3SJGA

Human glutamate carboxypeptidase ii (e424a inactive mutant ) in complex with n-acetyl-aspartyl-aminooctanoic acid
Total Genus 269
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
269
sequence length
696
structure length
696
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Novel Substrate-Based Inhibitors of Human Glutamate Carboxypeptidase II with Enhanced Lipophilicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 269
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3sjgA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3sjgA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3sjgA02
2EK9A 3PB8X 1YLOA 3IJ3A 4DJLA 1ZLHA 3D7HA 2BO9A 4ZI6A 4MHPA 5CBMA 2QJ8A 3V7ZA 2V8HA 3PFOA 2ZELA 1FNOA 3QNVA 3CT9A 2ZOGA 5D8NA 2PJBA 3I74A 2IMOA 4X3RA 4DYOA 1XBUA 2FVGA 2ZEEA 5K8MA 3SJEA 4OC3A 4P44A 1KWMA 3B3VA 4UIAA 4C84A 2AFSA 2AFMA 4EFDA 2HB6A 1HDUA 4ONWA 4PXDA 3FEEA 3KR4A 5F09A 4OC1A 3KQXA 1AYEA 4C9AA 2JBJA 1LCPA 2ANPA 1F2OA 4UEFA 2PJ4A 1Y9ZA 2PCUA 4PXCA 3B3CA 3I1UA 3KHZA 1YW4A 4C85A 2AFWA 4PQAA 4TWEA 4MCRA 3LMSA 4TJVA 2V8DA 3RAMA 7CPAA 4P4FA 2PE3A 4P10A 5HVGA 2VL1A 2ZEMA 4R8FA 2IJZA 3KASA 4C9RA 1TKHA 3D7DA 1LAPA 4OIDA 3FVLA 4NJQA 4JYWA 3PBBA 1TKJA 2F8HA 3PEIA 4C8CA 2EK8A 5LRJA 4OC4A 5THWA 3NFZA 4ZY2A 1PCAA 2PJ7A 3RZAA 4P4EA 1LAMA 4H2KA 1ZG9A 5LRKA 4C9UA 3BHXA 5D29A 1F57A 3I6SA 2ZEGA 2PJ9A 2Q4ZA 4TNUA 5DS0A 3KHXA 3FJUA 4PXBA 3B3WA 4C86A 6CPAA 4NGSA 2ZEHA 4WJBA 4UEZA 5K8NA 4AXVA 3L2NA 2GLFA 4P45A 4IHMA 2DEAA 3PFEA 2OR4A 3SJGA 2CIJA 4ZYQA 2Q43A 2ZEPA 1BPMA 4BD9A 4OC2A 5JGFA 8CPAA 4A37A 1CP6A 1TXRA 2RB7A 4NFRA 3CPXA 3FMCA 2C6GA 4PXEA 3D68A 3FF3A 3SI0A 3B3SA 1ZLIA 2ZEFA 1WVMA 2G9DA 1YSJA 3IC1A 2V77A 4C9VA 4FBEA 3HUVA 4MXUA 4O23A 1ELLP 1UWYA 2NSMA 2EWBA 3K9TA 1TKFA 2I3CA 3WC5A 4MRIA 2PJ6A 2PJ0A 2XEGA 4UF4A 3VH9A 1YW6A 3EIFA 4B6ZA 4F8ZA 4F9VA 4TJXA 3IFEA 2ZOFA 4YWYA 1F2PA 2JBKA 2BCOA 4UEEA 1JQGA 2PJ5A 5I4MA 3WT4A 4NGNA 3RBUA 2AFXA 1CPXA 1Z5RA 4DUKA 3PB7X 3NH8A 3D7FA 5LYIA 4MCQA 4JZ0A 2GU2A 5ELYA 3FEDA 4R76A 4P6YA 4FWUA 3SJFA 4NGQA 2PJAA 5K8PA 4F9UA 4OP4A 1LANA 4C99A 2C6CA 3D67A 3V38A 1AMPA 1M4LA 2CTCA 3B35A 4OC5A 1OBRA 4OMEA 1Z8LA 4P4BA 3SI1A 3VARA 4R6TA 2QVPA 2ZEOA 1CX8A 4NGTA 3ISXA 3KI9A 3PB9X 2PVWA 4KSIA 1QQ9A 4GM5A 1VHOA 1XMBA 1R3NA 2HC9A 3PRTA 4NJRA 4K3NA 4C8PA 3KGQA 2XEJA 2AFUA 4WWVA 1BPNA 4P4JA 3KQZA 3S9MA 4YN3A 4UIBA 4YU9A 4CPAA 1RTQA 2C6PA 3WC6A 4NGMA 4RUHA 1PYTB 5HVFA 1VGYA 4FUUA 2PJ2A 2O4HA 4FAIA 1ARLA 5K8OA 2RFHA 3CDXA 2NYQA 4Q7AA 3KR5A 3DGVA 5LYLA 4P4IA 4MCPA 2PRQA 1ARMA 3HLPA 2PJCA 2PJ3A 4X2TA 3ISZA 3NH5A 3NH4A 3PB4X 1V6CA 3ICUA 4EMEA 2PIYA 4Z65A 3FX6A 4EWTA 4KNGE 1HEEA 2POKA 1CG2A 3GLJA 4C8UA 1XRYA 3D66A 5IB9A 3IWWA 3GUXA 3B2YA 4A38A 2OOTA 4IK2A 5J1QA 2GREA 4NGPA 1VHEA 2IQ6A 2WZNA 3H8EA 3CPAA 3GB0A 2PVVA 1XJOA 2Q51A 1DTDA 4X8IA 5HXDA 3IIBA 3NA6A 2AFOA 4MHYA 2ABZA 3PB6X 3D4UA 1QMUA 1Y0RA 4MHNA 4LQGA 1CPSA 3KZWA 2V8GA 3VTAA 3B3TA 4IAVA 1Z2LA 3TC8A 1LOKA 1NSAA 4ZX8A 3SI2A 2PJ1A 2C1CA 3S9LA 1VIXA 4A39A 5JH9A 2GLJA 2V8VA 3MN8A 3H8FA 2XEFA 1GYTA 5JM6A 3BI1A 3WABA 3LWUA 1ZG7A 4MCSA 1TF9A 3IEHA 1IY7A 3KL9A 3VATA 3PBEA 1IGBA 4ZY1A 3H8GA 4C9EA 1FT7A 3S9NA 4C8AA 1TF8A 4CDJA 3BI0A 1YMEA 1Y0YA 3WC7A 4NGRA 1CP7A 5LYDA 1ELMP 3FH4A 3TX8A 5LYFA 4ZX9A 1R43A 4MHZA 1DE4C 3DLJA 1BAVA 4R7MA 4W9YA 2F7VA 1CBXA 5HVHA 5CPAA 2JEWA 4OKOA 4CDKA 3K2KA 4MMOA 1LFWA 1Y7EA 2XEIA 3D7GA 4P4DA 3IO1A 3SJXA 2PIZA 2O53A 5LRGA 4A94A 2ZENA 4ZY0A 4G1PA 2QYVA 2WYRA 1XFOA 4C8FA 2J9AA 3MRUA 2PJ8A 1ZG8A 3T8WA 4C8TA 1BLLE 3JRUA 3B7IA 1XF1A 2CF4A 2ZEDA 4OIWA 2BOAA 4PPZA 3BXMA 1H8LA 3N5FA 1EE3P 1HDQA 3FECA 1Q7LA 2AFZA 4OC0A 2CTBA
chains in the Genus database with same CATH superfamily
2EK9A 1M4GA 3PB8X 1NSLA 3R96A 1YLOA 3IJ3A 3DDDA 5JVLA 4DJLA 1YVKA 1ZLHA 2JLMA 3TLBA 3D7HA 3TLZA 2BO9A 4FD7A 3K4IA 4KLWA 5F47A 4OADA 1XE4A 4ZI6A 4AVBA 4MHPA 3F9KC 5CBMA 2YNCC 1GHEA 2QJ8A 2JDCA 3V7ZA 3TOBA 4CAVA 2WPXA 2V8HA 2B4DB 3PFOA 2ZELA 1FNOA 3QNVA 2EBJA 3CT9A 2ZOGA 4A4CA 5J8FA 1QSNA 2C27A 2PJBA 1MJ9A 5D8NA 4UFXA 4C2ZA 2IMOA 3I74A 4BTFA 5HMNA 3TLEA 4CS0B 4X3RA 1P0HA 2Q4VA 1J4JA 3DR6A 4DYOA 2EZBA 1XBUA 2P0WA 3P2FA 4CRYB 4K30A 1QSOA 3PZJA 2FVGA 1M4DA 2NMTA 4DNCA 2GE3A 1Z8XA 2ZEEA 5K8MA 1YR0A 1KUVA 2J8NA 3RO0A 5KTDA 3SJEA 2B3UA 3F0AA 1B87A 4OC3A 5F13A 2D0OA 4P44A 1IB1E 5J3XA 1KWMA 1X10A 3D2MA 4H6ZA 3VROA 2QECA 2PSWA 4B5OA 1CE8B 2Q04A 2X7BA 3B3VA 4NEXA 4UIAA 2AFSA 2D4PA 4XPLA 4INJA 3T05A 4C84A 2AFMA 2REFA 4KOTA 4EFDA 2HB6A 3BUNB 3JUWA 4R87A 1HDUA 2HUZA 3FYNA 3MGDA 4MY0A 4ONWA 4HNYB 4PXDA 3QB8A 1YGHA 3FEEA 1JWQA 3KR4A 4OC1A 5F09A 2G3AA 3KQXA 3TO9A 3W91A 1AYEA 5AXIA 5C82A 4C9AA 4B10A 2JBJA 1LCPA 2J8MA 1QSRA 1F2OA 2ANPA 4MFJA 4UWJA 1T36B 5IX3A 2G0BA 2EVNA 2XPNA 4UEFA 2JDDA 3D8PA 2DF5A 2PJ4A 3JTKA 5F5XA 4CGOA 3VRPA 1Y9ZA 1B6BA 2YJVA 3TE4A 2PCUA 4PXCA 4RI1A 3B3CA 3I1UA 3QAHA 3KHZA 5BY0A 2FIWA 3ZZIA 1YW4A 2PCNA 3FXTA 3GJZA 4R3LA 4C85A 2AFWA 1KC7A 4PQAA 4TWEA 4MCRA 3LMSA 3G8WA 4TJVA 4JXQA 3BUXB 4YRHA 2V8DA 1LRZA 3RAMA 2Z3KA 7CPAA 4P4FA 2PE3A 1PU9A 4P10A 5HVGA 3VRQA 4AG7A 2Y1MA 2VL1A 4GS4A 2PRBA 5GCNA 3UY5A 5EC4A 4KLVA 3HPHE 4GXHA 5FVJA 4E0AA 2ZEMA 3FBUA 4R8FA 2Q44A 2IJZA 4A95A 4KVOE 3KASA 2ARHA 2VI7A 5K99A 4C9RA 1TKHA 2FSRA 2EO8A 2GANA 1JDEA 4HNXB 3TLYA 3D7DA 2N3AB 4M8DA 4YFJA 4M6HA 3VRNA 3EFAA 2D0PA 1LAPA 4OIDA 3FVLA 3GIUA 1YREA 2WPWA 4NJQA 4FD4A 1S7KA 4JYWA 3GKRA 3PBBA 4PV6A 3FNCA 1TKJA 2F8HA 3PEIA 4BBHA 4C8CA 1S3ZA 2EK8A 5LRJA 2VKZG 3SXOA 5A27A 4OC4A 1BXRB 4H1HA 3VGOA 4UFWA 5THWA 5FD8A 2BSWA 3NFZA 4ZY2A 2R1IA 4UCMA 4HKFA 1Q2CA 1PCAA 4B5PB 2PJ7A 3RZAA 4UCPA 4P4EA 1LAMA 3P2HA 4H2KA 4KOVA 3BUWB 1ZG9A 2PQ8A 4EYSA 5G20A 5LRKA 4C9UA 3BHXA 5D29A 1F57A 2J8RA 2ZEGA 4LQ6A 3I6SA 2PJ9A 4CRZB 1YVOA 2Q4ZA 5A28A 2QMLA 4TNUA 1Z9UA 1FBVA 3R9EA 5JYBA 5DS0A 1MJAA 4H89A 1VBHA 2OZUA 3KHXA 1N71A 3FJUA 4PXBA 2GIVA 3T90A 2EZAA 4KOWA 5J8CA 2FM4A 1KUYA 2ZXVA 3B3WA 4PK3A 5IB0A 2AE6A 4C86A 1Z8TA 5G1ZA 6CPAA 4BPXB 4NGSA 1XIXA 2HV2A 2ZEHA 4ONUA 4H6UA 4UEZA 4WJBA 5K8NA 1YVHA 4Y49C 2R98A 3F8KA 5IR2A 4AXVA 4E94A 5H86A 1CM0A 4CGMA 2ZPAA 3L2NA 4HNWB 2GLFA 4IF5A 1GGOA 4P45A 4IHMA 2OZHA 2DEAA 4R57A 3SXNA 1VKCA 2VZYA 4C68A 1M44A 2FT0A 2OR4A 3I9SA 3NE7A 3PFEA 4MI4A 3SJGA 2CIJA 4NF1A 4U9ZA 5HH1A 4MY3A 4AVAA 4ZYQA 5JPHA 2C5QA 4KVXA 4QVTA 4KOYA 2Q43A 1M6VB 3A9LA 5DWNA 2ZEPA 4FD6A 2YGWA 1BPMA 4RS2A 4BD9A 2Z3OA 4BINA 1KBLA 4OC2A 2GFQA 5JGFA 1QSMA 3CZXA 2YJTA 8CPAA 3TLAA 2VQYA 1CP6A 1TXRA 2RB7A 3NE8A 4NFRA 5H84A 3HPGG 3CPXA 4A37A 2I79A 3FMCA 4CAWA 1A9XB 5HKYA 2X0SA 3ZJ0A 2C6GA 4C7IA 1NXJA 4PXEA 1S60A 3D68A 1RO5A 4R9MA 3FF3A 3D3SA 3B3SA 3SI0A 2YNCA 1ZLIA 2ZEFA 4C2YA 1I1DA 3G3SA 2QIRA 4CAEA 1VI4A 1WVMA 2G9DA 1YSJA 3IC1A 4X5KA 4MFZA 1K4JA 4NCZA 2V77A 1C3OB 2Z3LA 4C9VA 3T07A 4FBEA 2H5MA 3H5ZA 2XPOA 3HUVA 3OP0A 3OAKA 1P4NA 3CXPA 4MXUA 3VWEA 3W6SA 4O23A 4MI1A 1ELLP 1UWYA 2NSMA 2EWBA 1U6MA 3K9TA 1TKFA 4MHDA 2I3CA 3WC5A 4MRIA 2PJ6A 2PJ0A 3PFVA 1XF8A 4A2ZA 3CXSA 3LACA 3TLGB 2ODFA 3U1BA 2XEGA 4UF4A 3VH9A 3KRVA 1YW6A 4Y49B 3EIFA 1EZBA 4B6ZA 4F8ZA 4F9VA 3EY5A 4TJXA 4Q38A 3T5MA 1AUGA 2OZGA 3IFEA 2ZOFA 4NXYA 3D2PA 4YWYA 3N7ZA 1F2PA 3NOJA 2FS5A 4CGPA 2JBKA 2BCOA 4QUSA 4UEEA 1JQGA 2PJ5A 3WR7A 2B0AA 3IGRA 3WT4A 4NGNA 5I4MA 4MJXA 3IWEA 4C7HA 4Q36A 1V0CA 4A4BA 3RBUA 1Y9KA 2AFXA 1CPXA 1Z5RA 3BLNA 4FD5A 2Q7SA 3PB7X 2D4OA 3NH8A 4DUKA 3K9UA 4M3SA 2Z3MA 4CYQA 2RC4A 1WK4A 1Y7RA 4LX9A 1Z9EA 2EUIA 1IYLA 3D7FA 3E0KA 1S7FA 2R82A 5LYIA 2PR1A 4MCQA 4JZ0A 2CBLA 4MFPA 2MP0A 4M85A 2GU2A 5ELYA 1KZFA 3FEDA 4I49A 4P6YA 4R76A 2CNMA 1IOFA 4FWUA 4JVOA 4KVME 3R95A 3SJFA 4NGQA 2PJAA 2Z10A 5K8PA 2B5GA 4F9UA 2E28A 4OP4A 1LANA 4QB9A 3JVNA 4C99A 1WJTA 1RXTA 2FXFA 4JXRA 1NBWA 1BOBA 2PR8A 2AUNA 2C6CA 3D67A 2PC1A 4J3GA 3V38A 1AMPA 5BWAB 1M4LA 1L0CA 2CTCA 2WUUA 3B35A 4OC5A 1IU8A 5E96A 1ON0A 2DPSA 1OBRA 1S5KA 4OMEA 1Z8LA 4QBJA 1VHSA 4P4BA 3SI1A 3VARA 3TYXA 4M6IA 2GP4A 4R6TA 2QVPA 1CS0B 4A32A 1YQEA 2ZEOA 2Z3PA 4UFVA 1CX8A 4NGTA 3ISXA 5KTAA 3TTHA 4GPLB 3KI9A 3PB9X 2PVWA 4YGOA 4KSIA 4COGA 2B58A 2ATRA 1XEBA 1QQ9A 4GM5A 2ZW4A 3OWCA 1VHOA 1EO0A 1XMBA 3FIXA 5AG6A 4KS9A 1NMTA 1ZL0A 1R3NA 3BJ8A 4PK2A 2HC9A 4JJXA 3PRTA 4MBUA 4MJ8A 3BJ7A 4NJRA 2B4JC 3R9FA 4NSQA 4E2AA 2CXAA 2HI6A 3SHPA 2B4DA 2CY2A 2DPTA 4K3NA 2OU2A 4CGNA 3EZAA 4C8PA 5C88A 1VBGA 4MFLA 1S7NA 2A4NA 3KGQA 4B11A 5ISVA 2XEJA 2AFUA 4UBRA 1BPNA 4P4JA 1IOIA 4WWVA 4XPDB 3KQZA 5DWMA 2DLAA 3S9MA 1FY7A 3I3GA 4ORFA 4YN3A 4UIBA 1B47A 2ZW5A 4YU9A 3C8OA 1IICA 4CPAA 1BO4A 2C6PA 1RTQA 2WSAA 3WC6A 3EO4A 4NGMA 4U9YA 4RUHA 1PYTB 3DNSA 5HVFA 1VGYA 4FUUA 2PJ2A 3VWDA 2VEZA 2REEA 2O4HA 2YNDA 3TO7A 5F9MA 3ZNIA 1KUXA 3NFQA 1ARLA 2FCKA 2ZW7A 4FAIA 1Q2YA 2RFHA 1NE9A 3GY9A 3CDXA 2NYQA 4Q7AA 2B5GB 3KR5A 4MFKA 1Q5XA 1Z4RA 4XNHC 5G21A 4XPKA 5I0CA 3DGVA 2DXQA 5LYLA 4P4IA 4MCPA 1UFHA 2PRQA 2R7HA 5K8OA 4M6GA 1ARMA 3SR3A 3HLPA 2ZW6A 2PJCA 4B14A 3R9GA 1CJWA 1R57A 2PJ3A 5KTCA 4CYPA 3G23A 4X2TA 3PT1A 3ISZA 3NH5A 3NH4A 3T0TA 3PB4X 1V6CA 3TFYA 1Y9WA 3DSBA 4E8OA 1YK3A 4EMEA 5AG4A 2PIYA 5CNPA 3ICUA 3PP9A 5AG7A 4Z65A 1M4IA 3FX6A 3IU2A 4EWTA 5F46A 4KNGE 3OB1B 1HEEA 3O8ZA 1CG2A 2XPPA 1WWZA 2POKA 3BUOB 1XRYA 3D66A 3OB2B 3FRMA 3GLJA 4HPSA 3T9YA 4CAXA 1IYKA 4L8AA 5IB9A 4B13A 1I12A 3IWWA 1EZAA 3GUXA 3B2YA 3CXQA 4A38A 2OOTA 2BEIA 4IK2A 3V8IA 2XPLA 5J1QA 1Z4EA 2GREA 2HWGA 2BUEA 5EMIA 4PSXA 4CGLA 4NGPA 1VHEA 2IQ6A 4L89A 3EZEA 2WZNA 3H8EA 2CNTA 4KUAA 4KSAA 2AJ6A 3CPAA 3GB0A 4KOXA 2PVVA 1XJOA 2HQYA 2R8VA 2Q51A 3EZBA 1DTDA 4X8IA 2B4BA 3W6XA 5HXDA 4AB7A 3IIBA 3NA6A 2AFOA 4MHYA 2ABZA 4LUAA 3PB6X 1KEEB 3U88C 3B8GA 3D4UA 3EC4A 1QMUA 2B3VA 2IL4A 5EBVA 4U5YA 4JD6A 2Y0MA 1Y0RA 4MHNA 4LQGA 1CPSA 1QSTA 3KZWA 3TCVA 3TO6A 1C30B 2V8GA 3VTAA 3B3TA 4IAVA 4UA3A 1Z2LA 4B12A 3TC8A 1LOKA 1NSAA 4XNHB 3LODA 4ZX8A 4IIYA 3SI2A 2PJ1A 2C1CA 2AUMA 3S9LA 1VIXA 5F48A 4A39A 4AG9A 2FL4A 4XPDC 3H4QA 4F0XA 4B5PA 5JH9A 3GYAA 3IU1A 4ZBGA 2CNSA 2GLJA 2V8VA 3MN8A 1JDBC 4C2XA 2Y1NA 3FB3A 3H8FA 2XEFA 1GYTA 5JM6A 3BI1A 3WABA 4KORA 3DR8A 3TOAA 4CAFA 3LWUA 1ZG7A 4MCSA 1A2ZA 1MK4A 4EVYA 3S6KA 1Q2DA 1TF9A 4ZGYB 3IEHA 4UCNA 5F49A 1IY7A 2PDOA 2DIKA 3KL9A 2Q4YA 4KOSA 4CYOA 2I00A 3VATA 3PBEA 1IGBA 3R1KA 2OH1A 4IUSA 3S6GA 3TT2A 4ZY1A 3H8GA 1MJBA 1ZO0A 1FT7A 2Z3NA 3S9NA 4KZTA 1DIKA 1TF8A 4C9EA 2Q7BA 4C8AA 3PLFB 3IWGA 5JQ4A 4BPUB 2HROA 4CDJA 3BI0A 2VBQA 4PSWA 3RNZA 1YMEA 1Y0YA 3C26A 3WC7A 4II9A 1Z8WA 4NGRA 5AG5A 1CP7A 5HKZA 1ELMP 3FH4A 5LYDA 3TX8A 4F0YA 5LYFA 2VZZA 4ZX9A 3S6FA 1ZRSA 4J0NA 3BUMB 1R43A 2K5TA 4MHZA 1DE4C 4AVCA 3DLJA 4KUBA 1BAVA 1XOVA 4A33A 4R7MA 4W9YA 2F5IA 1ZYMA 4CZ1A 4BMHA 2F7VA 2P6FA 3F5BA 1I21A 4C8UA 2EZCA 4CO9A 1CBXA 5HVHA 5AGEA 2JEWA 1OZPA 4OKOA 4OAEA 4MFQA 2Q0YA 5CPAA 1M1DA 4KSFA 2OB0A 3K2KA 4CDKA 1PUAA 4A31A 4A30A 4BPWB 5HKWA 4MMOA 1LFWA 1Y7EA 4F6AA 2XEIA 3D7GA 4P4DA 3IO1A 5IV0A 1IIDA 3SJXA 2PIZA 2G3TA 2O53A 5LRGA 4A94A 2O28A 3PGPA 2BL1A 2ZENA 4R3KA 3EXNA 4KOUA 4UWIA 1X12A 3LD2A 4G1PA 4ZY0A 3RYOA 2QYVA 2WYRA 2YNEA 1TIQA 1XFOA 4C8FA 1R61A 2J9AA 3MRUA 1XMTA 1YLEA 2P6GA 2PJ8A 3HMJG 2Z11A 5G22A 1ZG8A 1SQHA 2P6EA 3T8WA 4IIXA 4C8TA 1BLLE 4OLLA 2FE7A 3JRUA 4RN7A 3B7IA 3VRRA 1S7LA 1XF1A 2UV8G 4RR2B 2CF4A 2ZEDA 4OIWA 3TLCA 2KCWA 2BOAA 4JWPA 4PPZA 3BXMA 4JLYA 4E5SA 4QC6A 1H8LA 4COBA 3TLGA 3N5FA 3KKWA 3QAYA 1EE3P 2Z0ZA 1YX0A 1J3LA 3S6HA 1HDQA 3FECA 1Q7LA 2AFZA 2FIAA 2OLSA 2JEVA 5F1YA 4OC0A 2VXKA 2CTBA 4CYNA
chains in the Genus database with same CATH topology
2EK9A 3PB8X 1YLOA 3IJ3A 4DJLA 1ZLHA 3D7HA 2BO9A 4ZI6A 4MHPA 5CBMA 2QJ8A 3V7ZA 2V8HA 3PFOA 2ZELA 1FNOA 3QNVA 3CT9A 2ZOGA 5D8NA 2PJBA 3I74A 2IMOA 4X3RA 4DYOA 1XBUA 2FVGA 2ZEEA 5K8MA 3SJEA 4OC3A 4P44A 1KWMA 3B3VA 4UIAA 4C84A 2AFSA 2AFMA 4EFDA 2HB6A 1HDUA 4ONWA 4PXDA 3FEEA 3KR4A 5F09A 4OC1A 3KQXA 1AYEA 4C9AA 2JBJA 1LCPA 2ANPA 1F2OA 4UEFA 2PJ4A 1Y9ZA 2PCUA 4PXCA 3B3CA 3I1UA 3KHZA 1YW4A 4C85A 2AFWA 4PQAA 4TWEA 4MCRA 3LMSA 4TJVA 2V8DA 3RAMA 7CPAA 4P4FA 2PE3A 4P10A 5HVGA 2VL1A 2ZEMA 4R8FA 2IJZA 3KASA 4C9RA 1TKHA 3D7DA 1LAPA 4OIDA 3FVLA 4NJQA 4JYWA 3PBBA 1TKJA 2F8HA 3PEIA 4C8CA 2EK8A 5LRJA 4OC4A 5THWA 3NFZA 4ZY2A 1PCAA 2PJ7A 3RZAA 4P4EA 1LAMA 4H2KA 1ZG9A 5LRKA 4C9UA 3BHXA 5D29A 1F57A 3I6SA 2ZEGA 2PJ9A 2Q4ZA 4TNUA 5DS0A 3KHXA 3FJUA 4PXBA 3B3WA 4C86A 6CPAA 4NGSA 2ZEHA 4WJBA 4UEZA 5K8NA 5IR2A 4AXVA 3L2NA 2GLFA 4P45A 4IHMA 2DEAA 3PFEA 2OR4A 3SJGA 2CIJA 4ZYQA 2C5QA 2Q43A 2ZEPA 1BPMA 4BD9A 4OC2A 5JGFA 8CPAA 4A37A 1CP6A 1TXRA 2RB7A 4NFRA 3CPXA 3FMCA 2C6GA 4PXEA 3D68A 3FF3A 3SI0A 3B3SA 1ZLIA 2ZEFA 1WVMA 2G9DA 1YSJA 3IC1A 2V77A 4C9VA 4FBEA 3HUVA 4MXUA 4O23A 1ELLP 1UWYA 2NSMA 2EWBA 3K9TA 1TKFA 2I3CA 3WC5A 4MRIA 2PJ6A 2PJ0A 2XEGA 4UF4A 3VH9A 1YW6A 3EIFA 4B6ZA 4F8ZA 4F9VA 4TJXA 3IFEA 2ZOFA 4YWYA 1F2PA 2JBKA 2BCOA 4UEEA 1JQGA 2PJ5A 5I4MA 3WT4A 4NGNA 3RBUA 2AFXA 1CPXA 1Z5RA 4DUKA 3PB7X 3NH8A 3D7FA 5LYIA 4MCQA 4JZ0A 2GU2A 5ELYA 3FEDA 4R76A 4P6YA 4FWUA 3SJFA 4NGQA 2PJAA 5K8PA 4F9UA 4OP4A 1LANA 4C99A 2C6CA 3D67A 3V38A 1AMPA 1M4LA 2CTCA 3B35A 4OC5A 1OBRA 4OMEA 1Z8LA 4P4BA 3SI1A 3VARA 2GP4A 4R6TA 2QVPA 2ZEOA 1CX8A 4NGTA 3ISXA 3KI9A 3PB9X 2PVWA 4KSIA 1QQ9A 4GM5A 1VHOA 1XMBA 1R3NA 2HC9A 3PRTA 4NJRA 4K3NA 4C8PA 3KGQA 2XEJA 2AFUA 4WWVA 1BPNA 4P4JA 3KQZA 3S9MA 4YN3A 4UIBA 4YU9A 4CPAA 1RTQA 2C6PA 3WC6A 4NGMA 4RUHA 1PYTB 5HVFA 1VGYA 4FUUA 2PJ2A 2O4HA 4FAIA 1ARLA 5K8OA 2RFHA 3CDXA 2NYQA 4Q7AA 3KR5A 3DGVA 5LYLA 4P4IA 4MCPA 2PRQA 1ARMA 3HLPA 2PJCA 2PJ3A 4X2TA 3ISZA 3NH5A 3NH4A 3PB4X 1V6CA 3ICUA 4EMEA 2PIYA 4Z65A 3FX6A 4EWTA 4KNGE 1HEEA 2POKA 1CG2A 3GLJA 4C8UA 1XRYA 3D66A 5IB9A 3IWWA 3GUXA 3B2YA 4A38A 2OOTA 4IK2A 5J1QA 2GREA 4NGPA 1VHEA 2IQ6A 2WZNA 3H8EA 3CPAA 3GB0A 2PVVA 1XJOA 2Q51A 1DTDA 4X8IA 5HXDA 3IIBA 3NA6A 2AFOA 4MHYA 2ABZA 3PB6X 3D4UA 1QMUA 1Y0RA 4MHNA 4LQGA 1CPSA 3KZWA 2V8GA 3VTAA 3B3TA 4IAVA 1Z2LA 3TC8A 1LOKA 1NSAA 4ZX8A 3SI2A 2PJ1A 2C1CA 3S9LA 1VIXA 4A39A 5JH9A 2GLJA 2V8VA 3MN8A 3H8FA 2XEFA 1GYTA 5JM6A 3BI1A 3WABA 3LWUA 1ZG7A 4MCSA 1TF9A 3IEHA 1IY7A 3KL9A 3VATA 3PBEA 1IGBA 4ZY1A 3H8GA 4C9EA 1FT7A 3S9NA 4C8AA 1TF8A 4CDJA 3BI0A 1YMEA 1Y0YA 3WC7A 4NGRA 1CP7A 5LYDA 1ELMP 3FH4A 3TX8A 5LYFA 4ZX9A 1R43A 4MHZA 1DE4C 3DLJA 1BAVA 4R7MA 4W9YA 2F7VA 1CBXA 5HVHA 5CPAA 2JEWA 4OKOA 4CDKA 3K2KA 4MMOA 1LFWA 1Y7EA 2XEIA 3D7GA 4P4DA 3IO1A 3SJXA 2PIZA 2O53A 5LRGA 4A94A 2ZENA 4ZY0A 4G1PA 2QYVA 2WYRA 1XFOA 4C8FA 2J9AA 3MRUA 2PJ8A 1ZG8A 3T8WA 4C8TA 1BLLE 3JRUA 3B7IA 1XF1A 2CF4A 2ZEDA 4OIWA 2BOAA 4PPZA 3BXMA 1H8LA 3N5FA 1EE3P 1HDQA 3FECA 1Q7LA 2AFZA 4OC0A 2CTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EK9 A;  3PB8 X;  1YLO A;  3IJ3 A;  4DJL A;  1ZLH A;  3D7H A;  2BO9 A;  4ZI6 A;  4MHP A;  5CBM A;  2QJ8 A;  3V7Z A;  2V8H A;  3PFO A;  2ZEL A;  1FNO A;  3QNV A;  3CT9 A;  2ZOG A;  5D8N A;  2PJB A;  3I74 A;  2IMO A;  4X3R A;  4DYO A;  1XBU A;  2FVG A;  2ZEE A;  5K8M A;  3SJE A;  4OC3 A;  4P44 A;  1KWM A;  3B3V A;  4UIA A;  4C84 A;  2AFS A;  2AFM A;  4EFD A;  2HB6 A;  1HDU A;  4ONW A;  4PXD A;  3FEE A;  3KR4 A;  5F09 A;  4OC1 A;  3KQX A;  1AYE A;  4C9A A;  2JBJ A;  1LCP A;  2ANP A;  1F2O A;  4UEF A;  2PJ4 A;  1Y9Z A;  2PCU A;  4PXC A;  3B3C A;  3I1U A;  3KHZ A;  1YW4 A;  4C85 A;  2AFW A;  4PQA A;  4TWE A;  4MCR A;  3LMS A;  4TJV A;  2V8D A;  3RAM A;  7CPA A;  4P4F A;  2PE3 A;  4P10 A;  5HVG A;  2VL1 A;  2ZEM A;  4R8F A;  2IJZ A;  3KAS A;  4C9R A;  1TKH A;  3D7D A;  1LAP A;  4OID A;  3FVL A;  4NJQ A;  4JYW A;  3PBB A;  1TKJ A;  2F8H A;  3PEI A;  4C8C A;  2EK8 A;  5LRJ A;  4OC4 A;  5THW A;  3NFZ A;  4ZY2 A;  1PCA A;  2PJ7 A;  3RZA A;  4P4E A;  1LAM A;  4H2K A;  1ZG9 A;  5LRK A;  4C9U A;  3BHX A;  5D29 A;  1F57 A;  3I6S A;  2ZEG A;  2PJ9 A;  2Q4Z A;  4TNU A;  5DS0 A;  3KHX A;  3FJU A;  4PXB A;  3B3W A;  4C86 A;  6CPA A;  4NGS A;  2ZEH A;  4WJB A;  4UEZ A;  5K8N A;  4AXV A;  3L2N A;  2GLF A;  4P45 A;  4IHM A;  2DEA A;  3PFE A;  2OR4 A;  3SJG A;  2CIJ A;  4ZYQ A;  2Q43 A;  2ZEP A;  1BPM A;  4BD9 A;  4OC2 A;  5JGF A;  8CPA A;  4A37 A;  1CP6 A;  1TXR A;  2RB7 A;  4NFR A;  3CPX A;  3FMC A;  2C6G A;  4PXE A;  3D68 A;  3FF3 A;  3SI0 A;  3B3S A;  1ZLI A;  2ZEF A;  1WVM A;  2G9D A;  1YSJ A;  3IC1 A;  2V77 A;  4C9V A;  4FBE A;  3HUV A;  4MXU A;  4O23 A;  1ELL P;  1UWY A;  2NSM A;  2EWB A;  3K9T A;  1TKF A;  2I3C A;  3WC5 A;  4MRI A;  2PJ6 A;  2PJ0 A;  2XEG A;  4UF4 A;  3VH9 A;  1YW6 A;  3EIF A;  4B6Z A;  4F8Z A;  4F9V A;  4TJX A;  3IFE A;  2ZOF A;  4YWY A;  1F2P A;  2JBK A;  2BCO A;  4UEE A;  1JQG A;  2PJ5 A;  5I4M A;  3WT4 A;  4NGN A;  3RBU A;  2AFX A;  1CPX A;  1Z5R A;  4DUK A;  3PB7 X;  3NH8 A;  3D7F A;  5LYI A;  4MCQ A;  4JZ0 A;  2GU2 A;  5ELY A;  3FED A;  4R76 A;  4P6Y A;  4FWU A;  3SJF A;  4NGQ A;  2PJA A;  5K8P A;  4F9U A;  4OP4 A;  1LAN A;  4C99 A;  2C6C A;  3D67 A;  3V38 A;  1AMP A;  1M4L A;  2CTC A;  3B35 A;  4OC5 A;  1OBR A;  4OME A;  1Z8L A;  4P4B A;  3SI1 A;  3VAR A;  4R6T A;  2QVP A;  2ZEO A;  1CX8 A;  4NGT A;  3ISX A;  3KI9 A;  3PB9 X;  2PVW A;  4KSI A;  1QQ9 A;  4GM5 A;  1VHO A;  1XMB A;  1R3N A;  2HC9 A;  3PRT A;  4NJR A;  4K3N A;  4C8P A;  3KGQ A;  2XEJ A;  2AFU A;  4WWV A;  1BPN A;  4P4J A;  3KQZ A;  3S9M A;  4YN3 A;  4UIB A;  4YU9 A;  4CPA A;  1RTQ A;  2C6P A;  3WC6 A;  4NGM A;  4RUH A;  1PYT B;  5HVF A;  1VGY A;  4FUU A;  2PJ2 A;  2O4H A;  4FAI A;  1ARL A;  5K8O A;  2RFH A;  3CDX A;  2NYQ A;  4Q7A A;  3KR5 A;  3DGV A;  5LYL A;  4P4I A;  4MCP A;  2PRQ A;  1ARM A;  3HLP A;  2PJC A;  2PJ3 A;  4X2T A;  3ISZ A;  3NH5 A;  3NH4 A;  3PB4 X;  1V6C A;  3ICU A;  4EME A;  2PIY A;  4Z65 A;  3FX6 A;  4EWT A;  4KNG E;  1HEE A;  2POK A;  1CG2 A;  3GLJ A;  4C8U A;  1XRY A;  3D66 A;  5IB9 A;  3IWW A;  3GUX A;  3B2Y A;  4A38 A;  2OOT A;  4IK2 A;  5J1Q A;  2GRE A;  4NGP A;  1VHE A;  2IQ6 A;  2WZN A;  3H8E A;  3CPA A;  3GB0 A;  2PVV A;  1XJO A;  2Q51 A;  1DTD A;  4X8I A;  5HXD A;  3IIB A;  3NA6 A;  2AFO A;  4MHY A;  2ABZ A;  3PB6 X;  3D4U A;  1QMU A;  1Y0R A;  4MHN A;  4LQG A;  1CPS A;  3KZW A;  2V8G A;  3VTA A;  3B3T A;  4IAV A;  1Z2L A;  3TC8 A;  1LOK A;  1NSA A;  4ZX8 A;  3SI2 A;  2PJ1 A;  2C1C A;  3S9L A;  1VIX A;  4A39 A;  5JH9 A;  2GLJ A;  2V8V A;  3MN8 A;  3H8F A;  2XEF A;  1GYT A;  5JM6 A;  3BI1 A;  3WAB A;  3LWU A;  1ZG7 A;  4MCS A;  1TF9 A;  3IEH A;  1IY7 A;  3KL9 A;  3VAT A;  3PBE A;  1IGB A;  4ZY1 A;  3H8G A;  4C9E A;  1FT7 A;  3S9N A;  4C8A A;  1TF8 A;  4CDJ A;  3BI0 A;  1YME A;  1Y0Y A;  3WC7 A;  4NGR A;  1CP7 A;  5LYD A;  1ELM P;  3FH4 A;  3TX8 A;  5LYF A;  4ZX9 A;  1R43 A;  4MHZ A;  1DE4 C;  3DLJ A;  1BAV A;  4R7M A;  4W9Y A;  2F7V A;  1CBX A;  5HVH A;  5CPA A;  2JEW A;  4OKO A;  4CDK A;  3K2K A;  4MMO A;  1LFW A;  1Y7E A;  2XEI A;  3D7G A;  4P4D A;  3IO1 A;  3SJX A;  2PIZ A;  2O53 A;  5LRG A;  4A94 A;  2ZEN A;  4ZY0 A;  4G1P A;  2QYV A;  2WYR A;  1XFO A;  4C8F A;  2J9A A;  3MRU A;  2PJ8 A;  1ZG8 A;  3T8W A;  4C8T A;  1BLL E;  3JRU A;  3B7I A;  1XF1 A;  2CF4 A;  2ZED A;  4OIW A;  2BOA A;  4PPZ A;  3BXM A;  1H8L A;  3N5F A;  1EE3 P;  1HDQ A;  3FEC A;  1Q7L A;  2AFZ A;  4OC0 A;  2CTB A; 
#chains in the Genus database with same CATH topology
 2EK9 A;  1M4G A;  3PB8 X;  1NSL A;  3R96 A;  1YLO A;  3IJ3 A;  3DDD A;  5JVL A;  4DJL A;  1YVK A;  1ZLH A;  2JLM A;  3TLB A;  3D7H A;  3TLZ A;  2BO9 A;  4FD7 A;  3K4I A;  4KLW A;  5F47 A;  4OAD A;  1XE4 A;  4ZI6 A;  4AVB A;  4MHP A;  3F9K C;  5CBM A;  2YNC C;  1GHE A;  2QJ8 A;  2JDC A;  3V7Z A;  3TOB A;  4CAV A;  2WPX A;  2V8H A;  2B4D B;  3PFO A;  2ZEL A;  1FNO A;  3QNV A;  2EBJ A;  3CT9 A;  2ZOG A;  4A4C A;  5J8F A;  1QSN A;  2C27 A;  2PJB A;  1MJ9 A;  5D8N A;  4UFX A;  4C2Z A;  2IMO A;  3I74 A;  4BTF A;  5HMN A;  3TLE A;  4CS0 B;  4X3R A;  1P0H A;  2Q4V A;  1J4J A;  3DR6 A;  4DYO A;  2EZB A;  1XBU A;  2P0W A;  3P2F A;  4CRY B;  4K30 A;  1QSO A;  3PZJ A;  2FVG A;  1M4D A;  2NMT A;  4DNC A;  2GE3 A;  1Z8X A;  2ZEE A;  5K8M A;  1YR0 A;  1KUV A;  2J8N A;  3RO0 A;  5KTD A;  3SJE A;  2B3U A;  3F0A A;  1B87 A;  4OC3 A;  5F13 A;  2D0O A;  4P44 A;  1IB1 E;  5J3X A;  1KWM A;  1X10 A;  3D2M A;  4H6Z A;  3VRO A;  2QEC A;  2PSW A;  4B5O A;  1CE8 B;  2Q04 A;  2X7B A;  3B3V A;  4NEX A;  4UIA A;  2AFS A;  2D4P A;  4XPL A;  4INJ A;  3T05 A;  4C84 A;  2AFM A;  2REF A;  4KOT A;  4EFD A;  2HB6 A;  3BUN B;  3JUW A;  4R87 A;  1HDU A;  2HUZ A;  3FYN A;  3MGD A;  4MY0 A;  4ONW A;  4HNY B;  4PXD A;  3QB8 A;  1YGH A;  3FEE A;  1JWQ A;  3KR4 A;  4OC1 A;  5F09 A;  2G3A A;  3KQX A;  3TO9 A;  3W91 A;  1AYE A;  5AXI A;  5C82 A;  4C9A A;  4B10 A;  2JBJ A;  1LCP A;  2J8M A;  1QSR A;  1F2O A;  2ANP A;  4MFJ A;  4UWJ A;  1T36 B;  5IX3 A;  2G0B A;  2EVN A;  2XPN A;  4UEF A;  2JDD A;  3D8P A;  2DF5 A;  2PJ4 A;  3JTK A;  5F5X A;  4CGO A;  3VRP A;  1Y9Z A;  1B6B A;  2YJV A;  3TE4 A;  2PCU A;  4PXC A;  4RI1 A;  3B3C A;  3I1U A;  3QAH A;  3KHZ A;  5BY0 A;  2FIW A;  3ZZI A;  1YW4 A;  2PCN A;  3FXT A;  3GJZ A;  4R3L A;  4C85 A;  2AFW A;  1KC7 A;  4PQA A;  4TWE A;  4MCR A;  3LMS A;  3G8W A;  4TJV A;  4JXQ A;  3BUX B;  4YRH A;  2V8D A;  1LRZ A;  3RAM A;  2Z3K A;  7CPA A;  4P4F A;  2PE3 A;  1PU9 A;  4P10 A;  5HVG A;  3VRQ A;  4AG7 A;  2Y1M A;  2VL1 A;  4GS4 A;  2PRB A;  5GCN A;  3UY5 A;  5EC4 A;  4KLV A;  3HPH E;  4GXH A;  5FVJ A;  4E0A A;  2ZEM A;  3FBU A;  4R8F A;  2Q44 A;  2IJZ A;  4A95 A;  4KVO E;  3KAS A;  2ARH A;  2VI7 A;  5K99 A;  4C9R A;  1TKH A;  2FSR A;  2EO8 A;  2GAN A;  1JDE A;  4HNX B;  3TLY A;  3D7D A;  2N3A B;  4M8D A;  4YFJ A;  4M6H A;  3VRN A;  3EFA A;  2D0P A;  1LAP A;  4OID A;  3FVL A;  3GIU A;  1YRE A;  2WPW A;  4NJQ A;  4FD4 A;  1S7K A;  4JYW A;  3GKR A;  3PBB A;  4PV6 A;  3FNC A;  1TKJ A;  2F8H A;  3PEI A;  4BBH A;  4C8C A;  1S3Z A;  2EK8 A;  5LRJ A;  2VKZ G;  3SXO A;  5A27 A;  4OC4 A;  1BXR B;  4H1H A;  3VGO A;  4UFW A;  5THW A;  5FD8 A;  2BSW A;  3NFZ A;  4ZY2 A;  2R1I A;  4UCM A;  4HKF A;  1Q2C A;  1PCA A;  4B5P B;  2PJ7 A;  3RZA A;  4UCP A;  4P4E A;  1LAM A;  3P2H A;  4H2K A;  4KOV A;  3BUW B;  1ZG9 A;  2PQ8 A;  4EYS A;  5G20 A;  5LRK A;  4C9U A;  3BHX A;  5D29 A;  1F57 A;  2J8R A;  2ZEG A;  4LQ6 A;  3I6S A;  2PJ9 A;  4CRZ B;  1YVO A;  2Q4Z A;  5A28 A;  2QML A;  4TNU A;  1Z9U A;  1FBV A;  3R9E A;  5JYB A;  5DS0 A;  1MJA A;  4H89 A;  1VBH A;  2OZU A;  3KHX A;  1N71 A;  3FJU A;  4PXB A;  2GIV A;  3T90 A;  2EZA A;  4KOW A;  5J8C A;  2FM4 A;  1KUY A;  2ZXV A;  3B3W A;  4PK3 A;  5IB0 A;  2AE6 A;  4C86 A;  1Z8T A;  5G1Z A;  6CPA A;  4BPX B;  4NGS A;  1XIX A;  2HV2 A;  2ZEH A;  4ONU A;  4H6U A;  4UEZ A;  4WJB A;  5K8N A;  1YVH A;  4Y49 C;  2R98 A;  3F8K A;  5IR2 A;  4AXV A;  4E94 A;  5H86 A;  1CM0 A;  4CGM A;  2ZPA A;  3L2N A;  4HNW B;  2GLF A;  4IF5 A;  1GGO A;  4P45 A;  4IHM A;  2OZH A;  2DEA A;  4R57 A;  3SXN A;  1VKC A;  2VZY A;  4C68 A;  1M44 A;  2FT0 A;  2OR4 A;  3I9S A;  3NE7 A;  3PFE A;  4MI4 A;  3SJG A;  2CIJ A;  4NF1 A;  4U9Z A;  5HH1 A;  4MY3 A;  4AVA A;  4ZYQ A;  5JPH A;  2C5Q A;  4KVX A;  4QVT A;  4KOY A;  2Q43 A;  1M6V B;  3A9L A;  5DWN A;  2ZEP A;  4FD6 A;  2YGW A;  1BPM A;  4RS2 A;  4BD9 A;  2Z3O A;  4BIN A;  1KBL A;  4OC2 A;  2GFQ A;  5JGF A;  1QSM A;  3CZX A;  2YJT A;  8CPA A;  3TLA A;  2VQY A;  1CP6 A;  1TXR A;  2RB7 A;  3NE8 A;  4NFR A;  5H84 A;  3HPG G;  3CPX A;  4A37 A;  2I79 A;  3FMC A;  4CAW A;  1A9X B;  5HKY A;  2X0S A;  3ZJ0 A;  2C6G A;  4C7I A;  1NXJ A;  4PXE A;  1S60 A;  3D68 A;  1RO5 A;  4R9M A;  3FF3 A;  3D3S A;  3B3S A;  3SI0 A;  2YNC A;  1ZLI A;  2ZEF A;  4C2Y A;  1I1D A;  3G3S A;  2QIR A;  4CAE A;  1VI4 A;  1WVM A;  2G9D A;  1YSJ A;  3IC1 A;  4X5K A;  4MFZ A;  1K4J A;  4NCZ A;  2V77 A;  1C3O B;  2Z3L A;  4C9V A;  3T07 A;  4FBE A;  2H5M A;  3H5Z A;  2XPO A;  3HUV A;  3OP0 A;  3OAK A;  1P4N A;  3CXP A;  4MXU A;  3VWE A;  3W6S A;  4O23 A;  4MI1 A;  1ELL P;  1UWY A;  2NSM A;  2EWB A;  1U6M A;  3K9T A;  1TKF A;  4MHD A;  2I3C A;  3WC5 A;  4MRI A;  2PJ6 A;  2PJ0 A;  3PFV A;  1XF8 A;  4A2Z A;  3CXS A;  3LAC A;  3TLG B;  2ODF A;  3U1B A;  2XEG A;  4UF4 A;  3VH9 A;  3KRV A;  1YW6 A;  4Y49 B;  3EIF A;  1EZB A;  4B6Z A;  4F8Z A;  4F9V A;  3EY5 A;  4TJX A;  4Q38 A;  3T5M A;  1AUG A;  2OZG A;  3IFE A;  2ZOF A;  4NXY A;  3D2P A;  4YWY A;  3N7Z A;  1F2P A;  3NOJ A;  2FS5 A;  4CGP A;  2JBK A;  2BCO A;  4QUS A;  4UEE A;  1JQG A;  2PJ5 A;  3WR7 A;  2B0A A;  3IGR A;  3WT4 A;  4NGN A;  5I4M A;  4MJX A;  3IWE A;  4C7H A;  4Q36 A;  1V0C A;  4A4B A;  3RBU A;  1Y9K A;  2AFX A;  1CPX A;  1Z5R A;  3BLN A;  4FD5 A;  2Q7S A;  3PB7 X;  2D4O A;  3NH8 A;  4DUK A;  3K9U A;  4M3S A;  2Z3M A;  4CYQ A;  2RC4 A;  1WK4 A;  1Y7R A;  4LX9 A;  1Z9E A;  2EUI A;  1IYL A;  3D7F A;  3E0K A;  1S7F A;  2R82 A;  5LYI A;  2PR1 A;  4MCQ A;  4JZ0 A;  2CBL A;  4MFP A;  2MP0 A;  4M85 A;  2GU2 A;  5ELY A;  1KZF A;  3FED A;  4I49 A;  4P6Y A;  4R76 A;  2CNM A;  1IOF A;  4FWU A;  4JVO A;  4KVM E;  3R95 A;  3SJF A;  4NGQ A;  2PJA A;  2Z10 A;  5K8P A;  2B5G A;  4F9U A;  2E28 A;  4OP4 A;  1LAN A;  4QB9 A;  3JVN A;  4C99 A;  1WJT A;  1RXT A;  2FXF A;  4JXR A;  1NBW A;  1BOB A;  2PR8 A;  2AUN A;  2C6C A;  3D67 A;  2PC1 A;  4J3G A;  3V38 A;  1AMP A;  5BWA B;  1M4L A;  1L0C A;  2CTC A;  2WUU A;  3B35 A;  4OC5 A;  1IU8 A;  5E96 A;  1ON0 A;  2DPS A;  1OBR A;  1S5K A;  4OME A;  1Z8L A;  4QBJ A;  1VHS A;  4P4B A;  3SI1 A;  3VAR A;  3TYX A;  4M6I A;  2GP4 A;  4R6T A;  2QVP A;  1CS0 B;  4A32 A;  1YQE A;  2ZEO A;  2Z3P A;  4UFV A;  1CX8 A;  4NGT A;  3ISX A;  5KTA A;  3TTH A;  4GPL B;  3KI9 A;  3PB9 X;  2PVW A;  4YGO A;  4KSI A;  4COG A;  2B58 A;  2ATR A;  1XEB A;  1QQ9 A;  4GM5 A;  2ZW4 A;  3OWC A;  1VHO A;  1EO0 A;  1XMB A;  3FIX A;  5AG6 A;  4KS9 A;  1NMT A;  1ZL0 A;  1R3N A;  3BJ8 A;  4PK2 A;  2HC9 A;  4JJX A;  3PRT A;  4MBU A;  4MJ8 A;  3BJ7 A;  4NJR A;  2B4J C;  3R9F A;  4NSQ A;  4E2A A;  2CXA A;  2HI6 A;  3SHP A;  2B4D A;  2CY2 A;  2DPT A;  4K3N A;  2OU2 A;  4CGN A;  3EZA A;  4C8P A;  5C88 A;  1VBG A;  4MFL A;  1S7N A;  2A4N A;  3KGQ A;  4B11 A;  5ISV A;  2XEJ A;  2AFU A;  4UBR A;  1BPN A;  4P4J A;  1IOI A;  4WWV A;  4XPD B;  3KQZ A;  5DWM A;  2DLA A;  3S9M A;  1FY7 A;  3I3G A;  4ORF A;  4YN3 A;  4UIB A;  1B47 A;  2ZW5 A;  4YU9 A;  3C8O A;  1IIC A;  4CPA A;  1BO4 A;  2C6P A;  1RTQ A;  2WSA A;  3WC6 A;  3EO4 A;  4NGM A;  4U9Y A;  4RUH A;  1PYT B;  3DNS A;  5HVF A;  1VGY A;  4FUU A;  2PJ2 A;  3VWD A;  2VEZ A;  2REE A;  2O4H A;  2YND A;  3TO7 A;  5F9M A;  3ZNI A;  1KUX A;  3NFQ A;  1ARL A;  2FCK A;  2ZW7 A;  4FAI A;  1Q2Y A;  2RFH A;  1NE9 A;  3GY9 A;  3CDX A;  2NYQ A;  4Q7A A;  2B5G B;  3KR5 A;  4MFK A;  1Q5X A;  1Z4R A;  4XNH C;  5G21 A;  4XPK A;  5I0C A;  3DGV A;  2DXQ A;  5LYL A;  4P4I A;  4MCP A;  1UFH A;  2PRQ A;  2R7H A;  5K8O A;  4M6G A;  1ARM A;  3SR3 A;  3HLP A;  2ZW6 A;  2PJC A;  4B14 A;  3R9G A;  1CJW A;  1R57 A;  2PJ3 A;  5KTC A;  4CYP A;  3G23 A;  4X2T A;  3PT1 A;  3ISZ A;  3NH5 A;  3NH4 A;  3T0T A;  3PB4 X;  1V6C A;  3TFY A;  1Y9W A;  3DSB A;  4E8O A;  1YK3 A;  4EME A;  5AG4 A;  2PIY A;  5CNP A;  3ICU A;  3PP9 A;  5AG7 A;  4Z65 A;  1M4I A;  3FX6 A;  3IU2 A;  4EWT A;  5F46 A;  4KNG E;  3OB1 B;  1HEE A;  3O8Z A;  1CG2 A;  2XPP A;  1WWZ A;  2POK A;  3BUO B;  1XRY A;  3D66 A;  3OB2 B;  3FRM A;  3GLJ A;  4HPS A;  3T9Y A;  4CAX A;  1IYK A;  4L8A A;  5IB9 A;  4B13 A;  1I12 A;  3IWW A;  1EZA A;  3GUX A;  3B2Y A;  3CXQ A;  4A38 A;  2OOT A;  2BEI A;  4IK2 A;  3V8I A;  2XPL A;  5J1Q A;  1Z4E A;  2GRE A;  2HWG A;  2BUE A;  5EMI A;  4PSX A;  4CGL A;  4NGP A;  1VHE A;  2IQ6 A;  4L89 A;  3EZE A;  2WZN A;  3H8E A;  2CNT A;  4KUA A;  4KSA A;  2AJ6 A;  3CPA A;  3GB0 A;  4KOX A;  2PVV A;  1XJO A;  2HQY A;  2R8V A;  2Q51 A;  3EZB A;  1DTD A;  4X8I A;  2B4B A;  3W6X A;  5HXD A;  4AB7 A;  3IIB A;  3NA6 A;  2AFO A;  4MHY A;  2ABZ A;  4LUA A;  3PB6 X;  1KEE B;  3U88 C;  3B8G A;  3D4U A;  3EC4 A;  1QMU A;  2B3V A;  2IL4 A;  5EBV A;  4U5Y A;  4JD6 A;  2Y0M A;  1Y0R A;  4MHN A;  4LQG A;  1CPS A;  1QST A;  3KZW A;  3TCV A;  3TO6 A;  1C30 B;  2V8G A;  3VTA A;  3B3T A;  4IAV A;  4UA3 A;  1Z2L A;  4B12 A;  3TC8 A;  1LOK A;  1NSA A;  4XNH B;  3LOD A;  4ZX8 A;  4IIY A;  3SI2 A;  2PJ1 A;  2C1C A;  2AUM A;  3S9L A;  1VIX A;  5F48 A;  4A39 A;  4AG9 A;  2FL4 A;  4XPD C;  3H4Q A;  4F0X A;  4B5P A;  5JH9 A;  3GYA A;  3IU1 A;  4ZBG A;  2CNS A;  2GLJ A;  2V8V A;  3MN8 A;  1JDB C;  4C2X A;  2Y1N A;  3FB3 A;  3H8F A;  2XEF A;  1GYT A;  5JM6 A;  3BI1 A;  3WAB A;  4KOR A;  3DR8 A;  3TOA A;  4CAF A;  3LWU A;  1ZG7 A;  4MCS A;  1A2Z A;  1MK4 A;  4EVY A;  3S6K A;  1Q2D A;  1TF9 A;  4ZGY B;  3IEH A;  4UCN A;  5F49 A;  1IY7 A;  2PDO A;  2DIK A;  3KL9 A;  2Q4Y A;  4KOS A;  4CYO A;  2I00 A;  3VAT A;  3PBE A;  1IGB A;  3R1K A;  2OH1 A;  4IUS A;  3S6G A;  3TT2 A;  4ZY1 A;  3H8G A;  1MJB A;  1ZO0 A;  1FT7 A;  2Z3N A;  3S9N A;  4KZT A;  1DIK A;  1TF8 A;  4C9E A;  2Q7B A;  4C8A A;  3PLF B;  3IWG A;  5JQ4 A;  4BPU B;  2HRO A;  4CDJ A;  3BI0 A;  2VBQ A;  4PSW A;  3RNZ A;  1YME A;  1Y0Y A;  3C26 A;  3WC7 A;  4II9 A;  1Z8W A;  4NGR A;  5AG5 A;  1CP7 A;  5HKZ A;  1ELM P;  3FH4 A;  5LYD A;  3TX8 A;  4F0Y A;  5LYF A;  2VZZ A;  4ZX9 A;  3S6F A;  1ZRS A;  4J0N A;  3BUM B;  1R43 A;  2K5T A;  4MHZ A;  1DE4 C;  4AVC A;  3DLJ A;  4KUB A;  1BAV A;  1XOV A;  4A33 A;  4R7M A;  4W9Y A;  2F5I A;  1ZYM A;  4CZ1 A;  4BMH A;  2F7V A;  2P6F A;  3F5B A;  1I21 A;  4C8U A;  2EZC A;  4CO9 A;  1CBX A;  5HVH A;  5AGE A;  2JEW A;  1OZP A;  4OKO A;  4OAE A;  4MFQ A;  2Q0Y A;  5CPA A;  1M1D A;  4KSF A;  2OB0 A;  3K2K A;  4CDK A;  1PUA A;  4A31 A;  4A30 A;  4BPW B;  5HKW A;  4MMO A;  1LFW A;  1Y7E A;  4F6A A;  2XEI A;  3D7G A;  4P4D A;  3IO1 A;  5IV0 A;  1IID A;  3SJX A;  2PIZ A;  2G3T A;  2O53 A;  5LRG A;  4A94 A;  2O28 A;  3PGP A;  2BL1 A;  2ZEN A;  4R3K A;  3EXN A;  4KOU A;  4UWI A;  1X12 A;  3LD2 A;  4G1P A;  4ZY0 A;  3RYO A;  2QYV A;  2WYR A;  2YNE A;  1TIQ A;  1XFO A;  4C8F A;  1R61 A;  2J9A A;  3MRU A;  1XMT A;  1YLE A;  2P6G A;  2PJ8 A;  3HMJ G;  2Z11 A;  5G22 A;  1ZG8 A;  1SQH A;  2P6E A;  3T8W A;  4IIX A;  4C8T A;  1BLL E;  4OLL A;  2FE7 A;  3JRU A;  4RN7 A;  3B7I A;  3VRR A;  1S7L A;  1XF1 A;  2UV8 G;  4RR2 B;  2CF4 A;  2ZED A;  4OIW A;  3TLC A;  2KCW A;  2BOA A;  4JWP A;  4PPZ A;  3BXM A;  4JLY A;  4E5S A;  4QC6 A;  1H8L A;  4COB A;  3TLG A;  3N5F A;  3KKW A;  3QAY A;  1EE3 P;  2Z0Z A;  1YX0 A;  1J3L A;  3S6H A;  1HDQ A;  3FEC A;  1Q7L A;  2AFZ A;  2FIA A;  2OLS A;  2JEV A;  5F1Y A;  4OC0 A;  2VXK A;  2CTB A;  4CYN A; 
#chains in the Genus database with same CATH homology
 2EK9 A;  3PB8 X;  1YLO A;  3IJ3 A;  4DJL A;  1ZLH A;  3D7H A;  2BO9 A;  4ZI6 A;  4MHP A;  5CBM A;  2QJ8 A;  3V7Z A;  2V8H A;  3PFO A;  2ZEL A;  1FNO A;  3QNV A;  3CT9 A;  2ZOG A;  5D8N A;  2PJB A;  3I74 A;  2IMO A;  4X3R A;  4DYO A;  1XBU A;  2FVG A;  2ZEE A;  5K8M A;  3SJE A;  4OC3 A;  4P44 A;  1KWM A;  3B3V A;  4UIA A;  4C84 A;  2AFS A;  2AFM A;  4EFD A;  2HB6 A;  1HDU A;  4ONW A;  4PXD A;  3FEE A;  3KR4 A;  5F09 A;  4OC1 A;  3KQX A;  1AYE A;  4C9A A;  2JBJ A;  1LCP A;  2ANP A;  1F2O A;  4UEF A;  2PJ4 A;  1Y9Z A;  2PCU A;  4PXC A;  3B3C A;  3I1U A;  3KHZ A;  1YW4 A;  4C85 A;  2AFW A;  4PQA A;  4TWE A;  4MCR A;  3LMS A;  4TJV A;  2V8D A;  3RAM A;  7CPA A;  4P4F A;  2PE3 A;  4P10 A;  5HVG A;  2VL1 A;  2ZEM A;  4R8F A;  2IJZ A;  3KAS A;  4C9R A;  1TKH A;  3D7D A;  1LAP A;  4OID A;  3FVL A;  4NJQ A;  4JYW A;  3PBB A;  1TKJ A;  2F8H A;  3PEI A;  4C8C A;  2EK8 A;  5LRJ A;  4OC4 A;  5THW A;  3NFZ A;  4ZY2 A;  1PCA A;  2PJ7 A;  3RZA A;  4P4E A;  1LAM A;  4H2K A;  1ZG9 A;  5LRK A;  4C9U A;  3BHX A;  5D29 A;  1F57 A;  3I6S A;  2ZEG A;  2PJ9 A;  2Q4Z A;  4TNU A;  5DS0 A;  3KHX A;  3FJU A;  4PXB A;  3B3W A;  4C86 A;  6CPA A;  4NGS A;  2ZEH A;  4WJB A;  4UEZ A;  5K8N A;  5IR2 A;  4AXV A;  3L2N A;  2GLF A;  4P45 A;  4IHM A;  2DEA A;  3PFE A;  2OR4 A;  3SJG A;  2CIJ A;  4ZYQ A;  2C5Q A;  2Q43 A;  2ZEP A;  1BPM A;  4BD9 A;  4OC2 A;  5JGF A;  8CPA A;  4A37 A;  1CP6 A;  1TXR A;  2RB7 A;  4NFR A;  3CPX A;  3FMC A;  2C6G A;  4PXE A;  3D68 A;  3FF3 A;  3SI0 A;  3B3S A;  1ZLI A;  2ZEF A;  1WVM A;  2G9D A;  1YSJ A;  3IC1 A;  2V77 A;  4C9V A;  4FBE A;  3HUV A;  4MXU A;  4O23 A;  1ELL P;  1UWY A;  2NSM A;  2EWB A;  3K9T A;  1TKF A;  2I3C A;  3WC5 A;  4MRI A;  2PJ6 A;  2PJ0 A;  2XEG A;  4UF4 A;  3VH9 A;  1YW6 A;  3EIF A;  4B6Z A;  4F8Z A;  4F9V A;  4TJX A;  3IFE A;  2ZOF A;  4YWY A;  1F2P A;  2JBK A;  2BCO A;  4UEE A;  1JQG A;  2PJ5 A;  5I4M A;  3WT4 A;  4NGN A;  3RBU A;  2AFX A;  1CPX A;  1Z5R A;  4DUK A;  3PB7 X;  3NH8 A;  3D7F A;  5LYI A;  4MCQ A;  4JZ0 A;  2GU2 A;  5ELY A;  3FED A;  4R76 A;  4P6Y A;  4FWU A;  3SJF A;  4NGQ A;  2PJA A;  5K8P A;  4F9U A;  4OP4 A;  1LAN A;  4C99 A;  2C6C A;  3D67 A;  3V38 A;  1AMP A;  1M4L A;  2CTC A;  3B35 A;  4OC5 A;  1OBR A;  4OME A;  1Z8L A;  4P4B A;  3SI1 A;  3VAR A;  2GP4 A;  4R6T A;  2QVP A;  2ZEO A;  1CX8 A;  4NGT A;  3ISX A;  3KI9 A;  3PB9 X;  2PVW A;  4KSI A;  1QQ9 A;  4GM5 A;  1VHO A;  1XMB A;  1R3N A;  2HC9 A;  3PRT A;  4NJR A;  4K3N A;  4C8P A;  3KGQ A;  2XEJ A;  2AFU A;  4WWV A;  1BPN A;  4P4J A;  3KQZ A;  3S9M A;  4YN3 A;  4UIB A;  4YU9 A;  4CPA A;  1RTQ A;  2C6P A;  3WC6 A;  4NGM A;  4RUH A;  1PYT B;  5HVF A;  1VGY A;  4FUU A;  2PJ2 A;  2O4H A;  4FAI A;  1ARL A;  5K8O A;  2RFH A;  3CDX A;  2NYQ A;  4Q7A A;  3KR5 A;  3DGV A;  5LYL A;  4P4I A;  4MCP A;  2PRQ A;  1ARM A;  3HLP A;  2PJC A;  2PJ3 A;  4X2T A;  3ISZ A;  3NH5 A;  3NH4 A;  3PB4 X;  1V6C A;  3ICU A;  4EME A;  2PIY A;  4Z65 A;  3FX6 A;  4EWT A;  4KNG E;  1HEE A;  2POK A;  1CG2 A;  3GLJ A;  4C8U A;  1XRY A;  3D66 A;  5IB9 A;  3IWW A;  3GUX A;  3B2Y A;  4A38 A;  2OOT A;  4IK2 A;  5J1Q A;  2GRE A;  4NGP A;  1VHE A;  2IQ6 A;  2WZN A;  3H8E A;  3CPA A;  3GB0 A;  2PVV A;  1XJO A;  2Q51 A;  1DTD A;  4X8I A;  5HXD A;  3IIB A;  3NA6 A;  2AFO A;  4MHY A;  2ABZ A;  3PB6 X;  3D4U A;  1QMU A;  1Y0R A;  4MHN A;  4LQG A;  1CPS A;  3KZW A;  2V8G A;  3VTA A;  3B3T A;  4IAV A;  1Z2L A;  3TC8 A;  1LOK A;  1NSA A;  4ZX8 A;  3SI2 A;  2PJ1 A;  2C1C A;  3S9L A;  1VIX A;  4A39 A;  5JH9 A;  2GLJ A;  2V8V A;  3MN8 A;  3H8F A;  2XEF A;  1GYT A;  5JM6 A;  3BI1 A;  3WAB A;  3LWU A;  1ZG7 A;  4MCS A;  1TF9 A;  3IEH A;  1IY7 A;  3KL9 A;  3VAT A;  3PBE A;  1IGB A;  4ZY1 A;  3H8G A;  4C9E A;  1FT7 A;  3S9N A;  4C8A A;  1TF8 A;  4CDJ A;  3BI0 A;  1YME A;  1Y0Y A;  3WC7 A;  4NGR A;  1CP7 A;  5LYD A;  1ELM P;  3FH4 A;  3TX8 A;  5LYF A;  4ZX9 A;  1R43 A;  4MHZ A;  1DE4 C;  3DLJ A;  1BAV A;  4R7M A;  4W9Y A;  2F7V A;  1CBX A;  5HVH A;  5CPA A;  2JEW A;  4OKO A;  4CDK A;  3K2K A;  4MMO A;  1LFW A;  1Y7E A;  2XEI A;  3D7G A;  4P4D A;  3IO1 A;  3SJX A;  2PIZ A;  2O53 A;  5LRG A;  4A94 A;  2ZEN A;  4ZY0 A;  4G1P A;  2QYV A;  2WYR A;  1XFO A;  4C8F A;  2J9A A;  3MRU A;  2PJ8 A;  1ZG8 A;  3T8W A;  4C8T A;  1BLL E;  3JRU A;  3B7I A;  1XF1 A;  2CF4 A;  2ZED A;  4OIW A;  2BOA A;  4PPZ A;  3BXM A;  1H8L A;  3N5F A;  1EE3 P;  1HDQ A;  3FEC A;  1Q7L A;  2AFZ A;  4OC0 A;  2CTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...