3SJGA

Human glutamate carboxypeptidase ii (e424a inactive mutant ) in complex with n-acetyl-aspartyl-aminooctanoic acid
Total Genus 269
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
269
sequence length
696
structure length
696
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Novel Substrate-Based Inhibitors of Human Glutamate Carboxypeptidase II with Enhanced Lipophilicity.
pubmed doi rcsb
total genus 269
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3sjgA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3sjgA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3sjgA02
1ARMA 3IC1A 7CPAA 5K8PA 2PJ8A 2QJ8A 2RFHA 3FEDA 3H8GA 5D8NA 1ZLHA 5K8OA 3H8FA 3D7HA 5LYIA 2HC9A 2V8HA 3CT9A 2PJ0A 3ISXA 4X3RA 2PIZA 1ELLP 4OMEA 4MHZA 5JGFA 3CPXA 1QMUA 2V77A 3IO1A 1CG2A 2ZEMA 2CTCA 4PXDA 3BXMA 4NFRA 3DLJA 3KZWA 2VL1A 3IJ3A 2XEJA 2PJCA 2JBKA 1VIXA 4WWVA 5JM6A 3PBEA 1Y0RA 3PBBA 3BHXA 3S9NA 2WYRA 1VGYA 4NJRA 1ZG8A 2GU2A 2V8DA 3VH9A 1XMBA 3BI1A 1AMPA 3K9TA 4KSIA 4PXEA 3SJGA 2Q4ZA 2OOTA 3KL9A 5JH9A 1TKHA 2ZEOA 2Q43A 1LFWA 3KI9A 3SJXA 2ZEGA 3PEIA 4KNGE 3WC5A 3K2KA 4C8PA 3PB6X 2ZEDA 3D68A 4R8FA 3D7GA 1ZG7A 3FECA 2C1CA 2ZENA 3KQZA 3NH5A 4FUUA 3NA6A 2EK9A 3VARA 1VHOA 3IEHA 3WABA 2JEWA 3B3TA 4C8TA 2V8VA 2CTBA 4PPZA 2PJAA 2PJ7A 2EK8A 3VATA 3KHXA 4NJQA 4OIWA 2XEFA 4FAIA 2ZEEA 4NGQA 3PB8X 4OC0A 1YLOA 3B3SA 3D66A 3B35A 2AFSA 2XEGA 1HDUA 2BCOA 4P4JA 1GYTA 4Q7AA 4MHYA 4A38A 1F2OA 3DGVA 1YMEA 2FVGA 4GM5A 2PJ6A 1CBXA 3IIBA 4FWUA 1ZLIA 4OIDA 3BI0A 4R6TA 1Y9ZA 3KR4A 4TJVA 4ZY2A 2PVVA 2POKA 2I3CA 2PJ2A 1BAVA 2PJBA 2IJZA 1LANA 2ZEHA 3B2YA 2NYQA 2PJ4A 3S9LA 3JRUA 3WC7A 4MCQA 1DTDA 4C9EA 5IB9A 4C84A 4UEEA 3EIFA 3RZAA 4NGPA 1IY7A 2C6PA 3ISZA 4YN3A 3SI0A 2PRQA 2BO9A 3N5FA 4P10A 4UF4A 2PJ9A 1DE4C 4EWTA 4AXVA 1IGBA 4P6YA 1EE3P 1KWMA 4JZ0A 4OC4A 5CBMA 4C99A 1CPXA 1FT7A 2BOAA 1Y7EA 2ZOGA 1BPMA 5HVHA 3GUXA 4TNUA 1TF9A 3NFZA 4C9UA 4R76A 3I1UA 1OBRA 2ABZA 1YW6A 4UIAA 4C9VA 4OC1A 3PB9X 2ZOFA 2C6CA 4IAVA 1HDQA 4EMEA 4PXBA 4G1PA 3LMSA 5LYDA 3FVLA 4MMOA 4P45A 2XEIA 4ZY1A 1TXRA 4IHMA 3QNVA 4F8ZA 4NGNA 4C8FA 5D29A 4NGRA 1ELMP 3FF3A 3VTAA 1CP6A 4MHPA 2ZEPA 3D4UA 4H2KA 5LYFA 3B3WA 4ZX8A 2IQ6A 2AFOA 4NGTA 2CIJA 4ZYQA 2AFXA 2AFZA 1TKJA 3RBUA 1ARLA 4ONWA 4W9YA 1Z2LA 1R3NA 1XJOA 1VHEA 4X2TA 2PJ3A 3HLPA 4IK2A 4P44A 5DS0A 2Q51A 2DEAA 2PVWA 1Z8LA 1BPNA 1ZG9A 3KR5A 3IFEA 4MCSA 4WJBA 5HVGA 3KGQA 4Z65A 2F8HA 1RTQA 4C9AA 2PIYA 5CPAA 4O23A 1JQGA 3PFEA 1XRYA 1F57A 3I74A 3SI2A 3D67A 5HVFA 2RB7A 5THWA 3WT4A 4C8UA 4MCRA 2GREA 3KHZA 1M4LA 1CP7A 1H8LA 4UEFA 2QYVA 1Y0YA 3CPAA 4K3NA 2O4HA 3MN8A 4YU9A 3D7DA 3TC8A 3B3CA 2C6GA 3RAMA 4P4IA 4MCPA 2ANPA 4P4BA 3GLJA 3FEEA 5LRGA 3T8WA 1TKFA 3IWWA 5ELYA 4C85A 5HXDA 6CPAA 3FH4A 2EWBA 3KASA 4ZI6A 1LCPA 1PYTB 2ZELA 4B6ZA 2J9AA 3L2NA 2G9DA 4MRIA 2PCUA 2O53A 5K8NA 8CPAA 1F2PA 3NH8A 4A94A 3NH4A 5F09A 1XFOA 4TJXA 2HB6A 2CF4A 5LRKA 4DJLA 1YW4A 1WVMA 3KQXA 3SJFA 4NGSA 1PCAA 4PQAA 1HEEA 4R7MA 4LQGA 2PJ1A 4ZY0A 3SJEA 3FX6A 4OP4A 4FBEA 4C8CA 3MRUA 3PB4X 2ZEFA 1QQ9A 3CDXA 4CPAA 5LYLA 1NSAA 4OKOA 1LAPA 4ZX9A 4CDKA 4UIBA 1Z5RA 4TWEA 3PB7X 5J1QA 4C86A 4NGMA 4F9UA 4OC2A 4PXCA 1CX8A 3HUVA 1LOKA 3S9MA 1LAMA 4X8IA 4OC3A 2GLJA 1R43A 5K8MA 3TX8A 1V6CA 2AFWA 3SI1A 4MXUA 4MHNA 1XF1A 4UEZA 4A39A 1YSJA 2IMOA 4F9VA 2NSMA 3WC6A 1XBUA 2PE3A 4C9RA 3FMCA 1BLLE 3V38A 3D7FA 4OC5A 2F7VA 4CDJA 5I4MA 5LRJA 2AFMA 2PJ5A 4DUKA 3ICUA 3FJUA 4YWYA 1TF8A 3B3VA 3PFOA 4C8AA 3V7ZA 3H8EA 2OR4A 2V8GA 3B7IA 3I6SA 1CPSA 4BD9A 4RUHA 4P4DA 4A37A 4EFDA 4P4EA 1AYEA 4P4FA 1FNOA 2AFUA 4JYWA 2QVPA 1UWYA 3GB0A 3PRTA 2WZNA 3LWUA 4DYOA 2GLFA 2JBJA 1Q7LA
chains in the Genus database with same CATH superfamily
2Z11A 1ARMA 3IC1A 5HKYA 3OB2B 4KORA 4KOTA 4AVBA 4QBJA 7CPAA 1Z4EA 4UCMA 3SXNA 5K8PA 2PJ8A 4BPXB 4MFZA 2QJ8A 2RFHA 4M6IA 5JPHA 1Y9WA 1NXJA 3FEDA 4UA3A 1MJAA 2B4JC 3H8GA 5D8NA 1ZLHA 2QMLA 4MBUA 5K8OA 1M44A 3H8FA 1VBHA 3EZAA 3K4IA 3D7HA 5AXIA 5LYIA 5I0CA 2HC9A 5EBVA 4A30A 2V8HA 3EC4A 5J8FA 1XMTA 3CT9A 2PJ0A 3ISXA 4X3RA 2PIZA 1KC7A 1ELLP 2XPOA 4OMEA 3VWDA 4X5KA 4MHZA 2D0OA 2D4OA 1Q2YA 3CXQA 4A4BA 3CPXA 1QMUA 4CAFA 2V77A 5JGFA 3TLGB 4XNHB 1B47A 3IO1A 3OB1B 1CG2A 2EVNA 2CNMA 2ZEMA 2CTCA 1IB1E 3IU2A 1VHSA 3OWCA 1P0HA 1Z8WA 5AG7A 4YRHA 4AB7A 1ZRSA 4PXDA 3TYXA 3BXMA 4I49A 2AE6A 3PGPA 4NFRA 4B14A 3V8IA 3TLGA 3DLJA 3KZWA 1S3ZA 5F49A 2VL1A 3IJ3A 2XEJA 1J3LA 2PJCA 4F0XA 1PUAA 2JBKA 3HPGG 1FY7A 1VIXA 5HKWA 4CGMA 1JWQA 4WWVA 2B0AA 5JM6A 3PBEA 1Y0RA 2GANA 3T0TA 3QAHA 2YJTA 4R87A 2CNSA 2VKZG 3PBBA 4CS0B 3BHXA 4JVOA 2AJ6A 3S9NA 2WYRA 1VGYA 1R61A 2FCKA 2B4BA 2JEVA 2Z3KA 2WSAA 2I79A 4NJRA 3T9YA 1ZG8A 2GU2A 3GY9A 4KUAA 4LUAA 2FSRA 2V8DA 2DF5A 1XMBA 3VH9A 2Y1MA 3BI1A 4ONUA 2ZPAA 3T90A 1AMPA 4A33A 3S6KA 1CJWA 3K9TA 4KSIA 4PXEA 5AG6A 5ISVA 4IIXA 3TLBA 3SJGA 3R1KA 2JDDA 2VZYA 2MP0A 5HMNA 3PT1A 4CYQA 2Q4ZA 2OOTA 3KL9A 5JH9A 1I1DA 2B58A 3D2MA 2Z3MA 1TKHA 2ZW5A 1IIDA 3BJ7A 2YNCC 4MI4A 3SHPA 2C5QA 2ZEOA 4JJXA 4NXYA 4M6HA 3GJZA 2YNDA 2Q0YA 4H6UA 2BL1A 2Q43A 1LFWA 3KI9A 3SJXA 1VI4A 3PFVA 2IL4A 2ZEGA 1FBVA 2YGWA 2ZW7A 2A4NA 2Q04A 3PEIA 4F0YA 4KNGE 4GS4A 4CAXA 1XEBA 3WC5A 2F5IA 3K2KA 4C8PA 4B5PA 2ATRA 3PB6X 2ZEDA 5JYBA 3TLAA 3D68A 4R8FA 4PK3A 3D7GA 1ZG7A 3FECA 2C1CA 2ZENA 3KQZA 2GE3A 3NH5A 1VBGA 4FD4A 4FUUA 3VRRA 1WJTA 3NA6A 2B5GB 1GGOA 2EK9A 2WPXA 2G3AA 4ORFA 4Q36A 2I00A 5F48A 3VARA 3D8PA 3DSBA 1M4GA 3RNZA 4PV6A 4PK2A 2Z3OA 1VHOA 3IEHA 4C7HA 4IF5A 4M8DA 3WABA 3G3SA 2JEWA 3B3TA 4KOYA 2OB0A 4C8TA 2P6EA 2HUZA 2V8VA 1B87A 2CTBA 3PLFB 1YVKA 4YFJA 4BPUB 1EO0A 4PPZA 2PJAA 2PJ7A 2EK8A 3F5BA 3P2FA 3VATA 4Y49C 2BSWA 3DR8A 3KHXA 4M3SA 4NJQA 3R9GA 5KTCA 3FYNA 2K5TA 2CNTA 4OIWA 4NF1A 4HNYB 2XEFA 2PDOA 4FAIA 1V0CA 1Y7RA 2ZEEA 4KS9A 3OAKA 4NGQA 4Y49B 4AG9A 3PB8X 1ZYMA 4C2XA 4OC0A 1YLOA 2OZGA 3B3SA 3R9FA 3H4QA 3D66A 1U6MA 3B35A 2AFSA 4IUSA 2XEGA 1HDUA 2BCOA 4KVME 4P4JA 1GYTA 2R82A 1UFHA 3CZXA 4CZ1A 4KOWA 4MHYA 4NSQA 4Q7AA 3RYOA 2REFA 1F2OA 3DGVA 1YMEA 4A38A 4B13A 4E8OA 3D2PA 2FVGA 4GM5A 1YLEA 2PJ6A 5E96A 1CBXA 3IIBA 4FWUA 1ZLIA 4OIDA 3BI0A 4R6TA 2KCWA 1Y9ZA 3KR4A 4TJVA 3GIUA 4ZY2A 3FXTA 2PVVA 1M4DA 2POKA 2I3CA 2PJ2A 2D0PA 1BAVA 1IOIA 2UV8G 1IYKA 2X0SA 5AGEA 3BUWB 2PJBA 2IJZA 1LANA 3G8WA 4KOUA 2HV2A 3TOBA 2ZEHA 4MY0A 4J0NA 2EUIA 3EO4A 3B2YA 3VROA 2WUUA 2NYQA 4B5PB 2PJ4A 3S9LA 2X7BA 1KEEB 3JRUA 3WC7A 4OADA 3VRQA 4PSWA 4MCQA 5BY0A 4CYNA 3RO0A 4KOSA 2AUMA 2J8NA 1DTDA 5AG4A 1S7NA 3TO6A 4C9EA 4R3KA 5IB9A 4CAEA 4C84A 4UEEA 3CXPA 1WWZA 3EIFA 3T5MA 4HNXB 3BLNA 3TLEA 3RZAA 4NGPA 1IY7A 2DPSA 2FIAA 4YGOA 5F5XA 2C6PA 3EY5A 2ZW4A 3D3SA 3EXNA 4KSAA 2OZHA 4CAWA 4CRZB 3ISZA 4U5YA 1RXTA 3MGDA 4YN3A 3SI0A 3TE4A 2PRQA 3P2HA 2BO9A 1NMTA 1ZO0A 3N5FA 3QAYA 4P10A 4UF4A 2RC4A 2Q7BA 3TFYA 1XOVA 1IOFA 4H6ZA 2PJ9A 3LODA 4FD6A 1DE4C 4LQ6A 4EWTA 4L89A 5H86A 3JTKA 4A4CA 1IGBA 3TOAA 1S60A 4P6YA 4AXVA 1EE3P 1KWMA 4JZ0A 3ZNIA 4OC4A 5CBMA 4C99A 1CPXA 1FT7A 2BOAA 1Y7EA 4JXQA 2ZOGA 2N3AB 3DDDA 4DNCA 2AUNA 1BPMA 2FXFA 1YR0A 2R8VA 5HVHA 2OLSA 2B5GA 2HQYA 3DR6A 3FB3A 3GUXA 4B10A 4TNUA 1TF9A 3NE7A 1Z9UA 3NFZA 2JLMA 4R76A 5IX3A 4C9UA 4A2ZA 3I1UA 1IICA 4GPLB 1OBRA 3PP9A 4IIYA 2ABZA 4HKFA 1YW6A 1TIQA 4UIAA 4C9VA 2DPTA 4MY3A 2R98A 1QSOA 4OC1A 5EMIA 2P6FA 1KUXA 2ZOFA 2C6CA 3PB9X 4IAVA 1HDQA 4KZTA 4PXBA 4EMEA 5A28A 1BOBA 4G1PA 3NOJA 3T07A 2YNCA 5HH1A 3LMSA 5LYDA 4BTFA 3FVLA 4MMOA 5IB0A 2QECA 3TO7A 2R7HA 4P45A 1Y9KA 2PC1A 4CYOA 2XEIA 1WK4A 2VI7A 4ZY1A 1TXRA 1YREA 4IHMA 3QNVA 4II9A 4F8ZA 4NGNA 4C8FA 5D29A 4NGRA 2PQ8A 3I9SA 4M85A 2Z0ZA 1ELMP 3FF3A 1YK3A 3A9LA 2EZCA 3VTAA 1CP6A 5J3XA 4MHPA 2VEZA 2DLAA 2ZEPA 4AG7A 5IV0A 1GHEA 4COBA 3D4UA 4H2KA 5LYFA 4J3GA 3B3WA 4ZX8A 5BWAB 5JQ4A 4RN7A 2IQ6A 2AFOA 4NGTA 1YVOA 2CIJA 4UCPA 4ZYQA 2AFXA 4UWJA 2EO8A 4CGNA 5AG5A 2AFZA 2Z10A 1TKJA 3UY5A 3RBUA 1ARLA 1PU9A 3HMJG 3G23A 4ONWA 4W9YA 2P0WA 4UFXA 3SR3A 1Z2LA 4MJXA 1R3NA 2ODFA 2Y1NA 3K9UA 4JXRA 3FNCA 4EVYA 1XJOA 5A27A 1VHEA 4X2TA 2PJ3A 1BXRB 3S6HA 3HLPA 4IK2A 3BUMB 2Q4YA 2REEA 4P44A 5DS0A 2Q51A 4B5OA 2DEAA 4CGLA 2PVWA 1Z8LA 1BPNA 1ZG9A 3KR5A 4E94A 3IFEA 4MCSA 4WJBA 5HVGA 1ZL0A 2HWGA 1IU8A 3KGQA 2FM4A 1A2ZA 4Z65A 2ZXVA 4CRYB 2G0BA 4K30A 5H84A 2F8HA 1RTQA 4C9AA 3NFQA 2PIYA 5CPAA 3TO9A 1AUGA 4O23A 3EZEA 1JQGA 4E0AA 4EYSA 3PFEA 3JUWA 3VWEA 1RO5A 4MFJA 4L8AA 3C26A 3R96A 1KUVA 3EFAA 1XRYA 3KKWA 1F57A 3I74A 3VGOA 1CS0B 3SI2A 1NE9A 3D67A 4E5SA 5HVFA 2RB7A 3GYAA 3PZJA 4FD5A 1C30B 5THWA 3WT4A 4GXHA 4C8UA 4MCRA 4OAEA 1YVHA 2GREA 3O8ZA 3KHZA 1I12A 1LRZA 1Z8XA 1M4LA 4CGPA 2H5MA 1CP7A 1H8LA 1L0CA 3FRMA 4NEXA 2QYVA 1Y0YA 3CPAA 4HPSA 4UEFA 4K3NA 4CAVA 1X12A 5HKZA 5K99A 1YGHA 2O4HA 2P6GA 4NCZA 4QVTA 4KOXA 3F0AA 2XPNA 1Q2CA 3MN8A 1CM0A 2HROA 4YU9A 2VXKA 3D7DA 4KOVA 3TC8A 1P4NA 1Q2DA 2FS5A 2C6GA 3B3CA 3RAMA 4P4IA 4E2AA 4MCPA 3N7ZA 4RI1A 4C7IA 2ANPA 4P4BA 3GLJA 3FEEA 3DNSA 5LRGA 3T8WA 2PCNA 1JDBC 1TKFA 3IWWA 1S5KA 4A31A 3TLCA 4U9YA 5ELYA 2EZAA 4JD6A 4C85A 4A95A 5HXDA 3T05A 4C2YA 6CPAA 3FH4A 2EWBA 3KASA 1S7FA 1LCPA 1PYTB 2C27A 2G3TA 3ZZIA 4XPKA 4B12A 2ZELA 3TLYA 4B6ZA 2J9AA 3ZJ0A 2BUEA 4BBHA 1M6VB 2CXAA 2PSWA 1Q5XA 4XPDC 2Q7SA 3L2NA 1KUYA 2G9DA 3IWGA 2B4DA 2EBJA 2PCUA 3JVNA 2O53A 4MJ8A 4MRIA 1QSRA 3TT2A 5C82A 5K8NA 5KTAA 3S6FA 4INJA 1XIXA 1IYLA 8CPAA 4KSFA 3BUXB 2PR8A 4MFKA 2OH1A 1F2PA 1EZBA 4H89A 3KRVA 3NH8A 4A94A 4XPLA 5F9MA 3NH4A 5F09A 1XFOA 2JDCA 4JWPA 3F8KA 4MFPA 4TJXA 2HB6A 2CF4A 4QUSA 4B11A 5LRKA 2Z3LA 2NMTA 2Q4VA 3GKRA 4Q38A 4DJLA 1YW4A 4H1HA 1WVMA 4BMHA 3KQXA 3NE8A 1XE4A 4MHDA 2CBLA 3E0KA 3OP0A 3SJFA 4MFQA 1XF8A 3S6GA 4NGSA 1PCAA 4PQAA 1HEEA 4R3LA 4R7MA 3W91A 5JVLA 4LQGA 2YNEA 4U9ZA 3U1BA 2PJ1A 2ZW6A 2HI6A 4ZY0A 1X10A 3WR7A 3SJEA 2PR1A 1T36B 3FX6A 4AVCA 4ZI6A 3IGRA 1KZFA 4OP4A 4UCNA 4CGOA 4FBEA 5FD8A 1M4IA 4KLWA 5G20A 4C8CA 3W6SA 2CY2A 3MRUA 3PB4X 3R95A 2VQYA 4LX9A 4QC6A 2ZEFA 2R1IA 5J8CA 1QQ9A 4R9MA 2PRBA 3CDXA 4KLVA 4CPAA 5F47A 5LYLA 2YJVA 1M1DA 1NSAA 4OKOA 1LAPA 3LD2A 4ZX9A 4CDKA 4UIBA 5F13A 1Z5RA 1J4JA 2D4PA 1YQEA 4TWEA 2QIRA 3PB7X 5G1ZA 5J1QA 3IU1A 5C88A 2B3VA 2Z3PA 2WPWA 4KUBA 4M6GA 4NGMA 4ZBGA 4F9UA 4OC2A 2GFQA 3H5ZA 4C86A 1VKCA 2GIVA 4PXCA 1CX8A 1OZPA 3HUVA 4ZGYB 1LOKA 2E28A 2EZBA 5IR2A 1KBLA 4HNWB 3S9MA 4F6AA 2O28A 1LAMA 2OZUA 3HPHE 2XPPA 1C3OB 4XPDB 4X8IA 1QSTA 4OC3A 2XPLA 2GLJA 3R9EA 1R43A 2B4DB 5K8MA 1B6BA 4FD7A 3TX8A 3SXOA 1V6CA 2AFWA 3SI1A 2VZZA 4MXUA 3BJ8A 1ON0A 4MHNA 5G21A 1XF1A 4UEZA 2VBQA 4A39A 1YSJA 3U88C 2IMOA 4F9VA 1A9XB 2NSMA 4UFWA 3WC6A 5FVJA 2J8MA 4UWIA 4UBRA 1XBUA 4QB9A 2PE3A 1NSLA 4C9RA 3FMCA 1BLLE 2Z3NA 1N71A 1EZAA 3V38A 3D7FA 4OC5A 3VRNA 2F7VA 4CDJA 4JLYA 2Y0MA 1K4JA 5I4MA 3CXSA 3QB8A 1CE8B 5LRJA 2GP4A 2AFMA 5CNPA 1MJ9A 4COGA 5GCNA 3VRPA 2PJ5A 2FIWA 4OLLA 2JBJA 4RR2B 4C68A 3C8OA 3TLZA 1QSMA 4R57A 3FIXA 4DUKA 3EZBA 4C2ZA 3ICUA 3FJUA 1Z8TA 4YWYA 2B3UA 4MI1A 3BUOB 3B8GA 3FBUA 1TF8A 5G22A 3B3VA 3TTHA 3PFOA 4C8AA 3V7ZA 4RS2A 1Z9EA 3H8EA 2BEIA 2OR4A 1Z4RA 2V8GA 3B7IA 1NBWA 2FE7A 4A32A 3I6SA 2DIKA 5KTDA 2DXQA 2ARHA 3I3GA 4AVAA 1CPSA 3BUNB 4BD9A 4RUHA 4P4DA 3LACA 4A37A 4EFDA 5F1YA 4P4EA 1AYEA 3F9KC 1R57A 4CYPA 2FT0A 4P4FA 4MFLA 5DWMA 4BPWB 5EC4A 1FNOA 2AFUA 2FL4A 1QSNA 5DWNA 3TCVA 5F46A 1JDEA 4JYWA 1MK4A 2QVPA 1UWYA 1S7LA 3IWEA 4XNHC 3W6XA 2Q44A 1I21A 3GB0A 1YX0A 3PRTA 1MJBA 4KVOE 4UFVA 2WZNA 4BINA 1DIKA 3LWUA 1SQHA 4DYOA 4CO9A 2J8RA 2OU2A 2GLFA 1S7KA 1BO4A 1Q7LA 4PSXA 4KVXA
chains in the Genus database with same CATH topology
1ARMA 3IC1A 7CPAA 5K8PA 2PJ8A 2QJ8A 2RFHA 3FEDA 3H8GA 5D8NA 1ZLHA 5K8OA 3H8FA 3D7HA 5LYIA 2HC9A 2V8HA 3CT9A 2PJ0A 3ISXA 4X3RA 2PIZA 1ELLP 4OMEA 4MHZA 5JGFA 3CPXA 1QMUA 2V77A 3IO1A 1CG2A 2ZEMA 2CTCA 4PXDA 3BXMA 4NFRA 3DLJA 3KZWA 2VL1A 3IJ3A 2XEJA 2PJCA 2JBKA 1VIXA 4WWVA 5JM6A 3PBEA 1Y0RA 3PBBA 3BHXA 3S9NA 2WYRA 1VGYA 4NJRA 1ZG8A 2GU2A 2V8DA 3VH9A 1XMBA 3BI1A 1AMPA 3K9TA 4KSIA 4PXEA 3SJGA 2Q4ZA 2OOTA 3KL9A 5JH9A 1TKHA 2C5QA 2ZEOA 2Q43A 1LFWA 3KI9A 3SJXA 2ZEGA 3PEIA 4KNGE 3WC5A 3K2KA 4C8PA 3PB6X 2ZEDA 3D68A 4R8FA 3D7GA 1ZG7A 3FECA 2C1CA 2ZENA 3KQZA 3NH5A 4FUUA 3NA6A 2EK9A 3VARA 1VHOA 3IEHA 3WABA 2JEWA 3B3TA 4C8TA 2V8VA 2CTBA 4PPZA 2PJAA 2PJ7A 2EK8A 3VATA 3KHXA 4NJQA 4OIWA 2XEFA 4FAIA 2ZEEA 4NGQA 3PB8X 4OC0A 1YLOA 3B3SA 3D66A 3B35A 2AFSA 2XEGA 1HDUA 2BCOA 4P4JA 1GYTA 4Q7AA 4MHYA 4A38A 1F2OA 3DGVA 1YMEA 2FVGA 4GM5A 2PJ6A 1CBXA 3IIBA 4FWUA 1ZLIA 4OIDA 3BI0A 4R6TA 1Y9ZA 3KR4A 4TJVA 4ZY2A 2PVVA 2POKA 2I3CA 2PJ2A 1BAVA 2PJBA 2IJZA 1LANA 2ZEHA 3B2YA 2NYQA 2PJ4A 3S9LA 3JRUA 3WC7A 4MCQA 1DTDA 4C9EA 5IB9A 4C84A 4UEEA 3EIFA 3RZAA 4NGPA 1IY7A 2C6PA 3ISZA 4YN3A 3SI0A 2PRQA 2BO9A 3N5FA 4P10A 4UF4A 2PJ9A 1DE4C 4EWTA 4AXVA 1IGBA 4P6YA 1EE3P 1KWMA 4JZ0A 4OC4A 5CBMA 4C99A 1CPXA 1FT7A 2BOAA 1Y7EA 2ZOGA 1BPMA 5HVHA 3GUXA 4TNUA 1TF9A 3NFZA 4C9UA 4R76A 3I1UA 1OBRA 2ABZA 1YW6A 4UIAA 4C9VA 4OC1A 3PB9X 2ZOFA 2C6CA 4IAVA 1HDQA 4EMEA 4PXBA 4G1PA 3LMSA 5LYDA 3FVLA 4MMOA 4P45A 2XEIA 4ZY1A 1TXRA 4IHMA 3QNVA 4F8ZA 4NGNA 4C8FA 5D29A 4NGRA 1ELMP 3FF3A 3VTAA 1CP6A 4MHPA 2ZEPA 3D4UA 4H2KA 5LYFA 3B3WA 4ZX8A 2IQ6A 2AFOA 4NGTA 2CIJA 4ZYQA 2AFXA 2AFZA 1TKJA 3RBUA 1ARLA 4ONWA 4W9YA 1Z2LA 1R3NA 1XJOA 1VHEA 4X2TA 2PJ3A 3HLPA 4IK2A 4P44A 5DS0A 2Q51A 2DEAA 2PVWA 1Z8LA 1BPNA 1ZG9A 3KR5A 3IFEA 4MCSA 4WJBA 5HVGA 3KGQA 4Z65A 2F8HA 1RTQA 4C9AA 2PIYA 5CPAA 4O23A 1JQGA 3PFEA 1XRYA 1F57A 3I74A 3SI2A 3D67A 5HVFA 2RB7A 5THWA 3WT4A 4C8UA 4MCRA 2GREA 3KHZA 1M4LA 1CP7A 1H8LA 4UEFA 2QYVA 1Y0YA 3CPAA 4K3NA 2O4HA 3MN8A 4YU9A 3D7DA 3TC8A 3B3CA 2C6GA 3RAMA 4P4IA 4MCPA 2ANPA 4P4BA 3GLJA 3FEEA 5LRGA 3T8WA 1TKFA 3IWWA 5ELYA 4C85A 5HXDA 6CPAA 3FH4A 2EWBA 3KASA 4ZI6A 1LCPA 1PYTB 2ZELA 4B6ZA 2J9AA 3L2NA 2G9DA 4MRIA 2PCUA 2O53A 5K8NA 8CPAA 1F2PA 3NH8A 4A94A 3NH4A 5F09A 1XFOA 4TJXA 2HB6A 2CF4A 5LRKA 4DJLA 1YW4A 1WVMA 3KQXA 3SJFA 4NGSA 1PCAA 4PQAA 1HEEA 4R7MA 4LQGA 2PJ1A 4ZY0A 3SJEA 3FX6A 4OP4A 4FBEA 4C8CA 3MRUA 3PB4X 2ZEFA 1QQ9A 3CDXA 4CPAA 5LYLA 1NSAA 4OKOA 1LAPA 4ZX9A 4CDKA 4UIBA 1Z5RA 4TWEA 3PB7X 5J1QA 4C86A 4NGMA 4F9UA 4OC2A 4PXCA 5IR2A 1CX8A 3HUVA 1LOKA 3S9MA 1LAMA 4X8IA 4OC3A 2GLJA 1R43A 5K8MA 3TX8A 1V6CA 2AFWA 3SI1A 4MXUA 4MHNA 1XF1A 4UEZA 4A39A 1YSJA 2IMOA 4F9VA 2NSMA 3WC6A 1XBUA 2PE3A 4C9RA 3FMCA 1BLLE 3V38A 3D7FA 4OC5A 2F7VA 4CDJA 5I4MA 5LRJA 2GP4A 2AFMA 2PJ5A 4DUKA 3ICUA 3FJUA 4YWYA 1TF8A 3B3VA 3PFOA 4C8AA 3V7ZA 3H8EA 2OR4A 2V8GA 3B7IA 3I6SA 1CPSA 4BD9A 4RUHA 4P4DA 4A37A 4EFDA 4P4EA 1AYEA 4P4FA 1FNOA 2AFUA 4JYWA 2QVPA 1UWYA 3GB0A 3PRTA 2WZNA 3LWUA 4DYOA 2GLFA 2JBJA 1Q7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ARM A;  3IC1 A;  7CPA A;  5K8P A;  2PJ8 A;  2QJ8 A;  2RFH A;  3FED A;  3H8G A;  5D8N A;  1ZLH A;  5K8O A;  3H8F A;  3D7H A;  5LYI A;  2HC9 A;  2V8H A;  3CT9 A;  2PJ0 A;  3ISX A;  4X3R A;  2PIZ A;  1ELL P;  4OME A;  4MHZ A;  5JGF A;  3CPX A;  1QMU A;  2V77 A;  3IO1 A;  1CG2 A;  2ZEM A;  2CTC A;  4PXD A;  3BXM A;  4NFR A;  3DLJ A;  3KZW A;  2VL1 A;  3IJ3 A;  2XEJ A;  2PJC A;  2JBK A;  1VIX A;  4WWV A;  5JM6 A;  3PBE A;  1Y0R A;  3PBB A;  3BHX A;  3S9N A;  2WYR A;  1VGY A;  4NJR A;  1ZG8 A;  2GU2 A;  2V8D A;  3VH9 A;  1XMB A;  3BI1 A;  1AMP A;  3K9T A;  4KSI A;  4PXE A;  3SJG A;  2Q4Z A;  2OOT A;  3KL9 A;  5JH9 A;  1TKH A;  2ZEO A;  2Q43 A;  1LFW A;  3KI9 A;  3SJX A;  2ZEG A;  3PEI A;  4KNG E;  3WC5 A;  3K2K A;  4C8P A;  3PB6 X;  2ZED A;  3D68 A;  4R8F A;  3D7G A;  1ZG7 A;  3FEC A;  2C1C A;  2ZEN A;  3KQZ A;  3NH5 A;  4FUU A;  3NA6 A;  2EK9 A;  3VAR A;  1VHO A;  3IEH A;  3WAB A;  2JEW A;  3B3T A;  4C8T A;  2V8V A;  2CTB A;  4PPZ A;  2PJA A;  2PJ7 A;  2EK8 A;  3VAT A;  3KHX A;  4NJQ A;  4OIW A;  2XEF A;  4FAI A;  2ZEE A;  4NGQ A;  3PB8 X;  4OC0 A;  1YLO A;  3B3S A;  3D66 A;  3B35 A;  2AFS A;  2XEG A;  1HDU A;  2BCO A;  4P4J A;  1GYT A;  4Q7A A;  4MHY A;  4A38 A;  1F2O A;  3DGV A;  1YME A;  2FVG A;  4GM5 A;  2PJ6 A;  1CBX A;  3IIB A;  4FWU A;  1ZLI A;  4OID A;  3BI0 A;  4R6T A;  1Y9Z A;  3KR4 A;  4TJV A;  4ZY2 A;  2PVV A;  2POK A;  2I3C A;  2PJ2 A;  1BAV A;  2PJB A;  2IJZ A;  1LAN A;  2ZEH A;  3B2Y A;  2NYQ A;  2PJ4 A;  3S9L A;  3JRU A;  3WC7 A;  4MCQ A;  1DTD A;  4C9E A;  5IB9 A;  4C84 A;  4UEE A;  3EIF A;  3RZA A;  4NGP A;  1IY7 A;  2C6P A;  3ISZ A;  4YN3 A;  3SI0 A;  2PRQ A;  2BO9 A;  3N5F A;  4P10 A;  4UF4 A;  2PJ9 A;  1DE4 C;  4EWT A;  4AXV A;  1IGB A;  4P6Y A;  1EE3 P;  1KWM A;  4JZ0 A;  4OC4 A;  5CBM A;  4C99 A;  1CPX A;  1FT7 A;  2BOA A;  1Y7E A;  2ZOG A;  1BPM A;  5HVH A;  3GUX A;  4TNU A;  1TF9 A;  3NFZ A;  4C9U A;  4R76 A;  3I1U A;  1OBR A;  2ABZ A;  1YW6 A;  4UIA A;  4C9V A;  4OC1 A;  3PB9 X;  2ZOF A;  2C6C A;  4IAV A;  1HDQ A;  4EME A;  4PXB A;  4G1P A;  3LMS A;  5LYD A;  3FVL A;  4MMO A;  4P45 A;  2XEI A;  4ZY1 A;  1TXR A;  4IHM A;  3QNV A;  4F8Z A;  4NGN A;  4C8F A;  5D29 A;  4NGR A;  1ELM P;  3FF3 A;  3VTA A;  1CP6 A;  4MHP A;  2ZEP A;  3D4U A;  4H2K A;  5LYF A;  3B3W A;  4ZX8 A;  2IQ6 A;  2AFO A;  4NGT A;  2CIJ A;  4ZYQ A;  2AFX A;  2AFZ A;  1TKJ A;  3RBU A;  1ARL A;  4ONW A;  4W9Y A;  1Z2L A;  1R3N A;  1XJO A;  1VHE A;  4X2T A;  2PJ3 A;  3HLP A;  4IK2 A;  4P44 A;  5DS0 A;  2Q51 A;  2DEA A;  2PVW A;  1Z8L A;  1BPN A;  1ZG9 A;  3KR5 A;  3IFE A;  4MCS A;  4WJB A;  5HVG A;  3KGQ A;  4Z65 A;  2F8H A;  1RTQ A;  4C9A A;  2PIY A;  5CPA A;  4O23 A;  1JQG A;  3PFE A;  1XRY A;  1F57 A;  3I74 A;  3SI2 A;  3D67 A;  5HVF A;  2RB7 A;  5THW A;  3WT4 A;  4C8U A;  4MCR A;  2GRE A;  3KHZ A;  1M4L A;  1CP7 A;  1H8L A;  4UEF A;  2QYV A;  1Y0Y A;  3CPA A;  4K3N A;  2O4H A;  3MN8 A;  4YU9 A;  3D7D A;  3TC8 A;  3B3C A;  2C6G A;  3RAM A;  4P4I A;  4MCP A;  2ANP A;  4P4B A;  3GLJ A;  3FEE A;  5LRG A;  3T8W A;  1TKF A;  3IWW A;  5ELY A;  4C85 A;  5HXD A;  6CPA A;  3FH4 A;  2EWB A;  3KAS A;  4ZI6 A;  1LCP A;  1PYT B;  2ZEL A;  4B6Z A;  2J9A A;  3L2N A;  2G9D A;  4MRI A;  2PCU A;  2O53 A;  5K8N A;  8CPA A;  1F2P A;  3NH8 A;  4A94 A;  3NH4 A;  5F09 A;  1XFO A;  4TJX A;  2HB6 A;  2CF4 A;  5LRK A;  4DJL A;  1YW4 A;  1WVM A;  3KQX A;  3SJF A;  4NGS A;  1PCA A;  4PQA A;  1HEE A;  4R7M A;  4LQG A;  2PJ1 A;  4ZY0 A;  3SJE A;  3FX6 A;  4OP4 A;  4FBE A;  4C8C A;  3MRU A;  3PB4 X;  2ZEF A;  1QQ9 A;  3CDX A;  4CPA A;  5LYL A;  1NSA A;  4OKO A;  1LAP A;  4ZX9 A;  4CDK A;  4UIB A;  1Z5R A;  4TWE A;  3PB7 X;  5J1Q A;  4C86 A;  4NGM A;  4F9U A;  4OC2 A;  4PXC A;  1CX8 A;  3HUV A;  1LOK A;  3S9M A;  1LAM A;  4X8I A;  4OC3 A;  2GLJ A;  1R43 A;  5K8M A;  3TX8 A;  1V6C A;  2AFW A;  3SI1 A;  4MXU A;  4MHN A;  1XF1 A;  4UEZ A;  4A39 A;  1YSJ A;  2IMO A;  4F9V A;  2NSM A;  3WC6 A;  1XBU A;  2PE3 A;  4C9R A;  3FMC A;  1BLL E;  3V38 A;  3D7F A;  4OC5 A;  2F7V A;  4CDJ A;  5I4M A;  5LRJ A;  2AFM A;  2PJ5 A;  4DUK A;  3ICU A;  3FJU A;  4YWY A;  1TF8 A;  3B3V A;  3PFO A;  4C8A A;  3V7Z A;  3H8E A;  2OR4 A;  2V8G A;  3B7I A;  3I6S A;  1CPS A;  4BD9 A;  4RUH A;  4P4D A;  4A37 A;  4EFD A;  4P4E A;  1AYE A;  4P4F A;  1FNO A;  2AFU A;  4JYW A;  2QVP A;  1UWY A;  3GB0 A;  3PRT A;  2WZN A;  3LWU A;  4DYO A;  2GLF A;  2JBJ A;  1Q7L A; 
#chains in the Genus database with same CATH topology
 2Z11 A;  1ARM A;  3IC1 A;  5HKY A;  3OB2 B;  4KOR A;  4KOT A;  4AVB A;  4QBJ A;  7CPA A;  1Z4E A;  4UCM A;  3SXN A;  5K8P A;  2PJ8 A;  4BPX B;  4MFZ A;  2QJ8 A;  2RFH A;  4M6I A;  5JPH A;  1Y9W A;  1NXJ A;  3FED A;  4UA3 A;  1MJA A;  2B4J C;  3H8G A;  5D8N A;  1ZLH A;  2QML A;  4MBU A;  5K8O A;  1M44 A;  3H8F A;  1VBH A;  3EZA A;  3K4I A;  3D7H A;  5AXI A;  5LYI A;  5I0C A;  2HC9 A;  5EBV A;  4A30 A;  2V8H A;  3EC4 A;  5J8F A;  1XMT A;  3CT9 A;  2PJ0 A;  3ISX A;  4X3R A;  2PIZ A;  1KC7 A;  1ELL P;  2XPO A;  4OME A;  3VWD A;  4X5K A;  4MHZ A;  2D0O A;  2D4O A;  1Q2Y A;  3CXQ A;  4A4B A;  3CPX A;  1QMU A;  4CAF A;  2V77 A;  5JGF A;  3TLG B;  4XNH B;  1B47 A;  3IO1 A;  3OB1 B;  1CG2 A;  2EVN A;  2CNM A;  2ZEM A;  2CTC A;  1IB1 E;  3IU2 A;  1VHS A;  3OWC A;  1P0H A;  1Z8W A;  5AG7 A;  4YRH A;  4AB7 A;  1ZRS A;  4PXD A;  3TYX A;  3BXM A;  4I49 A;  2AE6 A;  3PGP A;  4NFR A;  4B14 A;  3V8I A;  3TLG A;  3DLJ A;  3KZW A;  1S3Z A;  5F49 A;  2VL1 A;  3IJ3 A;  2XEJ A;  1J3L A;  2PJC A;  4F0X A;  1PUA A;  2JBK A;  3HPG G;  1FY7 A;  1VIX A;  5HKW A;  4CGM A;  1JWQ A;  4WWV A;  2B0A A;  5JM6 A;  3PBE A;  1Y0R A;  2GAN A;  3T0T A;  3QAH A;  2YJT A;  4R87 A;  2CNS A;  2VKZ G;  3PBB A;  4CS0 B;  3BHX A;  4JVO A;  2AJ6 A;  3S9N A;  2WYR A;  1VGY A;  1R61 A;  2FCK A;  2B4B A;  2JEV A;  2Z3K A;  2WSA A;  2I79 A;  4NJR A;  3T9Y A;  1ZG8 A;  2GU2 A;  3GY9 A;  4KUA A;  4LUA A;  2FSR A;  2V8D A;  2DF5 A;  1XMB A;  3VH9 A;  2Y1M A;  3BI1 A;  4ONU A;  2ZPA A;  3T90 A;  1AMP A;  4A33 A;  3S6K A;  1CJW A;  3K9T A;  4KSI A;  4PXE A;  5AG6 A;  5ISV A;  4IIX A;  3TLB A;  3SJG A;  3R1K A;  2JDD A;  2VZY A;  2MP0 A;  5HMN A;  3PT1 A;  4CYQ A;  2Q4Z A;  2OOT A;  3KL9 A;  5JH9 A;  1I1D A;  2B58 A;  3D2M A;  2Z3M A;  1TKH A;  2ZW5 A;  1IID A;  3BJ7 A;  2YNC C;  4MI4 A;  3SHP A;  2C5Q A;  2ZEO A;  4JJX A;  4NXY A;  4M6H A;  3GJZ A;  2YND A;  2Q0Y A;  4H6U A;  2BL1 A;  2Q43 A;  1LFW A;  3KI9 A;  3SJX A;  1VI4 A;  3PFV A;  2IL4 A;  2ZEG A;  1FBV A;  2YGW A;  2ZW7 A;  2A4N A;  2Q04 A;  3PEI A;  4F0Y A;  4KNG E;  4GS4 A;  4CAX A;  1XEB A;  3WC5 A;  2F5I A;  3K2K A;  4C8P A;  4B5P A;  2ATR A;  3PB6 X;  2ZED A;  5JYB A;  3TLA A;  3D68 A;  4R8F A;  4PK3 A;  3D7G A;  1ZG7 A;  3FEC A;  2C1C A;  2ZEN A;  3KQZ A;  2GE3 A;  3NH5 A;  1VBG A;  4FD4 A;  4FUU A;  3VRR A;  1WJT A;  3NA6 A;  2B5G B;  1GGO A;  2EK9 A;  2WPX A;  2G3A A;  4ORF A;  4Q36 A;  2I00 A;  5F48 A;  3VAR A;  3D8P A;  3DSB A;  1M4G A;  3RNZ A;  4PV6 A;  4PK2 A;  2Z3O A;  1VHO A;  3IEH A;  4C7H A;  4IF5 A;  4M8D A;  3WAB A;  3G3S A;  2JEW A;  3B3T A;  4KOY A;  2OB0 A;  4C8T A;  2P6E A;  2HUZ A;  2V8V A;  1B87 A;  2CTB A;  3PLF B;  1YVK A;  4YFJ A;  4BPU B;  1EO0 A;  4PPZ A;  2PJA A;  2PJ7 A;  2EK8 A;  3F5B A;  3P2F A;  3VAT A;  4Y49 C;  2BSW A;  3DR8 A;  3KHX A;  4M3S A;  4NJQ A;  3R9G A;  5KTC A;  3FYN A;  2K5T A;  2CNT A;  4OIW A;  4NF1 A;  4HNY B;  2XEF A;  2PDO A;  4FAI A;  1V0C A;  1Y7R A;  2ZEE A;  4KS9 A;  3OAK A;  4NGQ A;  4Y49 B;  4AG9 A;  3PB8 X;  1ZYM A;  4C2X A;  4OC0 A;  1YLO A;  2OZG A;  3B3S A;  3R9F A;  3H4Q A;  3D66 A;  1U6M A;  3B35 A;  2AFS A;  4IUS A;  2XEG A;  1HDU A;  2BCO A;  4KVM E;  4P4J A;  1GYT A;  2R82 A;  1UFH A;  3CZX A;  4CZ1 A;  4KOW A;  4MHY A;  4NSQ A;  4Q7A A;  3RYO A;  2REF A;  1F2O A;  3DGV A;  1YME A;  4A38 A;  4B13 A;  4E8O A;  3D2P A;  2FVG A;  4GM5 A;  1YLE A;  2PJ6 A;  5E96 A;  1CBX A;  3IIB A;  4FWU A;  1ZLI A;  4OID A;  3BI0 A;  4R6T A;  2KCW A;  1Y9Z A;  3KR4 A;  4TJV A;  3GIU A;  4ZY2 A;  3FXT A;  2PVV A;  1M4D A;  2POK A;  2I3C A;  2PJ2 A;  2D0P A;  1BAV A;  1IOI A;  2UV8 G;  1IYK A;  2X0S A;  5AGE A;  3BUW B;  2PJB A;  2IJZ A;  1LAN A;  3G8W A;  4KOU A;  2HV2 A;  3TOB A;  2ZEH A;  4MY0 A;  4J0N A;  2EUI A;  3EO4 A;  3B2Y A;  3VRO A;  2WUU A;  2NYQ A;  4B5P B;  2PJ4 A;  3S9L A;  2X7B A;  1KEE B;  3JRU A;  3WC7 A;  4OAD A;  3VRQ A;  4PSW A;  4MCQ A;  5BY0 A;  4CYN A;  3RO0 A;  4KOS A;  2AUM A;  2J8N A;  1DTD A;  5AG4 A;  1S7N A;  3TO6 A;  4C9E A;  4R3K A;  5IB9 A;  4CAE A;  4C84 A;  4UEE A;  3CXP A;  1WWZ A;  3EIF A;  3T5M A;  4HNX B;  3BLN A;  3TLE A;  3RZA A;  4NGP A;  1IY7 A;  2DPS A;  2FIA A;  4YGO A;  5F5X A;  2C6P A;  3EY5 A;  2ZW4 A;  3D3S A;  3EXN A;  4KSA A;  2OZH A;  4CAW A;  4CRZ B;  3ISZ A;  4U5Y A;  1RXT A;  3MGD A;  4YN3 A;  3SI0 A;  3TE4 A;  2PRQ A;  3P2H A;  2BO9 A;  1NMT A;  1ZO0 A;  3N5F A;  3QAY A;  4P10 A;  4UF4 A;  2RC4 A;  2Q7B A;  3TFY A;  1XOV A;  1IOF A;  4H6Z A;  2PJ9 A;  3LOD A;  4FD6 A;  1DE4 C;  4LQ6 A;  4EWT A;  4L89 A;  5H86 A;  3JTK A;  4A4C A;  1IGB A;  3TOA A;  1S60 A;  4P6Y A;  4AXV A;  1EE3 P;  1KWM A;  4JZ0 A;  3ZNI A;  4OC4 A;  5CBM A;  4C99 A;  1CPX A;  1FT7 A;  2BOA A;  1Y7E A;  4JXQ A;  2ZOG A;  2N3A B;  3DDD A;  4DNC A;  2AUN A;  1BPM A;  2FXF A;  1YR0 A;  2R8V A;  5HVH A;  2OLS A;  2B5G A;  2HQY A;  3DR6 A;  3FB3 A;  3GUX A;  4B10 A;  4TNU A;  1TF9 A;  3NE7 A;  1Z9U A;  3NFZ A;  2JLM A;  4R76 A;  5IX3 A;  4C9U A;  4A2Z A;  3I1U A;  1IIC A;  4GPL B;  1OBR A;  3PP9 A;  4IIY A;  2ABZ A;  4HKF A;  1YW6 A;  1TIQ A;  4UIA A;  4C9V A;  2DPT A;  4MY3 A;  2R98 A;  1QSO A;  4OC1 A;  5EMI A;  2P6F A;  1KUX A;  2ZOF A;  2C6C A;  3PB9 X;  4IAV A;  1HDQ A;  4KZT A;  4PXB A;  4EME A;  5A28 A;  1BOB A;  4G1P A;  3NOJ A;  3T07 A;  2YNC A;  5HH1 A;  3LMS A;  5LYD A;  4BTF A;  3FVL A;  4MMO A;  5IB0 A;  2QEC A;  3TO7 A;  2R7H A;  4P45 A;  1Y9K A;  2PC1 A;  4CYO A;  2XEI A;  1WK4 A;  2VI7 A;  4ZY1 A;  1TXR A;  1YRE A;  4IHM A;  3QNV A;  4II9 A;  4F8Z A;  4NGN A;  4C8F A;  5D29 A;  4NGR A;  2PQ8 A;  3I9S A;  4M85 A;  2Z0Z A;  1ELM P;  3FF3 A;  1YK3 A;  3A9L A;  2EZC A;  3VTA A;  1CP6 A;  5J3X A;  4MHP A;  2VEZ A;  2DLA A;  2ZEP A;  4AG7 A;  5IV0 A;  1GHE A;  4COB A;  3D4U A;  4H2K A;  5LYF A;  4J3G A;  3B3W A;  4ZX8 A;  5BWA B;  5JQ4 A;  4RN7 A;  2IQ6 A;  2AFO A;  4NGT A;  1YVO A;  2CIJ A;  4UCP A;  4ZYQ A;  2AFX A;  4UWJ A;  2EO8 A;  4CGN A;  5AG5 A;  2AFZ A;  2Z10 A;  1TKJ A;  3UY5 A;  3RBU A;  1ARL A;  1PU9 A;  3HMJ G;  3G23 A;  4ONW A;  4W9Y A;  2P0W A;  4UFX A;  3SR3 A;  1Z2L A;  4MJX A;  1R3N A;  2ODF A;  2Y1N A;  3K9U A;  4JXR A;  3FNC A;  4EVY A;  1XJO A;  5A27 A;  1VHE A;  4X2T A;  2PJ3 A;  1BXR B;  3S6H A;  3HLP A;  4IK2 A;  3BUM B;  2Q4Y A;  2REE A;  4P44 A;  5DS0 A;  2Q51 A;  4B5O A;  2DEA A;  4CGL A;  2PVW A;  1Z8L A;  1BPN A;  1ZG9 A;  3KR5 A;  4E94 A;  3IFE A;  4MCS A;  4WJB A;  5HVG A;  1ZL0 A;  2HWG A;  1IU8 A;  3KGQ A;  2FM4 A;  1A2Z A;  4Z65 A;  2ZXV A;  4CRY B;  2G0B A;  4K30 A;  5H84 A;  2F8H A;  1RTQ A;  4C9A A;  3NFQ A;  2PIY A;  5CPA A;  3TO9 A;  1AUG A;  4O23 A;  3EZE A;  1JQG A;  4E0A A;  4EYS A;  3PFE A;  3JUW A;  3VWE A;  1RO5 A;  4MFJ A;  4L8A A;  3C26 A;  3R96 A;  1KUV A;  3EFA A;  1XRY A;  3KKW A;  1F57 A;  3I74 A;  3VGO A;  1CS0 B;  3SI2 A;  1NE9 A;  3D67 A;  4E5S A;  5HVF A;  2RB7 A;  3GYA A;  3PZJ A;  4FD5 A;  1C30 B;  5THW A;  3WT4 A;  4GXH A;  4C8U A;  4MCR A;  4OAE A;  1YVH A;  2GRE A;  3O8Z A;  3KHZ A;  1I12 A;  1LRZ A;  1Z8X A;  1M4L A;  4CGP A;  2H5M A;  1CP7 A;  1H8L A;  1L0C A;  3FRM A;  4NEX A;  2QYV A;  1Y0Y A;  3CPA A;  4HPS A;  4UEF A;  4K3N A;  4CAV A;  1X12 A;  5HKZ A;  5K99 A;  1YGH A;  2O4H A;  2P6G A;  4NCZ A;  4QVT A;  4KOX A;  3F0A A;  2XPN A;  1Q2C A;  3MN8 A;  1CM0 A;  2HRO A;  4YU9 A;  2VXK A;  3D7D A;  4KOV A;  3TC8 A;  1P4N A;  1Q2D A;  2FS5 A;  2C6G A;  3B3C A;  3RAM A;  4P4I A;  4E2A A;  4MCP A;  3N7Z A;  4RI1 A;  4C7I A;  2ANP A;  4P4B A;  3GLJ A;  3FEE A;  3DNS A;  5LRG A;  3T8W A;  2PCN A;  1JDB C;  1TKF A;  3IWW A;  1S5K A;  4A31 A;  3TLC A;  4U9Y A;  5ELY A;  2EZA A;  4JD6 A;  4C85 A;  4A95 A;  5HXD A;  3T05 A;  4C2Y A;  6CPA A;  3FH4 A;  2EWB A;  3KAS A;  1S7F A;  1LCP A;  1PYT B;  2C27 A;  2G3T A;  3ZZI A;  4XPK A;  4B12 A;  2ZEL A;  3TLY A;  4B6Z A;  2J9A A;  3ZJ0 A;  2BUE A;  4BBH A;  1M6V B;  2CXA A;  2PSW A;  1Q5X A;  4XPD C;  2Q7S A;  3L2N A;  1KUY A;  2G9D A;  3IWG A;  2B4D A;  2EBJ A;  2PCU A;  3JVN A;  2O53 A;  4MJ8 A;  4MRI A;  1QSR A;  3TT2 A;  5C82 A;  5K8N A;  5KTA A;  3S6F A;  4INJ A;  1XIX A;  1IYL A;  8CPA A;  4KSF A;  3BUX B;  2PR8 A;  4MFK A;  2OH1 A;  1F2P A;  1EZB A;  4H89 A;  3KRV A;  3NH8 A;  4A94 A;  4XPL A;  5F9M A;  3NH4 A;  5F09 A;  1XFO A;  2JDC A;  4JWP A;  3F8K A;  4MFP A;  4TJX A;  2HB6 A;  2CF4 A;  4QUS A;  4B11 A;  5LRK A;  2Z3L A;  2NMT A;  2Q4V A;  3GKR A;  4Q38 A;  4DJL A;  1YW4 A;  4H1H A;  1WVM A;  4BMH A;  3KQX A;  3NE8 A;  1XE4 A;  4MHD A;  2CBL A;  3E0K A;  3OP0 A;  3SJF A;  4MFQ A;  1XF8 A;  3S6G A;  4NGS A;  1PCA A;  4PQA A;  1HEE A;  4R3L A;  4R7M A;  3W91 A;  5JVL A;  4LQG A;  2YNE A;  4U9Z A;  3U1B A;  2PJ1 A;  2ZW6 A;  2HI6 A;  4ZY0 A;  1X10 A;  3WR7 A;  3SJE A;  2PR1 A;  1T36 B;  3FX6 A;  4AVC A;  4ZI6 A;  3IGR A;  1KZF A;  4OP4 A;  4UCN A;  4CGO A;  4FBE A;  5FD8 A;  1M4I A;  4KLW A;  5G20 A;  4C8C A;  3W6S A;  2CY2 A;  3MRU A;  3PB4 X;  3R95 A;  2VQY A;  4LX9 A;  4QC6 A;  2ZEF A;  2R1I A;  5J8C A;  1QQ9 A;  4R9M A;  2PRB A;  3CDX A;  4KLV A;  4CPA A;  5F47 A;  5LYL A;  2YJV A;  1M1D A;  1NSA A;  4OKO A;  1LAP A;  3LD2 A;  4ZX9 A;  4CDK A;  4UIB A;  5F13 A;  1Z5R A;  1J4J A;  2D4P A;  1YQE A;  4TWE A;  2QIR A;  3PB7 X;  5G1Z A;  5J1Q A;  3IU1 A;  5C88 A;  2B3V A;  2Z3P A;  2WPW A;  4KUB A;  4M6G A;  4NGM A;  4ZBG A;  4F9U A;  4OC2 A;  2GFQ A;  3H5Z A;  4C86 A;  1VKC A;  2GIV A;  4PXC A;  1CX8 A;  1OZP A;  3HUV A;  4ZGY B;  1LOK A;  2E28 A;  2EZB A;  5IR2 A;  1KBL A;  4HNW B;  3S9M A;  4F6A A;  2O28 A;  1LAM A;  2OZU A;  3HPH E;  2XPP A;  1C3O B;  4XPD B;  4X8I A;  1QST A;  4OC3 A;  2XPL A;  2GLJ A;  3R9E A;  1R43 A;  2B4D B;  5K8M A;  1B6B A;  4FD7 A;  3TX8 A;  3SXO A;  1V6C A;  2AFW A;  3SI1 A;  2VZZ A;  4MXU A;  3BJ8 A;  1ON0 A;  4MHN A;  5G21 A;  1XF1 A;  4UEZ A;  2VBQ A;  4A39 A;  1YSJ A;  3U88 C;  2IMO A;  4F9V A;  1A9X B;  2NSM A;  4UFW A;  3WC6 A;  5FVJ A;  2J8M A;  4UWI A;  4UBR A;  1XBU A;  4QB9 A;  2PE3 A;  1NSL A;  4C9R A;  3FMC A;  1BLL E;  2Z3N A;  1N71 A;  1EZA A;  3V38 A;  3D7F A;  4OC5 A;  3VRN A;  2F7V A;  4CDJ A;  4JLY A;  2Y0M A;  1K4J A;  5I4M A;  3CXS A;  3QB8 A;  1CE8 B;  5LRJ A;  2GP4 A;  2AFM A;  5CNP A;  1MJ9 A;  4COG A;  5GCN A;  3VRP A;  2PJ5 A;  2FIW A;  4OLL A;  2JBJ A;  4RR2 B;  4C68 A;  3C8O A;  3TLZ A;  1QSM A;  4R57 A;  3FIX A;  4DUK A;  3EZB A;  4C2Z A;  3ICU A;  3FJU A;  1Z8T A;  4YWY A;  2B3U A;  4MI1 A;  3BUO B;  3B8G A;  3FBU A;  1TF8 A;  5G22 A;  3B3V A;  3TTH A;  3PFO A;  4C8A A;  3V7Z A;  4RS2 A;  1Z9E A;  3H8E A;  2BEI A;  2OR4 A;  1Z4R A;  2V8G A;  3B7I A;  1NBW A;  2FE7 A;  4A32 A;  3I6S A;  2DIK A;  5KTD A;  2DXQ A;  2ARH A;  3I3G A;  4AVA A;  1CPS A;  3BUN B;  4BD9 A;  4RUH A;  4P4D A;  3LAC A;  4A37 A;  4EFD A;  5F1Y A;  4P4E A;  1AYE A;  3F9K C;  1R57 A;  4CYP A;  2FT0 A;  4P4F A;  4MFL A;  5DWM A;  4BPW B;  5EC4 A;  1FNO A;  2AFU A;  2FL4 A;  1QSN A;  5DWN A;  3TCV A;  5F46 A;  1JDE A;  4JYW A;  1MK4 A;  2QVP A;  1UWY A;  1S7L A;  3IWE A;  4XNH C;  3W6X A;  2Q44 A;  1I21 A;  3GB0 A;  1YX0 A;  3PRT A;  1MJB A;  4KVO E;  4UFV A;  2WZN A;  4BIN A;  1DIK A;  3LWU A;  1SQH A;  4DYO A;  4CO9 A;  2J8R A;  2OU2 A;  2GLF A;  1S7K A;  1BO4 A;  1Q7L A;  4PSX A;  4KVX A; 
#chains in the Genus database with same CATH homology
 1ARM A;  3IC1 A;  7CPA A;  5K8P A;  2PJ8 A;  2QJ8 A;  2RFH A;  3FED A;  3H8G A;  5D8N A;  1ZLH A;  5K8O A;  3H8F A;  3D7H A;  5LYI A;  2HC9 A;  2V8H A;  3CT9 A;  2PJ0 A;  3ISX A;  4X3R A;  2PIZ A;  1ELL P;  4OME A;  4MHZ A;  5JGF A;  3CPX A;  1QMU A;  2V77 A;  3IO1 A;  1CG2 A;  2ZEM A;  2CTC A;  4PXD A;  3BXM A;  4NFR A;  3DLJ A;  3KZW A;  2VL1 A;  3IJ3 A;  2XEJ A;  2PJC A;  2JBK A;  1VIX A;  4WWV A;  5JM6 A;  3PBE A;  1Y0R A;  3PBB A;  3BHX A;  3S9N A;  2WYR A;  1VGY A;  4NJR A;  1ZG8 A;  2GU2 A;  2V8D A;  3VH9 A;  1XMB A;  3BI1 A;  1AMP A;  3K9T A;  4KSI A;  4PXE A;  3SJG A;  2Q4Z A;  2OOT A;  3KL9 A;  5JH9 A;  1TKH A;  2C5Q A;  2ZEO A;  2Q43 A;  1LFW A;  3KI9 A;  3SJX A;  2ZEG A;  3PEI A;  4KNG E;  3WC5 A;  3K2K A;  4C8P A;  3PB6 X;  2ZED A;  3D68 A;  4R8F A;  3D7G A;  1ZG7 A;  3FEC A;  2C1C A;  2ZEN A;  3KQZ A;  3NH5 A;  4FUU A;  3NA6 A;  2EK9 A;  3VAR A;  1VHO A;  3IEH A;  3WAB A;  2JEW A;  3B3T A;  4C8T A;  2V8V A;  2CTB A;  4PPZ A;  2PJA A;  2PJ7 A;  2EK8 A;  3VAT A;  3KHX A;  4NJQ A;  4OIW A;  2XEF A;  4FAI A;  2ZEE A;  4NGQ A;  3PB8 X;  4OC0 A;  1YLO A;  3B3S A;  3D66 A;  3B35 A;  2AFS A;  2XEG A;  1HDU A;  2BCO A;  4P4J A;  1GYT A;  4Q7A A;  4MHY A;  4A38 A;  1F2O A;  3DGV A;  1YME A;  2FVG A;  4GM5 A;  2PJ6 A;  1CBX A;  3IIB A;  4FWU A;  1ZLI A;  4OID A;  3BI0 A;  4R6T A;  1Y9Z A;  3KR4 A;  4TJV A;  4ZY2 A;  2PVV A;  2POK A;  2I3C A;  2PJ2 A;  1BAV A;  2PJB A;  2IJZ A;  1LAN A;  2ZEH A;  3B2Y A;  2NYQ A;  2PJ4 A;  3S9L A;  3JRU A;  3WC7 A;  4MCQ A;  1DTD A;  4C9E A;  5IB9 A;  4C84 A;  4UEE A;  3EIF A;  3RZA A;  4NGP A;  1IY7 A;  2C6P A;  3ISZ A;  4YN3 A;  3SI0 A;  2PRQ A;  2BO9 A;  3N5F A;  4P10 A;  4UF4 A;  2PJ9 A;  1DE4 C;  4EWT A;  4AXV A;  1IGB A;  4P6Y A;  1EE3 P;  1KWM A;  4JZ0 A;  4OC4 A;  5CBM A;  4C99 A;  1CPX A;  1FT7 A;  2BOA A;  1Y7E A;  2ZOG A;  1BPM A;  5HVH A;  3GUX A;  4TNU A;  1TF9 A;  3NFZ A;  4C9U A;  4R76 A;  3I1U A;  1OBR A;  2ABZ A;  1YW6 A;  4UIA A;  4C9V A;  4OC1 A;  3PB9 X;  2ZOF A;  2C6C A;  4IAV A;  1HDQ A;  4EME A;  4PXB A;  4G1P A;  3LMS A;  5LYD A;  3FVL A;  4MMO A;  4P45 A;  2XEI A;  4ZY1 A;  1TXR A;  4IHM A;  3QNV A;  4F8Z A;  4NGN A;  4C8F A;  5D29 A;  4NGR A;  1ELM P;  3FF3 A;  3VTA A;  1CP6 A;  4MHP A;  2ZEP A;  3D4U A;  4H2K A;  5LYF A;  3B3W A;  4ZX8 A;  2IQ6 A;  2AFO A;  4NGT A;  2CIJ A;  4ZYQ A;  2AFX A;  2AFZ A;  1TKJ A;  3RBU A;  1ARL A;  4ONW A;  4W9Y A;  1Z2L A;  1R3N A;  1XJO A;  1VHE A;  4X2T A;  2PJ3 A;  3HLP A;  4IK2 A;  4P44 A;  5DS0 A;  2Q51 A;  2DEA A;  2PVW A;  1Z8L A;  1BPN A;  1ZG9 A;  3KR5 A;  3IFE A;  4MCS A;  4WJB A;  5HVG A;  3KGQ A;  4Z65 A;  2F8H A;  1RTQ A;  4C9A A;  2PIY A;  5CPA A;  4O23 A;  1JQG A;  3PFE A;  1XRY A;  1F57 A;  3I74 A;  3SI2 A;  3D67 A;  5HVF A;  2RB7 A;  5THW A;  3WT4 A;  4C8U A;  4MCR A;  2GRE A;  3KHZ A;  1M4L A;  1CP7 A;  1H8L A;  4UEF A;  2QYV A;  1Y0Y A;  3CPA A;  4K3N A;  2O4H A;  3MN8 A;  4YU9 A;  3D7D A;  3TC8 A;  3B3C A;  2C6G A;  3RAM A;  4P4I A;  4MCP A;  2ANP A;  4P4B A;  3GLJ A;  3FEE A;  5LRG A;  3T8W A;  1TKF A;  3IWW A;  5ELY A;  4C85 A;  5HXD A;  6CPA A;  3FH4 A;  2EWB A;  3KAS A;  4ZI6 A;  1LCP A;  1PYT B;  2ZEL A;  4B6Z A;  2J9A A;  3L2N A;  2G9D A;  4MRI A;  2PCU A;  2O53 A;  5K8N A;  8CPA A;  1F2P A;  3NH8 A;  4A94 A;  3NH4 A;  5F09 A;  1XFO A;  4TJX A;  2HB6 A;  2CF4 A;  5LRK A;  4DJL A;  1YW4 A;  1WVM A;  3KQX A;  3SJF A;  4NGS A;  1PCA A;  4PQA A;  1HEE A;  4R7M A;  4LQG A;  2PJ1 A;  4ZY0 A;  3SJE A;  3FX6 A;  4OP4 A;  4FBE A;  4C8C A;  3MRU A;  3PB4 X;  2ZEF A;  1QQ9 A;  3CDX A;  4CPA A;  5LYL A;  1NSA A;  4OKO A;  1LAP A;  4ZX9 A;  4CDK A;  4UIB A;  1Z5R A;  4TWE A;  3PB7 X;  5J1Q A;  4C86 A;  4NGM A;  4F9U A;  4OC2 A;  4PXC A;  5IR2 A;  1CX8 A;  3HUV A;  1LOK A;  3S9M A;  1LAM A;  4X8I A;  4OC3 A;  2GLJ A;  1R43 A;  5K8M A;  3TX8 A;  1V6C A;  2AFW A;  3SI1 A;  4MXU A;  4MHN A;  1XF1 A;  4UEZ A;  4A39 A;  1YSJ A;  2IMO A;  4F9V A;  2NSM A;  3WC6 A;  1XBU A;  2PE3 A;  4C9R A;  3FMC A;  1BLL E;  3V38 A;  3D7F A;  4OC5 A;  2F7V A;  4CDJ A;  5I4M A;  5LRJ A;  2GP4 A;  2AFM A;  2PJ5 A;  4DUK A;  3ICU A;  3FJU A;  4YWY A;  1TF8 A;  3B3V A;  3PFO A;  4C8A A;  3V7Z A;  3H8E A;  2OR4 A;  2V8G A;  3B7I A;  3I6S A;  1CPS A;  4BD9 A;  4RUH A;  4P4D A;  4A37 A;  4EFD A;  4P4E A;  1AYE A;  4P4F A;  1FNO A;  2AFU A;  4JYW A;  2QVP A;  1UWY A;  3GB0 A;  3PRT A;  2WZN A;  3LWU A;  4DYO A;  2GLF A;  2JBJ A;  1Q7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...