GLJ A;  4G1P A;  2ZEN A;  4O23 A;  2C6C A;  3SJX A;  2PJ4 A;  4P4F A;  2J9A A;  3BI1 A;  4JYW A;  1XRY A;  3EIF A;  3IO1 A;  2GP4 A;  4ONW A;  4P6Y A;  4MCQ A;  2PIY A;  4F9U A;  4OC1 A;  3SI0 A;  3PB8 X;  3N5F A;  4OME A;  3IWW A;  2G9D A;  2CTC A;  1AMP A;  1ZLI A;  1YME A;  3BI0 A;  4NGT A;  2F7V A;  1CPS A;  3SJE A;  3RBU A;  1HDQ A;  1TKJ A;  1BAV A;  4C9U A;  2VL1 A;  3CPA A;  2ZEG A;  8CPA A;  4FUU A;  4C9R A;  1YSJ A;  3CDX A;  2V77 A;  3D67 A;  4UF4 A;  4ZY1 A;  3D68 A;  1ELL P;  3PRT A;  5DS0 A;  3KAS A;  1HEE A;  5K8M A;  2V8V A;  4A39 A;  4P4J A;  3IC1 A;  4NGS A;  4C86 A;  2PVW A;  4C9V A;  4F9V A;  1RTQ A;  2AFW A;  3B7I A;  2V8H A;  2JEW A;  4FWU A;  4C85 A;  6CPA A;  3CPX A;  1BPN A;  3NH4 A;  3KQX A;  4CDJ A;  4R6T A;  1Q7L A;  4BD9 A;  2V8G A;  2QYV A;  2HC9 A;  5D8N A;  3FJU A;  4ZI6 A;  4WJB A;  1LOK A;  5CPA A;  3K2K A;  3K9T A;  5K8N A;  3PEI A;  4JZ0 A;  3I74 A;  5JH9 A;  3H8G A;  3NA6 A;  1VHE A;  3B35 A;  3WC7 A;  2AFZ A;  1XMB A;  3WC6 A;  3H8E A;  2C6G A;  1NSA A;  4W9Y A;  4P4D A;  2WYR A;  3IEH A;  3KHX A;  4EME A;  3KQZ A;  2ZEE A;  2IJZ A;  3D7H A;  2Q4Z A;  2PJ9 A;  3NFZ A;  4C8P A;  3DLJ A;  5K8P A;  2C6P A;  4C8T A;  3KHZ A;  4B6Z A;  3FVL A;  1Y0R A;  1GYT A;  5THW A;  3ICU A;  4OC3 A;  5CBM A;  1IGB A;  3B3W A;  2EK8 A;  2AFU A;  3RZA A;  1Y9Z A;  3VH9 A;  5LRK A;  2F8H A;  2XEF A;  4C8U A;  1LFW A;  2PJC A;  5IR2 A;  2PJ7 A;  4FAI A;  4X2T A;  3H8F A;  4UIA A;  4OC0 A;  2POK A;  1HDU A;  4C84 A;  3JRU A;  3PB9 X;  3FEC A;  4C8C A;  4IK2 A;  1CBX A;  3FF3 A;  4UEF A;  3T8W A;  2RB7 A;  2ZEM A;  2WZN A;  3L2N A;  1CP7 A;  2HB6 A;  2ZED A;  4MHZ A;  2XEI A;  1XFO A;  3HLP A;  3ISZ A;  2ANP A;  2PVV A;  3PBE A;  1AYE A;  1ZG8 A;  4NJR A;  2GLF A;  3PB7 X;  5F09 A;  4TJV A;  4RUH A;  1XBU A;  1BPM A;  4ZX8 A;  4MHP A;  5LRG A;  3D7G A;  3VAT A;  3B3T A;  2CIJ A;  4MRI A;  4C8A A;  4UIB A;  3GB0 A;  3V7Z A;  4OP4 A;  5JGF A;  1CG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...