3SJGA

Human glutamate carboxypeptidase ii (e424a inactive mutant ) in complex with n-acetyl-aspartyl-aminooctanoic acid
Total Genus 269
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
269
sequence length
696
structure length
696
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
publication title Novel Substrate-Based Inhibitors of Human Glutamate Carboxypeptidase II with Enhanced Lipophilicity.
pubmed doi rcsb
source organism Homo sapiens
total genus 269
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3sjgA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3sjgA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3sjgA02
2CF4A 2QYVA 1TKHA 2BCOA 4PPZA 1VHOA 1YW6A 4R8FA 5HVHA 4P10A 4P4IA 1TKJA 3PB9X 4NJQA 4P4JA 3KHZA 2PJ3A 1Y0YA 4ZX9A 4DJLA 4MXUA 4FUUA 5D29A 4C8TA 4ZY1A 1IY7A 4CDJA 3LWUA 4YN3A 1TXRA 2ZEHA 2ZEEA 3RAMA 1YSJA 3D7FA 4C86A 3FX6A 2PJ4A 4C9RA 3FEEA 1TKFA 3I6SA 3H8GA 1IGBA 3VARA 5K8MA 3PRTA 4OC5A 4MHZA 4JYWA 4P4BA 3PB7X 4OIDA 3S9MA 3GUXA 1BPMA 4UIAA 1CX8A 2AFMA 3JRUA 5LYIA 5THWA 3S9NA 1QQ9A 1Z2LA 3FVLA 2PJ2A 4NJRA 1CPXA 2I3CA 4IHMA 4Z65A 4C9AA 4WJBA 4NGTA 1GYTA 5LYFA 3PBBA 4FBEA 4C84A 1LANA 4X3RA 8CPAA 4PXDA 1BPNA 3FF3A 2F8HA 2CTBA 4TWEA 4NGSA 1V6CA 4PQAA 3FH4A 3WT4A 3ISZA 3D7DA 3D66A 2GU2A 1LFWA 3IIBA 4LQGA 2EWBA 4X8IA 4R6TA 3TC8A 4ZY0A 3FMCA 3HUVA 5HVGA 1XBUA 3D67A 2O53A 2C6CA 4MHYA 4R76A 4A38A 3D4UA 1BAVA 3FECA 2BO9A 4OKOA 2V77A 1VHEA 4IAVA 4UEEA 3RZAA 2ZEGA 2PIZA 5K8OA 3PEIA 2VL1A 1KWMA 1WVMA 3NH4A 2ZEOA 4W9YA 1FNOA 5JM6A 2WZNA 7CPAA 2XEJA 2PVWA 4MHPA 3SJGA 5F09A 3V38A 1ZLIA 5JGFA 2PJ6A 4NGNA 4ZYQA 1R3NA 2O4HA 3WC5A 3PBEA 4C9UA 2PJ1A 4CDKA 4C99A 5HVFA 1ARLA 3CPAA 5LYLA 3BI1A 1CG2A 2PE3A 1YLOA 3N5FA 4BD9A 4JZ0A 3B3WA 2PRQA 3GB0A 3GLJA 2ZELA 1ZG8A 1OBRA 4YWYA 3I74A 5I4MA 4WWVA 4NGPA 3LMSA 4A39A 1CBXA 3B3VA 3IFEA 3DGVA 2BOAA 4C9EA 4MCSA 5HXDA 4MCPA 4R7MA 1Q7LA 4UIBA 4F9VA 2QJ8A 1HEEA 3KR5A 3SJXA 4AXVA 2G9DA 4DUKA 3WC7A 3CPXA 3ISXA 2HB6A 5ELYA 1JQGA 3D68A 1PYTB 2PJAA 3PB8X 1LCPA 2EK8A 1VIXA 4EWTA 2ZEMA 4C8AA 2J9AA 1RTQA 4OC2A 4UEFA 1AYEA 2POKA 3NA6A 2C6GA 3KGQA 5JH9A 4C8CA 2NYQA 4PXBA 3D7HA 3D7GA 3KL9A 1XF1A 1LOKA 4EMEA 3SI2A 2ZENA 4MCQA 4Q7AA 4TJVA 4MHNA 3B7IA 1TF9A 4F9UA 3B3SA 1H8LA 1FT7A 4C9VA 2IJZA 2GLFA 3K2KA 4G1PA 4MRIA 3BXMA 4GM5A 2AFWA 3MRUA 3H8EA 3NFZA 2C6PA 3EIFA 1TF8A 1Z8LA 1F57A 4UEZA 5LYDA 4X2TA 3KI9A 2Q43A 3KR4A 4MMOA 1ELLP 1PCAA 4PXEA 2C1CA 5LRKA 2EK9A 4P44A 5LRGA 2NSMA 3PB6X 1XJOA 2PJ9A 3PFEA 2CTCA 1YMEA 2V8DA 4FWUA 4C85A 2ABZA 3L2NA 1Z5RA 2V8GA 2ZOGA 5J1QA 6CPAA 4OMEA 3CT9A 3ICUA 5CBMA 4NGRA 4K3NA 2V8VA 1YW4A 3FJUA 3B3TA 2ANPA 3B35A 2PJ0A 2ZOFA 2PVVA 1CP6A 3VATA 1ARMA 1CPSA 3B2YA 3K9TA 1F2OA 3H8FA 2Q4ZA 5DS0A 4ZI6A 3T8WA 3NH5A 3IO1A 4A94A 5IB9A 2JBJA 1ZG7A 1M4LA 5CPAA 5D8NA 2IQ6A 1DE4C 2PJ8A 1UWYA 3V7ZA 3SI0A 2PJ5A 1XFOA 1ZLHA 4OC4A 3S9LA 4O23A 2OR4A 3IC1A 2OOTA 1QMUA 2PJBA 2ZEPA 2Q51A 3I1UA 2HC9A 4TNUA 4P6YA 3KQXA 3HLPA 1NSAA 4ZX8A 1CP7A 4CPAA 4UF4A 4P4FA 2IMOA 4A37A 2CIJA 3B3CA 2DEAA 4IK2A 4YU9A 3RBUA 4EFDA 4F8ZA 4KNGE 4OC1A 2QVPA 1Y9ZA 2JBKA 1F2PA 2GLJA 3VH9A 3VTAA 1R43A 3DLJA 4RUHA 2AFOA 2ZEDA 1BLLE 2RB7A 1LAMA 3PB4X 4P4EA 1DTDA 3IWWA 4NGQA 3SJEA 3MN8A 4ZY2A 1XRYA 2RFHA 3IJ3A 5K8NA 2XEFA 3BI0A 3CDXA 1ELMP 3NH8A 2AFSA 4OC0A 3KASA 4TJXA 4FAIA 2XEGA 2XEIA 2JEWA 4MCRA 1AMPA 2FVGA 1VGYA 5K8PA 3SI1A 3KQZA 3QNVA 2AFZA 4P4DA 4KSIA 4C8PA 1EE3P 4H2KA 3IEHA 4OP4A 5LRJA 2PJCA 2PJ7A 4NFRA 1XMBA 1Y0RA 3WC6A 4C8FA 3KHXA 1HDUA 4NGMA 2GREA 1Y7EA 2ZEFA 4C8UA 2F7VA 4OIWA 1HDQA 4PXCA 3WABA 2AFXA 4B6ZA 1ZG9A 3BHXA 4OC3A 1LAPA 2PCUA 2AFUA 4P45A 3PFOA 2WYRA 3TX8A 4DYOA 3KZWA 2PIYA 2V8HA 3FEDA 4ONWA 3SJFA
chains in the Genus database with same CATH superfamily
2CF4A 2QYVA 1TKHA 4ZBGA 2BCOA 2EZBA 4PPZA 1VHOA 3G23A 1YW6A 2ZPAA 2AUMA 4R8FA 4R9MA 5HVHA 3TLGB 4P10A 1K4JA 4P4IA 3BUWB 3TOBA 1TKJA 3TCVA 1M1DA 3GYAA 3PB9X 1SQHA 4RI1A 4F6AA 1XIXA 1RXTA 2AE6A 4NJQA 4P4JA 3E0KA 3KHZA 3U1BA 2PJ3A 1Y0YA 2X7BA 4ZX9A 4DJLA 3GY9A 3GJZA 3FNCA 4MXUA 5ISVA 3IWEA 4FUUA 2CNTA 2OZGA 4A31A 5D29A 4C8TA 4ZY1A 1IY7A 4QUSA 2WPXA 4MHDA 1XF8A 4CYNA 2HWGA 3LWUA 4YN3A 1TXRA 2ZEHA 1R57A 4CDJA 1QSOA 1P0HA 1ZO0A 2ZEEA 3RAMA 1YSJA 4C7HA 3D7FA 2B0AA 4CGPA 4C86A 3FX6A 3ZZIA 2PJ4A 3R9GA 4KVME 1XE4A 2Q0YA 4C9RA 3T9YA 3I3GA 5H84A 3FEEA 1TKFA 3BLNA 3I6SA 1YREA 2PR8A 1I21A 1IGBA 3H8GA 2BUEA 3VARA 5K8MA 4BTFA 3PRTA 4OC5A 4MHZA 1NXJA 4JYWA 4P4BA 2PDOA 2B3VA 3PB7X 3RNZA 3PGPA 4OIDA 2EVNA 3S9MA 3GUXA 2JDDA 1BPMA 4LQ6A 3T0TA 5AXIA 3F0AA 4UIAA 1CE8B 1CX8A 2AFMA 3R96A 4H6UA 3JRUA 2C5QA 3GKRA 5LYIA 3F8KA 1FY7A 2ATRA 2B5GA 4XNHC 3TLYA 2OZHA 5AG7A 5THWA 3S9NA 1QQ9A 1Z2LA 3FVLA 2PJ2A 1IU8A 1CPXA 2I3CA 3PP9A 4IHMA 4J3GA 4KVOE 4NJRA 3UY5A 5HMNA 3TYXA 1C3OB 4CZ1A 4KZTA 4Q38A 4A30A 4UFVA 2OH1A 1VHSA 2FE7A 3A9LA 4WJBA 4NGTA 1GYTA 5LYFA 3T07A 2FL4A 1S3ZA 3T90A 3PBBA 2D0PA 1J4JA 5DWMA 4FBEA 4ZGYB 2MP0A 2YJVA 2ODFA 3JTKA 3OAKA 4C84A 1LANA 3TOAA 4X3RA 2EO8A 8CPAA 3FRMA 3D2MA 4PXDA 1BPNA 4OAEA 3FF3A 4MY3A 2F8HA 2CTBA 4TWEA 4NGSA 3TTHA 1V6CA 2OB0A 4PQAA 5K99A 1MJAA 3FBUA 3FH4A 3WT4A 3ISZA 3TLEA 3D7DA 2GU2A 3D66A 1IOIA 1LFWA 1Q2YA 3IIBA 4GS4A 5DWNA 4CRZB 4GPLB 2Q44A 4LQGA 4PK2A 2EWBA 3EC4A 3GIUA 1ZYMA 4X8IA 3F5BA 4R6TA 3TC8A 4ZY0A 1IYLA 1IB1E 2D4PA 1IIDA 4FD7A 3ZNIA 3HPGG 4KOYA 3FMCA 1RO5A 3HUVA 3KKWA 3QB8A 4JXRA 5HVGA 1XBUA 3D67A 2O53A 2C6CA 4MHYA 2EUIA 4R76A 2Q04A 4E8OA 1Z9UA 1Y9WA 4U5YA 4A38A 2ZW7A 2VZYA 3D4UA 4A32A 1YLEA 1BAVA 3FECA 4CAFA 2BO9A 3CXPA 4MFQA 2V77A 1VHEA 2D4OA 4OKOA 4U9ZA 5G21A 2FM4A 4IAVA 1BOBA 5HKWA 1QSTA 4UEEA 3V8IA 3RZAA 3I74A 2ZEGA 4Z65A 2PIZA 5K8OA 3IGRA 3TO9A 5KTAA 1S7NA 3PEIA 4MY0A 2BSWA 2VL1A 1Y9KA 3S6GA 2E28A 3VGOA 2Z3OA 4QBJA 4KUAA 1KWMA 1WVMA 3NH4A 2ZEOA 2ZW5A 4W9YA 1FNOA 5JM6A 2WZNA 3TE4A 4BMHA 7CPAA 1NBWA 3H5ZA 2XEJA 3R1KA 2PVWA 3VRRA 4MHPA 3BUNB 3SJGA 5F09A 2YNDA 1ZLIA 3V38A 5JGFA 1T36B 2PJ6A 2P0WA 1EZAA 2DIKA 2P6FA 4NGNA 4A4CA 4AB7A 2ZW6A 4ZYQA 1R3NA 2O4HA 2FXFA 3WC5A 4UA3A 5BWAB 3PBEA 5J8FA 1L0CA 2Z3MA 5IB0A 4C9UA 4A2ZA 4PV6A 4XPDC 2YGWA 4C68A 5AG4A 3T05A 2PJ1A 4CDKA 3VROA 1IYKA 1CM0A 3VWEA 3DNSA 1C30B 1YQEA 5HVFA 4C99A 1ARLA 3CPAA 5LYLA 3BI1A 3HMJG 1B87A 1CG2A 2PE3A 3P2FA 4CYPA 1YLOA 4HNYB 3LACA 3N5FA 4BD9A 2H5MA 3EZEA 4M6GA 5F47A 4JZ0A 3B3WA 3EZAA 3H4QA 3VWDA 2PRQA 3GB0A 3ZJ0A 4F0XA 3PLFB 2OZUA 3GLJA 2ZELA 1ZG8A 4LUAA 5FVJA 4DNCA 1OBRA 1YVHA 2ZXVA 5G1ZA 4FD6A 4YWYA 3SHPA 1XMTA 4NGPA 3LMSA 4WWVA 4A39A 4CGLA 2Z3PA 1CS0B 2CNMA 1CBXA 3CXSA 3B3VA 4UWJA 5H86A 3IFEA 3DGVA 3RYOA 4KS9A 1M4GA 5I4MA 2B5GB 2C27A 2BOAA 2QECA 1IICA 2YJTA 4MFZA 2DLAA 3BUMB 4C9EA 4MCSA 5HXDA 4MCPA 4R7MA 2IL4A 4CO9A 1Q7LA 1S5KA 4I49A 4UIBA 4F9VA 2QJ8A 1HEEA 2DPTA 1A9XB 4C7IA 2BEIA 5JQ4A 4KOVA 3K4IA 3FB3A 4A95A 3KR5A 3SJXA 2HUZA 4AXVA 3BUXB 4CAVA 4UFXA 2G9DA 4DUKA 4KOUA 1J3LA 2Z10A 1GGOA 3WC7A 1M6VB 3CPXA 4IUSA 4COGA 3U88C 2OU2A 1KZFA 3ISXA 2HB6A 3MGDA 1VKCA 1KUYA 5ELYA 3BJ8A 1JQGA 4L89A 3SXOA 3D68A 1PYTB 2GE3A 4HNXB 4R3LA 2PJAA 2VQYA 4CRYB 1Y7RA 3PB8X 2VZZA 1Z8WA 1LCPA 2HV2A 2EK8A 1VIXA 3C26A 4A33A 4EWTA 4U9YA 4INJA 3VRPA 2ZEMA 4HNWB 4QVTA 4C8AA 2J9AA 1QSRA 1RTQA 4J0NA 4F0YA 4OC2A 2K5TA 1YK3A 4XPDB 3QAHA 4KLVA 4OADA 3FIXA 1PUAA 2B4JC 1Z9EA 5J3XA 3PZJA 4UEFA 1AYEA 3W6XA 4E5SA 3S6HA 4CYOA 2POKA 3NA6A 3IU1A 2P6EA 2C6GA 3TFYA 2Q7SA 1VI4A 3KGQA 2XPLA 5JH9A 1VBGA 4C8CA 4MI1A 2NYQA 4KLWA 3G3SA 3BUOB 4PXBA 3D7HA 1KBLA 3D7GA 5KTCA 2CY2A 1WWZA 4JWPA 5EMIA 3IWGA 3OWCA 1EO0A 1B6BA 2B4DA 3KL9A 4BINA 2R98A 2I79A 1XF1A 3D3SA 1LOKA 4LX9A 4H1HA 4RR2B 2Z11A 4EMEA 3SI2A 1M44A 2N3AB 1YVOA 2ZENA 4M6HA 5F49A 4X5KA 2VBQA 4MCQA 2VEZA 2PR1A 4B5OA 4Q7AA 5AG5A 4TJVA 4MHNA 3B7IA 5F46A 3OB1B 1TF9A 3DDDA 1KC7A 2REEA 1Z8TA 4NCZA 4F9UA 3B3SA 4BPXB 1H8LA 5JYBA 1FT7A 2YNEA 5JPHA 2XPNA 3OB2B 1Z4EA 2R1IA 4C9VA 2G3AA 2IJZA 3P2HA 2GLFA 3EO4A 4PK3A 3K9UA 1Q5XA 2EZAA 3K2KA 4G1PA 3SR3A 3RO0A 3NE7A 1KEEB 2REFA 4MRIA 3BXMA 2Z3KA 4GM5A 3NOJA 2HROA 2AFWA 3MRUA 2B58A 2OLSA 3O8ZA 1Q2CA 2YNCC 3H8EA 5EBVA 3R9FA 3NFZA 3F9KC 2C6PA 3N7ZA 2DF5A 2RC4A 4AG7A 5BY0A 3B8GA 4QB9A 4XNHB 2QMLA 1ZL0A 3EIFA 2UV8G 1KUVA 1Z8LA 1TF8A 1F57A 4UEZA 5LYDA 4X2TA 3KI9A 2Q43A 2Z3NA 3KR4A 1MJ9A 2HQYA 1ELLP 4MMOA 2B4BA 1PCAA 4RS2A 5HKYA 2CNSA 4CAWA 1BXRB 1NMTA 4PXEA 5F9MA 2C1CA 1JWQA 3D8PA 2EK9A 5LRKA 4MJXA 4P44A 5LRGA 2NSMA 1FBVA 3PB6X 2WUUA 3DSBA 1XJOA 2KCWA 3VRQA 2WSAA 2PJ9A 3FYNA 2PC1A 4M85A 1P4NA 2AJ6A 3PFEA 4GXHA 4H6ZA 1IOFA 4UWIA 3TLBA 2VI7A 2CTCA 4FD4A 1XOVA 1YMEA 4COBA 2F5IA 4KOSA 4JXQA 2V8DA 4FWUA 1YX0A 2Z3LA 4B11A 2ABZA 2GFQA 1Z5RA 2V8GA 3L2NA 2FIAA 4UCMA 3TO7A 4B5PA 4MFPA 2Y0MA 2ZOGA 5J1QA 3JUWA 4JD6A 2PCNA 1M4DA 6CPAA 4OMEA 3CT9A 5F13A 3ICUA 5CBMA 5A28A 4NGRA 2Q4YA 2DXQA 4K3NA 3SXNA 2V8VA 4B14A 4CS0B 1YW4A 4Y49C 3FJUA 1LRZA 3B3TA 2ANPA 3B35A 4II9A 2PJ0A 2VKZG 2ZOFA 4BPUB 2O28A 2PVVA 1CP6A 3LD2A 3NE8A 1ARMA 2FIWA 2ZW4A 1CPSA 3B2YA 3K9TA 4YGOA 4NXYA 5HH1A 1F2OA 3H8FA 1X12A 2HI6A 5CNPA 3FXTA 4MFJA 5F1YA 5I0CA 2Q4ZA 4NSQA 4CAEA 5DS0A 2B3UA 4ZI6A 3T8WA 3NH5A 1I1DA 3IO1A 4A94A 5IB9A 2JBJA 1KUXA 1ZG7A 4MFKA 4ONUA 4MJ8A 4Q36A 4UCPA 1M4LA 4E0AA 5CPAA 3W91A 4KORA 5GCNA 5D8NA 1NSLA 4JVOA 2J8MA 3PT1A 2IQ6A 1DE4C 2PJ8A 3R95A 2WPWA 5J8CA 4L8AA 1OZPA 4KOTA 2GANA 4KUBA 1XEBA 4UCNA 3T5MA 1UFHA 2PQ8A 5F48A 4EYSA 1UWYA 1ON0A 3V7ZA 4NEXA 2XPPA 3SI0A 4CGNA 4HKFA 4CGOA 2NMTA 2PJ5A 3OP0A 1XFOA 1ZLHA 4OC4A 3S9LA 4FD5A 4H89A 1S7FA 4O23A 2OR4A 4CAXA 4AG9A 5FD8A 2GIVA 3IC1A 3HPHE 2OOTA 1QMUA 2PJBA 2ZEPA 2Q51A 3I1UA 3NFQA 2FCKA 2ARHA 4AVAA 1JDBC 2HC9A 2B4DB 4AVCA 4TNUA 1MK4A 4MBUA 2P6GA 3TLGA 4P6YA 3KQXA 3HLPA 3C8OA 4IIXA 4C2ZA 1NSAA 4ZX8A 5AGEA 4CYQA 1CP7A 4CPAA 3KRVA 4C85A 4UF4A 4P4FA 1CJWA 1DIKA 2IMOA 3DR8A 1U6MA 2CIJA 2BL1A 4IF5A 3S6FA 4A37A 1S7KA 2JEVA 2Z0ZA 3G8WA 3TO6A 1R61A 1X10A 2YNCA 3B3CA 3LODA 4HPSA 4E2AA 5A27A 2DEAA 3EXNA 4IK2A 3RBUA 4YU9A 4EFDA 4F8ZA 4PSWA 2A4NA 4UBRA 4KNGE 4OC1A 3CXQA 2QVPA 1Y9ZA 2JBKA 1F2PA 2GLJA 3VH9A 3VTAA 5JVLA 3R9EA 1R43A 3DLJA 1Z8XA 4RUHA 2AFOA 4A4BA 1B47A 2ZEDA 4M6IA 4BBHA 4Y49B 1BLLE 2RB7A 4MFLA 1I12A 1LAMA 3PB4X 4P4EA 4XPLA 2GP4A 1WK4A 1DTDA 1VBHA 3IWWA 4B13A 3TLCA 4NGQA 3SJEA 1MJBA 4JLYA 5HKZA 1S60A 3MN8A 2JDCA 4ZY2A 1M4IA 4QC6A 1AUGA 3W6SA 3VATA 2JLMA 1XRYA 2RFHA 1YVKA 3IJ3A 5K8NA 2EZCA 2R82A 2XEFA 2FT0A 3CZXA 3EY5A 5G20A 1ZRSA 4M8DA 4R57A 2AUNA 2QIRA 4KVXA 3BI0A 1PU9A 1Q2DA 4BPWB 3CDXA 3VRNA 1ELMP 3EFAA 3NH8A 1S7LA 2AFSA 2XPOA 4UFWA 3KASA 4OC0A 1TIQA 4M3SA 4FAIA 4MI4A 4TJXA 3TLAA 1BO4A 4YFJA 2XEGA 2XEIA 5KTDA 4EVYA 1QSNA 2JEWA 4MCRA 1N71A 3TT2A 4CGMA 1EZBA 5C88A 1AMPA 2FVGA 1VGYA 4KOWA 1YR0A 5EC4A 3SI1A 4XPKA 4B5PB 5K8PA 3KQZA 3QNVA 2AFZA 4P4DA 2CBLA 4KSIA 4C9AA 4PSXA 3TLZA 4KSAA 5C82A 4C8PA 4C2XA 1GHEA 1EE3P 4H2KA 5AG6A 3S6KA 2R8VA 3PFVA 2FS5A 3IEHA 4OP4A 2Q7BA 4YRHA 5LRJA 2FSRA 2PJ7A 2PJCA 2PRBA 4C2YA 5IR2A 4NFRA 1XMBA 1YGHA 1Y0RA 4R3KA 1V0CA 2DPSA 3WC6A 4C8FA 1NE9A 3D2PA 4RN7A 5G22A 4JJXA 1HDUA 4NGMA 2GREA 1Y7EA 2ZEFA 3KHXA 2D0OA 4B12A 3EZBA 2F7VA 4OIWA 4C8UA 1HDQA 2G0BA 2CXAA 1QSMA 2G3TA 2I00A 4PXCA 2Q4VA 1WJTA 4KSFA 3WABA 2AFXA 5IV0A 2Y1NA 2R7HA 2VXKA 2Y1MA 1ZG9A 2J8RA 3BJ7A 4B6ZA 3BHXA 4OC3A 1LAPA 2PCUA 2PSWA 2AFUA 3WR7A 4P45A 4ORFA 3PFOA 2WYRA 3I9SA 3TX8A 4R87A 4DYOA 3KZWA 4E94A 3DR6A 4KOXA 5F5XA 2EBJA 3IU2A 5E96A 1JDEA 2PIYA 4OLLA 5IX3A 2V8HA 3FEDA 3QAYA 4ONWA 4AVBA 3JVNA 4IIYA 1A2ZA 1Z4RA 4B10A 4K30A 4NF1A 2X0SA 2J8NA 3SJFA
chains in the Genus database with same CATH topology
2CF4A 2QYVA 1TKHA 2BCOA 4PPZA 1VHOA 1YW6A 4R8FA 5HVHA 4P10A 4P4IA 1TKJA 3PB9X 4NJQA 4P4JA 3KHZA 2PJ3A 1Y0YA 4ZX9A 4DJLA 4MXUA 4FUUA 5D29A 4C8TA 4ZY1A 1IY7A 4CDJA 3LWUA 4YN3A 1TXRA 2ZEHA 2ZEEA 3RAMA 1YSJA 3D7FA 4C86A 3FX6A 2PJ4A 4C9RA 3FEEA 1TKFA 3I6SA 3H8GA 1IGBA 3VARA 5K8MA 3PRTA 4OC5A 4MHZA 4JYWA 4P4BA 3PB7X 4OIDA 3S9MA 3GUXA 1BPMA 4UIAA 1CX8A 2AFMA 3JRUA 2C5QA 5LYIA 5THWA 3S9NA 1QQ9A 1Z2LA 3FVLA 2PJ2A 4NJRA 1CPXA 2I3CA 4IHMA 4Z65A 4C9AA 4WJBA 4NGTA 1GYTA 5LYFA 3PBBA 4FBEA 4C84A 1LANA 4X3RA 8CPAA 4PXDA 1BPNA 3FF3A 2F8HA 2CTBA 4TWEA 4NGSA 1V6CA 4PQAA 3FH4A 3WT4A 3ISZA 3D7DA 3D66A 2GU2A 1LFWA 3IIBA 4LQGA 2EWBA 4X8IA 4R6TA 3TC8A 4ZY0A 3FMCA 3HUVA 5HVGA 1XBUA 3D67A 2O53A 2C6CA 4MHYA 4R76A 4A38A 3D4UA 1BAVA 3FECA 2BO9A 4OKOA 2V77A 1VHEA 4IAVA 4UEEA 3RZAA 2ZEGA 2PIZA 5K8OA 3PEIA 2VL1A 1KWMA 1WVMA 3NH4A 2ZEOA 4W9YA 1FNOA 5JM6A 2WZNA 7CPAA 2XEJA 2PVWA 4MHPA 3SJGA 5F09A 3V38A 1ZLIA 5JGFA 2PJ6A 4NGNA 4ZYQA 1R3NA 2O4HA 3WC5A 3PBEA 4C9UA 2PJ1A 4CDKA 4C99A 5HVFA 1ARLA 3CPAA 5LYLA 3BI1A 1CG2A 2PE3A 1YLOA 3N5FA 4BD9A 4JZ0A 3B3WA 2PRQA 3GB0A 3GLJA 2ZELA 1ZG8A 1OBRA 4YWYA 3I74A 5I4MA 4WWVA 4NGPA 3LMSA 4A39A 1CBXA 3B3VA 3IFEA 3DGVA 2BOAA 4C9EA 4MCSA 5HXDA 4MCPA 4R7MA 1Q7LA 4UIBA 4F9VA 2QJ8A 1HEEA 3KR5A 3SJXA 4AXVA 2G9DA 4DUKA 3WC7A 3CPXA 3ISXA 2HB6A 5ELYA 1JQGA 3D68A 1PYTB 2PJAA 3PB8X 1LCPA 2EK8A 1VIXA 4EWTA 2ZEMA 4C8AA 2J9AA 1RTQA 4OC2A 4UEFA 1AYEA 2POKA 3NA6A 2C6GA 3KGQA 5JH9A 4C8CA 2NYQA 4PXBA 3D7HA 3D7GA 3KL9A 1XF1A 1LOKA 4EMEA 3SI2A 2ZENA 4MCQA 4Q7AA 4TJVA 4MHNA 3B7IA 1TF9A 4F9UA 3B3SA 1H8LA 1FT7A 4C9VA 2IJZA 2GLFA 3K2KA 4G1PA 4MRIA 3BXMA 4GM5A 2AFWA 3MRUA 3H8EA 3NFZA 2C6PA 3EIFA 1TF8A 1Z8LA 1F57A 4UEZA 5LYDA 4X2TA 3KI9A 2Q43A 3KR4A 4MMOA 1ELLP 1PCAA 4PXEA 2C1CA 5LRKA 2EK9A 4P44A 5LRGA 2NSMA 3PB6X 1XJOA 2PJ9A 3PFEA 2CTCA 1YMEA 2V8DA 4FWUA 4C85A 2ABZA 3L2NA 1Z5RA 2V8GA 2ZOGA 5J1QA 6CPAA 4OMEA 3CT9A 3ICUA 5CBMA 4NGRA 4K3NA 2V8VA 1YW4A 3FJUA 3B3TA 2ANPA 3B35A 2PJ0A 2ZOFA 2PVVA 1CP6A 3VATA 1ARMA 1CPSA 3B2YA 3K9TA 1F2OA 3H8FA 2Q4ZA 5DS0A 4ZI6A 3T8WA 3NH5A 3IO1A 4A94A 5IB9A 2JBJA 1ZG7A 1M4LA 5CPAA 5D8NA 2IQ6A 1DE4C 2PJ8A 1UWYA 3V7ZA 3SI0A 2PJ5A 1XFOA 1ZLHA 4OC4A 3S9LA 4O23A 2OR4A 3IC1A 2OOTA 1QMUA 2PJBA 2ZEPA 2Q51A 3I1UA 2HC9A 4TNUA 4P6YA 3KQXA 3HLPA 1NSAA 4ZX8A 1CP7A 4CPAA 4UF4A 4P4FA 2IMOA 4A37A 2CIJA 3B3CA 2DEAA 4IK2A 4YU9A 3RBUA 4EFDA 4F8ZA 4KNGE 4OC1A 2QVPA 1Y9ZA 2JBKA 1F2PA 2GLJA 3VH9A 3VTAA 1R43A 3DLJA 4RUHA 2AFOA 2ZEDA 1BLLE 2RB7A 1LAMA 3PB4X 4P4EA 2GP4A 1DTDA 3IWWA 4NGQA 3SJEA 3MN8A 4ZY2A 1XRYA 2RFHA 3IJ3A 5K8NA 2XEFA 3BI0A 3CDXA 1ELMP 3NH8A 2AFSA 4OC0A 3KASA 4TJXA 4FAIA 2XEGA 2XEIA 2JEWA 4MCRA 1AMPA 2FVGA 1VGYA 5K8PA 3SI1A 3KQZA 3QNVA 2AFZA 4P4DA 4KSIA 4C8PA 1EE3P 4H2KA 3IEHA 4OP4A 5LRJA 2PJCA 2PJ7A 5IR2A 4NFRA 1XMBA 1Y0RA 3WC6A 4C8FA 3KHXA 1HDUA 4NGMA 2GREA 1Y7EA 2ZEFA 4C8UA 2F7VA 4OIWA 1HDQA 4PXCA 3WABA 2AFXA 4B6ZA 1ZG9A 3BHXA 4OC3A 1LAPA 2PCUA 2AFUA 4P45A 3PFOA 2WYRA 3TX8A 4DYOA 3KZWA 2PIYA 2V8HA 3FEDA 4ONWA 3SJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CF4 A;  2QYV A;  1TKH A;  2BCO A;  4PPZ A;  1VHO A;  1YW6 A;  4R8F A;  5HVH A;  4P10 A;  4P4I A;  1TKJ A;  3PB9 X;  4NJQ A;  4P4J A;  3KHZ A;  2PJ3 A;  1Y0Y A;  4ZX9 A;  4DJL A;  4MXU A;  4FUU A;  5D29 A;  4C8T A;  4ZY1 A;  1IY7 A;  4CDJ A;  3LWU A;  4YN3 A;  1TXR A;  2ZEH A;  2ZEE A;  3RAM A;  1YSJ A;  3D7F A;  4C86 A;  3FX6 A;  2PJ4 A;  4C9R A;  3FEE A;  1TKF A;  3I6S A;  3H8G A;  1IGB A;  3VAR A;  5K8M A;  3PRT A;  4OC5 A;  4MHZ A;  4JYW A;  4P4B A;  3PB7 X;  4OID A;  3S9M A;  3GUX A;  1BPM A;  4UIA A;  1CX8 A;  2AFM A;  3JRU A;  5LYI A;  5THW A;  3S9N A;  1QQ9 A;  1Z2L A;  3FVL A;  2PJ2 A;  4NJR A;  1CPX A;  2I3C A;  4IHM A;  4Z65 A;  4C9A A;  4WJB A;  4NGT A;  1GYT A;  5LYF A;  3PBB A;  4FBE A;  4C84 A;  1LAN A;  4X3R A;  8CPA A;  4PXD A;  1BPN A;  3FF3 A;  2F8H A;  2CTB A;  4TWE A;  4NGS A;  1V6C A;  4PQA A;  3FH4 A;  3WT4 A;  3ISZ A;  3D7D A;  3D66 A;  2GU2 A;  1LFW A;  3IIB A;  4LQG A;  2EWB A;  4X8I A;  4R6T A;  3TC8 A;  4ZY0 A;  3FMC A;  3HUV A;  5HVG A;  1XBU A;  3D67 A;  2O53 A;  2C6C A;  4MHY A;  4R76 A;  4A38 A;  3D4U A;  1BAV A;  3FEC A;  2BO9 A;  4OKO A;  2V77 A;  1VHE A;  4IAV A;  4UEE A;  3RZA A;  2ZEG A;  2PIZ A;  5K8O A;  3PEI A;  2VL1 A;  1KWM A;  1WVM A;  3NH4 A;  2ZEO A;  4W9Y A;  1FNO A;  5JM6 A;  2WZN A;  7CPA A;  2XEJ A;  2PVW A;  4MHP A;  3SJG A;  5F09 A;  3V38 A;  1ZLI A;  5JGF A;  2PJ6 A;  4NGN A;  4ZYQ A;  1R3N A;  2O4H A;  3WC5 A;  3PBE A;  4C9U A;  2PJ1 A;  4CDK A;  4C99 A;  5HVF A;  1ARL A;  3CPA A;  5LYL A;  3BI1 A;  1CG2 A;  2PE3 A;  1YLO A;  3N5F A;  4BD9 A;  4JZ0 A;  3B3W A;  2PRQ A;  3GB0 A;  3GLJ A;  2ZEL A;  1ZG8 A;  1OBR A;  4YWY A;  3I74 A;  5I4M A;  4WWV A;  4NGP A;  3LMS A;  4A39 A;  1CBX A;  3B3V A;  3IFE A;  3DGV A;  2BOA A;  4C9E A;  4MCS A;  5HXD A;  4MCP A;  4R7M A;  1Q7L A;  4UIB A;  4F9V A;  2QJ8 A;  1HEE A;  3KR5 A;  3SJX A;  4AXV A;  2G9D A;  4DUK A;  3WC7 A;  3CPX A;  3ISX A;  2HB6 A;  5ELY A;  1JQG A;  3D68 A;  1PYT B;  2PJA A;  3PB8 X;  1LCP A;  2EK8 A;  1VIX A;  4EWT A;  2ZEM A;  4C8A A;  2J9A A;  1RTQ A;  4OC2 A;  4UEF A;  1AYE A;  2POK A;  3NA6 A;  2C6G A;  3KGQ A;  5JH9 A;  4C8C A;  2NYQ A;  4PXB A;  3D7H A;  3D7G A;  3KL9 A;  1XF1 A;  1LOK A;  4EME A;  3SI2 A;  2ZEN A;  4MCQ A;  4Q7A A;  4TJV A;  4MHN A;  3B7I A;  1TF9 A;  4F9U A;  3B3S A;  1H8L A;  1FT7 A;  4C9V A;  2IJZ A;  2GLF A;  3K2K A;  4G1P A;  4MRI A;  3BXM A;  4GM5 A;  2AFW A;  3MRU A;  3H8E A;  3NFZ A;  2C6P A;  3EIF A;  1TF8 A;  1Z8L A;  1F57 A;  4UEZ A;  5LYD A;  4X2T A;  3KI9 A;  2Q43 A;  3KR4 A;  4MMO A;  1ELL P;  1PCA A;  4PXE A;  2C1C A;  5LRK A;  2EK9 A;  4P44 A;  5LRG A;  2NSM A;  3PB6 X;  1XJO A;  2PJ9 A;  3PFE A;  2CTC A;  1YME A;  2V8D A;  4FWU A;  4C85 A;  2ABZ A;  3L2N A;  1Z5R A;  2V8G A;  2ZOG A;  5J1Q A;  6CPA A;  4OME A;  3CT9 A;  3ICU A;  5CBM A;  4NGR A;  4K3N A;  2V8V A;  1YW4 A;  3FJU A;  3B3T A;  2ANP A;  3B35 A;  2PJ0 A;  2ZOF A;  2PVV A;  1CP6 A;  3VAT A;  1ARM A;  1CPS A;  3B2Y A;  3K9T A;  1F2O A;  3H8F A;  2Q4Z A;  5DS0 A;  4ZI6 A;  3T8W A;  3NH5 A;  3IO1 A;  4A94 A;  5IB9 A;  2JBJ A;  1ZG7 A;  1M4L A;  5CPA A;  5D8N A;  2IQ6 A;  1DE4 C;  2PJ8 A;  1UWY A;  3V7Z A;  3SI0 A;  2PJ5 A;  1XFO A;  1ZLH A;  4OC4 A;  3S9L A;  4O23 A;  2OR4 A;  3IC1 A;  2OOT A;  1QMU A;  2PJB A;  2ZEP A;  2Q51 A;  3I1U A;  2HC9 A;  4TNU A;  4P6Y A;  3KQX A;  3HLP A;  1NSA A;  4ZX8 A;  1CP7 A;  4CPA A;  4UF4 A;  4P4F A;  2IMO A;  4A37 A;  2CIJ A;  3B3C A;  2DEA A;  4IK2 A;  4YU9 A;  3RBU A;  4EFD A;  4F8Z A;  4KNG E;  4OC1 A;  2QVP A;  1Y9Z A;  2JBK A;  1F2P A;  2GLJ A;  3VH9 A;  3VTA A;  1R43 A;  3DLJ A;  4RUH A;  2AFO A;  2ZED A;  1BLL E;  2RB7 A;  1LAM A;  3PB4 X;  4P4E A;  1DTD A;  3IWW A;  4NGQ A;  3SJE A;  3MN8 A;  4ZY2 A;  1XRY A;  2RFH A;  3IJ3 A;  5K8N A;  2XEF A;  3BI0 A;  3CDX A;  1ELM P;  3NH8 A;  2AFS A;  4OC0 A;  3KAS A;  4TJX A;  4FAI A;  2XEG A;  2XEI A;  2JEW A;  4MCR A;  1AMP A;  2FVG A;  1VGY A;  5K8P A;  3SI1 A;  3KQZ A;  3QNV A;  2AFZ A;  4P4D A;  4KSI A;  4C8P A;  1EE3 P;  4H2K A;  3IEH A;  4OP4 A;  5LRJ A;  2PJC A;  2PJ7 A;  4NFR A;  1XMB A;  1Y0R A;  3WC6 A;  4C8F A;  3KHX A;  1HDU A;  4NGM A;  2GRE A;  1Y7E A;  2ZEF A;  4C8U A;  2F7V A;  4OIW A;  1HDQ A;  4PXC A;  3WAB A;  2AFX A;  4B6Z A;  1ZG9 A;  3BHX A;  4OC3 A;  1LAP A;  2PCU A;  2AFU A;  4P45 A;  3PFO A;  2WYR A;  3TX8 A;  4DYO A;  3KZW A;  2PIY A;  2V8H A;  3FED A;  4ONW A;  3SJF A; 
#chains in the Genus database with same CATH topology
 2CF4 A;  2QYV A;  1TKH A;  4ZBG A;  2BCO A;  2EZB A;  4PPZ A;  1VHO A;  3G23 A;  1YW6 A;  2ZPA A;  2AUM A;  4R8F A;  4R9M A;  5HVH A;  3TLG B;  4P10 A;  1K4J A;  4P4I A;  3BUW B;  3TOB A;  1TKJ A;  3TCV A;  1M1D A;  3GYA A;  3PB9 X;  1SQH A;  4RI1 A;  4F6A A;  1XIX A;  1RXT A;  2AE6 A;  4NJQ A;  4P4J A;  3E0K A;  3KHZ A;  3U1B A;  2PJ3 A;  1Y0Y A;  2X7B A;  4ZX9 A;  4DJL A;  3GY9 A;  3GJZ A;  3FNC A;  4MXU A;  5ISV A;  3IWE A;  4FUU A;  2CNT A;  2OZG A;  4A31 A;  5D29 A;  4C8T A;  4ZY1 A;  1IY7 A;  4QUS A;  2WPX A;  4MHD A;  1XF8 A;  4CYN A;  2HWG A;  3LWU A;  4YN3 A;  1TXR A;  2ZEH A;  1R57 A;  4CDJ A;  1QSO A;  1P0H A;  1ZO0 A;  2ZEE A;  3RAM A;  1YSJ A;  4C7H A;  3D7F A;  2B0A A;  4CGP A;  4C86 A;  3FX6 A;  3ZZI A;  2PJ4 A;  3R9G A;  4KVM E;  1XE4 A;  2Q0Y A;  4C9R A;  3T9Y A;  3I3G A;  5H84 A;  3FEE A;  1TKF A;  3BLN A;  3I6S A;  1YRE A;  2PR8 A;  1I21 A;  1IGB A;  3H8G A;  2BUE A;  3VAR A;  5K8M A;  4BTF A;  3PRT A;  4OC5 A;  4MHZ A;  1NXJ A;  4JYW A;  4P4B A;  2PDO A;  2B3V A;  3PB7 X;  3RNZ A;  3PGP A;  4OID A;  2EVN A;  3S9M A;  3GUX A;  2JDD A;  1BPM A;  4LQ6 A;  3T0T A;  5AXI A;  3F0A A;  4UIA A;  1CE8 B;  1CX8 A;  2AFM A;  3R96 A;  4H6U A;  3JRU A;  2C5Q A;  3GKR A;  5LYI A;  3F8K A;  1FY7 A;  2ATR A;  2B5G A;  4XNH C;  3TLY A;  2OZH A;  5AG7 A;  5THW A;  3S9N A;  1QQ9 A;  1Z2L A;  3FVL A;  2PJ2 A;  1IU8 A;  1CPX A;  2I3C A;  3PP9 A;  4IHM A;  4J3G A;  4KVO E;  4NJR A;  3UY5 A;  5HMN A;  3TYX A;  1C3O B;  4CZ1 A;  4KZT A;  4Q38 A;  4A30 A;  4UFV A;  2OH1 A;  1VHS A;  2FE7 A;  3A9L A;  4WJB A;  4NGT A;  1GYT A;  5LYF A;  3T07 A;  2FL4 A;  1S3Z A;  3T90 A;  3PBB A;  2D0P A;  1J4J A;  5DWM A;  4FBE A;  4ZGY B;  2MP0 A;  2YJV A;  2ODF A;  3JTK A;  3OAK A;  4C84 A;  1LAN A;  3TOA A;  4X3R A;  2EO8 A;  8CPA A;  3FRM A;  3D2M A;  4PXD A;  1BPN A;  4OAE A;  3FF3 A;  4MY3 A;  2F8H A;  2CTB A;  4TWE A;  4NGS A;  3TTH A;  1V6C A;  2OB0 A;  4PQA A;  5K99 A;  1MJA A;  3FBU A;  3FH4 A;  3WT4 A;  3ISZ A;  3TLE A;  3D7D A;  2GU2 A;  3D66 A;  1IOI A;  1LFW A;  1Q2Y A;  3IIB A;  4GS4 A;  5DWN A;  4CRZ B;  4GPL B;  2Q44 A;  4LQG A;  4PK2 A;  2EWB A;  3EC4 A;  3GIU A;  1ZYM A;  4X8I A;  3F5B A;  4R6T A;  3TC8 A;  4ZY0 A;  1IYL A;  1IB1 E;  2D4P A;  1IID A;  4FD7 A;  3ZNI A;  3HPG G;  4KOY A;  3FMC A;  1RO5 A;  3HUV A;  3KKW A;  3QB8 A;  4JXR A;  5HVG A;  1XBU A;  3D67 A;  2O53 A;  2C6C A;  4MHY A;  2EUI A;  4R76 A;  2Q04 A;  4E8O A;  1Z9U A;  1Y9W A;  4U5Y A;  4A38 A;  2ZW7 A;  2VZY A;  3D4U A;  4A32 A;  1YLE A;  1BAV A;  3FEC A;  4CAF A;  2BO9 A;  3CXP A;  4MFQ A;  2V77 A;  1VHE A;  2D4O A;  4OKO A;  4U9Z A;  5G21 A;  2FM4 A;  4IAV A;  1BOB A;  5HKW A;  1QST A;  4UEE A;  3V8I A;  3RZA A;  3I74 A;  2ZEG A;  4Z65 A;  2PIZ A;  5K8O A;  3IGR A;  3TO9 A;  5KTA A;  1S7N A;  3PEI A;  4MY0 A;  2BSW A;  2VL1 A;  1Y9K A;  3S6G A;  2E28 A;  3VGO A;  2Z3O A;  4QBJ A;  4KUA A;  1KWM A;  1WVM A;  3NH4 A;  2ZEO A;  2ZW5 A;  4W9Y A;  1FNO A;  5JM6 A;  2WZN A;  3TE4 A;  4BMH A;  7CPA A;  1NBW A;  3H5Z A;  2XEJ A;  3R1K A;  2PVW A;  3VRR A;  4MHP A;  3BUN B;  3SJG A;  5F09 A;  2YND A;  1ZLI A;  3V38 A;  5JGF A;  1T36 B;  2PJ6 A;  2P0W A;  1EZA A;  2DIK A;  2P6F A;  4NGN A;  4A4C A;  4AB7 A;  2ZW6 A;  4ZYQ A;  1R3N A;  2O4H A;  2FXF A;  3WC5 A;  4UA3 A;  5BWA B;  3PBE A;  5J8F A;  1L0C A;  2Z3M A;  5IB0 A;  4C9U A;  4A2Z A;  4PV6 A;  4XPD C;  2YGW A;  4C68 A;  5AG4 A;  3T05 A;  2PJ1 A;  4CDK A;  3VRO A;  1IYK A;  1CM0 A;  3VWE A;  3DNS A;  1C30 B;  1YQE A;  5HVF A;  4C99 A;  1ARL A;  3CPA A;  5LYL A;  3BI1 A;  3HMJ G;  1B87 A;  1CG2 A;  2PE3 A;  3P2F A;  4CYP A;  1YLO A;  4HNY B;  3LAC A;  3N5F A;  4BD9 A;  2H5M A;  3EZE A;  4M6G A;  5F47 A;  4JZ0 A;  3B3W A;  3EZA A;  3H4Q A;  3VWD A;  2PRQ A;  3GB0 A;  3ZJ0 A;  4F0X A;  3PLF B;  2OZU A;  3GLJ A;  2ZEL A;  1ZG8 A;  4LUA A;  5FVJ A;  4DNC A;  1OBR A;  1YVH A;  2ZXV A;  5G1Z A;  4FD6 A;  4YWY A;  3SHP A;  1XMT A;  4NGP A;  3LMS A;  4WWV A;  4A39 A;  4CGL A;  2Z3P A;  1CS0 B;  2CNM A;  1CBX A;  3CXS A;  3B3V A;  4UWJ A;  5H86 A;  3IFE A;  3DGV A;  3RYO A;  4KS9 A;  1M4G A;  5I4M A;  2B5G B;  2C27 A;  2BOA A;  2QEC A;  1IIC A;  2YJT A;  4MFZ A;  2DLA A;  3BUM B;  4C9E A;  4MCS A;  5HXD A;  4MCP A;  4R7M A;  2IL4 A;  4CO9 A;  1Q7L A;  1S5K A;  4I49 A;  4UIB A;  4F9V A;  2QJ8 A;  1HEE A;  2DPT A;  1A9X B;  4C7I A;  2BEI A;  5JQ4 A;  4KOV A;  3K4I A;  3FB3 A;  4A95 A;  3KR5 A;  3SJX A;  2HUZ A;  4AXV A;  3BUX B;  4CAV A;  4UFX A;  2G9D A;  4DUK A;  4KOU A;  1J3L A;  2Z10 A;  1GGO A;  3WC7 A;  1M6V B;  3CPX A;  4IUS A;  4COG A;  3U88 C;  2OU2 A;  1KZF A;  3ISX A;  2HB6 A;  3MGD A;  1VKC A;  1KUY A;  5ELY A;  3BJ8 A;  1JQG A;  4L89 A;  3SXO A;  3D68 A;  1PYT B;  2GE3 A;  4HNX B;  4R3L A;  2PJA A;  2VQY A;  4CRY B;  1Y7R A;  3PB8 X;  2VZZ A;  1Z8W A;  1LCP A;  2HV2 A;  2EK8 A;  1VIX A;  3C26 A;  4A33 A;  4EWT A;  4U9Y A;  4INJ A;  3VRP A;  2ZEM A;  4HNW B;  4QVT A;  4C8A A;  2J9A A;  1QSR A;  1RTQ A;  4J0N A;  4F0Y A;  4OC2 A;  2K5T A;  1YK3 A;  4XPD B;  3QAH A;  4KLV A;  4OAD A;  3FIX A;  1PUA A;  2B4J C;  1Z9E A;  5J3X A;  3PZJ A;  4UEF A;  1AYE A;  3W6X A;  4E5S A;  3S6H A;  4CYO A;  2POK A;  3NA6 A;  3IU1 A;  2P6E A;  2C6G A;  3TFY A;  2Q7S A;  1VI4 A;  3KGQ A;  2XPL A;  5JH9 A;  1VBG A;  4C8C A;  4MI1 A;  2NYQ A;  4KLW A;  3G3S A;  3BUO B;  4PXB A;  3D7H A;  1KBL A;  3D7G A;  5KTC A;  2CY2 A;  1WWZ A;  4JWP A;  5EMI A;  3IWG A;  3OWC A;  1EO0 A;  1B6B A;  2B4D A;  3KL9 A;  4BIN A;  2R98 A;  2I79 A;  1XF1 A;  3D3S A;  1LOK A;  4LX9 A;  4H1H A;  4RR2 B;  2Z11 A;  4EME A;  3SI2 A;  1M44 A;  2N3A B;  1YVO A;  2ZEN A;  4M6H A;  5F49 A;  4X5K A;  2VBQ A;  4MCQ A;  2VEZ A;  2PR1 A;  4B5O A;  4Q7A A;  5AG5 A;  4TJV A;  4MHN A;  3B7I A;  5F46 A;  3OB1 B;  1TF9 A;  3DDD A;  1KC7 A;  2REE A;  1Z8T A;  4NCZ A;  4F9U A;  3B3S A;  4BPX B;  1H8L A;  5JYB A;  1FT7 A;  2YNE A;  5JPH A;  2XPN A;  3OB2 B;  1Z4E A;  2R1I A;  4C9V A;  2G3A A;  2IJZ A;  3P2H A;  2GLF A;  3EO4 A;  4PK3 A;  3K9U A;  1Q5X A;  2EZA A;  3K2K A;  4G1P A;  3SR3 A;  3RO0 A;  3NE7 A;  1KEE B;  2REF A;  4MRI A;  3BXM A;  2Z3K A;  4GM5 A;  3NOJ A;  2HRO A;  2AFW A;  3MRU A;  2B58 A;  2OLS A;  3O8Z A;  1Q2C A;  2YNC C;  3H8E A;  5EBV A;  3R9F A;  3NFZ A;  3F9K C;  2C6P A;  3N7Z A;  2DF5 A;  2RC4 A;  4AG7 A;  5BY0 A;  3B8G A;  4QB9 A;  4XNH B;  2QML A;  1ZL0 A;  3EIF A;  2UV8 G;  1KUV A;  1Z8L A;  1TF8 A;  1F57 A;  4UEZ A;  5LYD A;  4X2T A;  3KI9 A;  2Q43 A;  2Z3N A;  3KR4 A;  1MJ9 A;  2HQY A;  1ELL P;  4MMO A;  2B4B A;  1PCA A;  4RS2 A;  5HKY A;  2CNS A;  4CAW A;  1BXR B;  1NMT A;  4PXE A;  5F9M A;  2C1C A;  1JWQ A;  3D8P A;  2EK9 A;  5LRK A;  4MJX A;  4P44 A;  5LRG A;  2NSM A;  1FBV A;  3PB6 X;  2WUU A;  3DSB A;  1XJO A;  2KCW A;  3VRQ A;  2WSA A;  2PJ9 A;  3FYN A;  2PC1 A;  4M85 A;  1P4N A;  2AJ6 A;  3PFE A;  4GXH A;  4H6Z A;  1IOF A;  4UWI A;  3TLB A;  2VI7 A;  2CTC A;  4FD4 A;  1XOV A;  1YME A;  4COB A;  2F5I A;  4KOS A;  4JXQ A;  2V8D A;  4FWU A;  1YX0 A;  2Z3L A;  4B11 A;  2ABZ A;  2GFQ A;  1Z5R A;  2V8G A;  3L2N A;  2FIA A;  4UCM A;  3TO7 A;  4B5P A;  4MFP A;  2Y0M A;  2ZOG A;  5J1Q A;  3JUW A;  4JD6 A;  2PCN A;  1M4D A;  6CPA A;  4OME A;  3CT9 A;  5F13 A;  3ICU A;  5CBM A;  5A28 A;  4NGR A;  2Q4Y A;  2DXQ A;  4K3N A;  3SXN A;  2V8V A;  4B14 A;  4CS0 B;  1YW4 A;  4Y49 C;  3FJU A;  1LRZ A;  3B3T A;  2ANP A;  3B35 A;  4II9 A;  2PJ0 A;  2VKZ G;  2ZOF A;  4BPU B;  2O28 A;  2PVV A;  1CP6 A;  3LD2 A;  3NE8 A;  1ARM A;  2FIW A;  2ZW4 A;  1CPS A;  3B2Y A;  3K9T A;  4YGO A;  4NXY A;  5HH1 A;  1F2O A;  3H8F A;  1X12 A;  2HI6 A;  5CNP A;  3FXT A;  4MFJ A;  5F1Y A;  5I0C A;  2Q4Z A;  4NSQ A;  4CAE A;  5DS0 A;  2B3U A;  4ZI6 A;  3T8W A;  3NH5 A;  1I1D A;  3IO1 A;  4A94 A;  5IB9 A;  2JBJ A;  1KUX A;  1ZG7 A;  4MFK A;  4ONU A;  4MJ8 A;  4Q36 A;  4UCP A;  1M4L A;  4E0A A;  5CPA A;  3W91 A;  4KOR A;  5GCN A;  5D8N A;  1NSL A;  4JVO A;  2J8M A;  3PT1 A;  2IQ6 A;  1DE4 C;  2PJ8 A;  3R95 A;  2WPW A;  5J8C A;  4L8A A;  1OZP A;  4KOT A;  2GAN A;  4KUB A;  1XEB A;  4UCN A;  3T5M A;  1UFH A;  2PQ8 A;  5F48 A;  4EYS A;  1UWY A;  1ON0 A;  3V7Z A;  4NEX A;  2XPP A;  3SI0 A;  4CGN A;  4HKF A;  4CGO A;  2NMT A;  2PJ5 A;  3OP0 A;  1XFO A;  1ZLH A;  4OC4 A;  3S9L A;  4FD5 A;  4H89 A;  1S7F A;  4O23 A;  2OR4 A;  4CAX A;  4AG9 A;  5FD8 A;  2GIV A;  3IC1 A;  3HPH E;  2OOT A;  1QMU A;  2PJB A;  2ZEP A;  2Q51 A;  3I1U A;  3NFQ A;  2FCK A;  2ARH A;  4AVA A;  1JDB C;  2HC9 A;  2B4D B;  4AVC A;  4TNU A;  1MK4 A;  4MBU A;  2P6G A;  3TLG A;  4P6Y A;  3KQX A;  3HLP A;  3C8O A;  4IIX A;  4C2Z A;  1NSA A;  4ZX8 A;  5AGE A;  4CYQ A;  1CP7 A;  4CPA A;  3KRV A;  4C85 A;  4UF4 A;  4P4F A;  1CJW A;  1DIK A;  2IMO A;  3DR8 A;  1U6M A;  2CIJ A;  2BL1 A;  4IF5 A;  3S6F A;  4A37 A;  1S7K A;  2JEV A;  2Z0Z A;  3G8W A;  3TO6 A;  1R61 A;  1X10 A;  2YNC A;  3B3C A;  3LOD A;  4HPS A;  4E2A A;  5A27 A;  2DEA A;  3EXN A;  4IK2 A;  3RBU A;  4YU9 A;  4EFD A;  4F8Z A;  4PSW A;  2A4N A;  4UBR A;  4KNG E;  4OC1 A;  3CXQ A;  2QVP A;  1Y9Z A;  2JBK A;  1F2P A;  2GLJ A;  3VH9 A;  3VTA A;  5JVL A;  3R9E A;  1R43 A;  3DLJ A;  1Z8X A;  4RUH A;  2AFO A;  4A4B A;  1B47 A;  2ZED A;  4M6I A;  4BBH A;  4Y49 B;  1BLL E;  2RB7 A;  4MFL A;  1I12 A;  1LAM A;  3PB4 X;  4P4E A;  4XPL A;  2GP4 A;  1WK4 A;  1DTD A;  1VBH A;  3IWW A;  4B13 A;  3TLC A;  4NGQ A;  3SJE A;  1MJB A;  4JLY A;  5HKZ A;  1S60 A;  3MN8 A;  2JDC A;  4ZY2 A;  1M4I A;  4QC6 A;  1AUG A;  3W6S A;  3VAT A;  2JLM A;  1XRY A;  2RFH A;  1YVK A;  3IJ3 A;  5K8N A;  2EZC A;  2R82 A;  2XEF A;  2FT0 A;  3CZX A;  3EY5 A;  5G20 A;  1ZRS A;  4M8D A;  4R57 A;  2AUN A;  2QIR A;  4KVX A;  3BI0 A;  1PU9 A;  1Q2D A;  4BPW B;  3CDX A;  3VRN A;  1ELM P;  3EFA A;  3NH8 A;  1S7L A;  2AFS A;  2XPO A;  4UFW A;  3KAS A;  4OC0 A;  1TIQ A;  4M3S A;  4FAI A;  4MI4 A;  4TJX A;  3TLA A;  1BO4 A;  4YFJ A;  2XEG A;  2XEI A;  5KTD A;  4EVY A;  1QSN A;  2JEW A;  4MCR A;  1N71 A;  3TT2 A;  4CGM A;  1EZB A;  5C88 A;  1AMP A;  2FVG A;  1VGY A;  4KOW A;  1YR0 A;  5EC4 A;  3SI1 A;  4XPK A;  4B5P B;  5K8P A;  3KQZ A;  3QNV A;  2AFZ A;  4P4D A;  2CBL A;  4KSI A;  4C9A A;  4PSX A;  3TLZ A;  4KSA A;  5C82 A;  4C8P A;  4C2X A;  1GHE A;  1EE3 P;  4H2K A;  5AG6 A;  3S6K A;  2R8V A;  3PFV A;  2FS5 A;  3IEH A;  4OP4 A;  2Q7B A;  4YRH A;  5LRJ A;  2FSR A;  2PJ7 A;  2PJC A;  2PRB A;  4C2Y A;  5IR2 A;  4NFR A;  1XMB A;  1YGH A;  1Y0R A;  4R3K A;  1V0C A;  2DPS A;  3WC6 A;  4C8F A;  1NE9 A;  3D2P A;  4RN7 A;  5G22 A;  4JJX A;  1HDU A;  4NGM A;  2GRE A;  1Y7E A;  2ZEF A;  3KHX A;  2D0O A;  4B12 A;  3EZB A;  2F7V A;  4OIW A;  4C8U A;  1HDQ A;  2G0B A;  2CXA A;  1QSM A;  2G3T A;  2I00 A;  4PXC A;  2Q4V A;  1WJT A;  4KSF A;  3WAB A;  2AFX A;  5IV0 A;  2Y1N A;  2R7H A;  2VXK A;  2Y1M A;  1ZG9 A;  2J8R A;  3BJ7 A;  4B6Z A;  3BHX A;  4OC3 A;  1LAP A;  2PCU A;  2PSW A;  2AFU A;  3WR7 A;  4P45 A;  4ORF A;  3PFO A;  2WYR A;  3I9S A;  3TX8 A;  4R87 A;  4DYO A;  3KZW A;  4E94 A;  3DR6 A;  4KOX A;  5F5X A;  2EBJ A;  3IU2 A;  5E96 A;  1JDE A;  2PIY A;  4OLL A;  5IX3 A;  2V8H A;  3FED A;  3QAY A;  4ONW A;  4AVB A;  3JVN A;  4IIY A;  1A2Z A;  1Z4R A;  4B10 A;  4K30 A;  4NF1 A;  2X0S A;  2J8N A;  3SJF A; 
#chains in the Genus database with same CATH homology
 2CF4 A;  2QYV A;  1TKH A;  2BCO A;  4PPZ A;  1VHO A;  1YW6 A;  4R8F A;  5HVH A;  4P10 A;  4P4I A;  1TKJ A;  3PB9 X;  4NJQ A;  4P4J A;  3KHZ A;  2PJ3 A;  1Y0Y A;  4ZX9 A;  4DJL A;  4MXU A;  4FUU A;  5D29 A;  4C8T A;  4ZY1 A;  1IY7 A;  4CDJ A;  3LWU A;  4YN3 A;  1TXR A;  2ZEH A;  2ZEE A;  3RAM A;  1YSJ A;  3D7F A;  4C86 A;  3FX6 A;  2PJ4 A;  4C9R A;  3FEE A;  1TKF A;  3I6S A;  3H8G A;  1IGB A;  3VAR A;  5K8M A;  3PRT A;  4OC5 A;  4MHZ A;  4JYW A;  4P4B A;  3PB7 X;  4OID A;  3S9M A;  3GUX A;  1BPM A;  4UIA A;  1CX8 A;  2AFM A;  3JRU A;  2C5Q A;  5LYI A;  5THW A;  3S9N A;  1QQ9 A;  1Z2L A;  3FVL A;  2PJ2 A;  4NJR A;  1CPX A;  2I3C A;  4IHM A;  4Z65 A;  4C9A A;  4WJB A;  4NGT A;  1GYT A;  5LYF A;  3PBB A;  4FBE A;  4C84 A;  1LAN A;  4X3R A;  8CPA A;  4PXD A;  1BPN A;  3FF3 A;  2F8H A;  2CTB A;  4TWE A;  4NGS A;  1V6C A;  4PQA A;  3FH4 A;  3WT4 A;  3ISZ A;  3D7D A;  3D66 A;  2GU2 A;  1LFW A;  3IIB A;  4LQG A;  2EWB A;  4X8I A;  4R6T A;  3TC8 A;  4ZY0 A;  3FMC A;  3HUV A;  5HVG A;  1XBU A;  3D67 A;  2O53 A;  2C6C A;  4MHY A;  4R76 A;  4A38 A;  3D4U A;  1BAV A;  3FEC A;  2BO9 A;  4OKO A;  2V77 A;  1VHE A;  4IAV A;  4UEE A;  3RZA A;  2ZEG A;  2PIZ A;  5K8O A;  3PEI A;  2VL1 A;  1KWM A;  1WVM A;  3NH4 A;  2ZEO A;  4W9Y A;  1FNO A;  5JM6 A;  2WZN A;  7CPA A;  2XEJ A;  2PVW A;  4MHP A;  3SJG A;  5F09 A;  3V38 A;  1ZLI A;  5JGF A;  2PJ6 A;  4NGN A;  4ZYQ A;  1R3N A;  2O4H A;  3WC5 A;  3PBE A;  4C9U A;  2PJ1 A;  4CDK A;  4C99 A;  5HVF A;  1ARL A;  3CPA A;  5LYL A;  3BI1 A;  1CG2 A;  2PE3 A;  1YLO A;  3N5F A;  4BD9 A;  4JZ0 A;  3B3W A;  2PRQ A;  3GB0 A;  3GLJ A;  2ZEL A;  1ZG8 A;  1OBR A;  4YWY A;  3I74 A;  5I4M A;  4WWV A;  4NGP A;  3LMS A;  4A39 A;  1CBX A;  3B3V A;  3IFE A;  3DGV A;  2BOA A;  4C9E A;  4MCS A;  5HXD A;  4MCP A;  4R7M A;  1Q7L A;  4UIB A;  4F9V A;  2QJ8 A;  1HEE A;  3KR5 A;  3SJX A;  4AXV A;  2G9D A;  4DUK A;  3WC7 A;  3CPX A;  3ISX A;  2HB6 A;  5ELY A;  1JQG A;  3D68 A;  1PYT B;  2PJA A;  3PB8 X;  1LCP A;  2EK8 A;  1VIX A;  4EWT A;  2ZEM A;  4C8A A;  2J9A A;  1RTQ A;  4OC2 A;  4UEF A;  1AYE A;  2POK A;  3NA6 A;  2C6G A;  3KGQ A;  5JH9 A;  4C8C A;  2NYQ A;  4PXB A;  3D7H A;  3D7G A;  3KL9 A;  1XF1 A;  1LOK A;  4EME A;  3SI2 A;  2ZEN A;  4MCQ A;  4Q7A A;  4TJV A;  4MHN A;  3B7I A;  1TF9 A;  4F9U A;  3B3S A;  1H8L A;  1FT7 A;  4C9V A;  2IJZ A;  2GLF A;  3K2K A;  4G1P A;  4MRI A;  3BXM A;  4GM5 A;  2AFW A;  3MRU A;  3H8E A;  3NFZ A;  2C6P A;  3EIF A;  1TF8 A;  1Z8L A;  1F57 A;  4UEZ A;  5LYD A;  4X2T A;  3KI9 A;  2Q43 A;  3KR4 A;  4MMO A;  1ELL P;  1PCA A;  4PXE A;  2C1C A;  5LRK A;  2EK9 A;  4P44 A;  5LRG A;  2NSM A;  3PB6 X;  1XJO A;  2PJ9 A;  3PFE A;  2CTC A;  1YME A;  2V8D A;  4FWU A;  4C85 A;  2ABZ A;  3L2N A;  1Z5R A;  2V8G A;  2ZOG A;  5J1Q A;  6CPA A;  4OME A;  3CT9 A;  3ICU A;  5CBM A;  4NGR A;  4K3N A;  2V8V A;  1YW4 A;  3FJU A;  3B3T A;  2ANP A;  3B35 A;  2PJ0 A;  2ZOF A;  2PVV A;  1CP6 A;  3VAT A;  1ARM A;  1CPS A;  3B2Y A;  3K9T A;  1F2O A;  3H8F A;  2Q4Z A;  5DS0 A;  4ZI6 A;  3T8W A;  3NH5 A;  3IO1 A;  4A94 A;  5IB9 A;  2JBJ A;  1ZG7 A;  1M4L A;  5CPA A;  5D8N A;  2IQ6 A;  1DE4 C;  2PJ8 A;  1UWY A;  3V7Z A;  3SI0 A;  2PJ5 A;  1XFO A;  1ZLH A;  4OC4 A;  3S9L A;  4O23 A;  2OR4 A;  3IC1 A;  2OOT A;  1QMU A;  2PJB A;  2ZEP A;  2Q51 A;  3I1U A;  2HC9 A;  4TNU A;  4P6Y A;  3KQX A;  3HLP A;  1NSA A;  4ZX8 A;  1CP7 A;  4CPA A;  4UF4 A;  4P4F A;  2IMO A;  4A37 A;  2CIJ A;  3B3C A;  2DEA A;  4IK2 A;  4YU9 A;  3RBU A;  4EFD A;  4F8Z A;  4KNG E;  4OC1 A;  2QVP A;  1Y9Z A;  2JBK A;  1F2P A;  2GLJ A;  3VH9 A;  3VTA A;  1R43 A;  3DLJ A;  4RUH A;  2AFO A;  2ZED A;  1BLL E;  2RB7 A;  1LAM A;  3PB4 X;  4P4E A;  2GP4 A;  1DTD A;  3IWW A;  4NGQ A;  3SJE A;  3MN8 A;  4ZY2 A;  1XRY A;  2RFH A;  3IJ3 A;  5K8N A;  2XEF A;  3BI0 A;  3CDX A;  1ELM P;  3NH8 A;  2AFS A;  4OC0 A;  3KAS A;  4TJX A;  4FAI A;  2XEG A;  2XEI A;  2JEW A;  4MCR A;  1AMP A;  2FVG A;  1VGY A;  5K8P A;  3SI1 A;  3KQZ A;  3QNV A;  2AFZ A;  4P4D A;  4KSI A;  4C8P A;  1EE3 P;  4H2K A;  3IEH A;  4OP4 A;  5LRJ A;  2PJC A;  2PJ7 A;  5IR2 A;  4NFR A;  1XMB A;  1Y0R A;  3WC6 A;  4C8F A;  3KHX A;  1HDU A;  4NGM A;  2GRE A;  1Y7E A;  2ZEF A;  4C8U A;  2F7V A;  4OIW A;  1HDQ A;  4PXC A;  3WAB A;  2AFX A;  4B6Z A;  1ZG9 A;  3BHX A;  4OC3 A;  1LAP A;  2PCU A;  2AFU A;  4P45 A;  3PFO A;  2WYR A;  3TX8 A;  4DYO A;  3KZW A;  2PIY A;  2V8H A;  3FED A;  4ONW A;  3SJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...