3SJLC

Crystal structure of the p107s-maug/pre-methylamine dehydrogenase complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
130
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein mauG
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 34
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3sjlC00
3PXSC 2HJBD 3RN1C 2HKMD 3SLEC 1MG2B 3PXTC 3L4OC 4Y5RC 3C75L 4FA1C 2J57K 3L4MC 2OJYD 3RMZC 4L1QC 2AH0D 2GC7B 3RLMC 4L3HC 2AGLD 2I0TD 2IUQD 4FA5C 2AGXD 4FA9C 4K3IC 4FA4C 2AH1D 2H3XB 2GC4B 2HJ4D 2HXCD 2J56L 2IURD 2AGZD 1MG3B 1MDAL 2MTAL 3PXWC 2OK6D 4O1QC 4FB1C 2MADL 1MAEL 2IUVD 2HKRD 3ORVC 4FAVC 2AGYD 2H47B 2IAAB 2J55L 2BBKL 2AGWD 2I0RD 2I0SD 2OK4D 2Q7QD 3SVWC 2OIZD 4FANC 4L3GC 3SXTC 1MAFL 3RN0C 3SWSC 2IUPD 3SJLC
chains in the Genus database with same CATH superfamily
3PXSC 2HJBD 3RN1C 2HKMD 3SLEC 1MG2B 3PXTC 3L4OC 4Y5RC 3C75L 4FA1C 2J57K 3L4MC 2OJYD 3RMZC 4L1QC 2AH0D 2GC7B 3RLMC 4L3HC 2AGLD 2I0TD 2IUQD 4FA5C 2AGXD 4FA9C 4K3IC 4FA4C 2AH1D 2H3XB 2GC4B 2HJ4D 2HXCD 2J56L 2IURD 2AGZD 1MG3B 1MDAL 2MTAL 3PXWC 2OK6D 4O1QC 4FB1C 2MADL 1MAEL 2IUVD 2HKRD 3ORVC 4FAVC 2AGYD 2H47B 2IAAB 2J55L 2BBKL 2AGWD 2I0RD 2I0SD 2OK4D 2Q7QD 3SVWC 2OIZD 4FANC 4L3GC 3SXTC 1MAFL 3RN0C 3SWSC 2IUPD 3SJLC
chains in the Genus database with same CATH topology
3PXSC 2HJBD 3RN1C 2HKMD 3SLEC 1MG2B 3PXTC 3L4OC 4Y5RC 3C75L 4FA1C 2J57K 3L4MC 2OJYD 3RMZC 4L1QC 2AH0D 2GC7B 3RLMC 4L3HC 2AGLD 2I0TD 2IUQD 4FA5C 2AGXD 4FA9C 4K3IC 4FA4C 2AH1D 2H3XB 2GC4B 2HJ4D 2HXCD 2J56L 2IURD 2AGZD 1MG3B 1MDAL 2MTAL 3PXWC 2OK6D 4O1QC 4FB1C 2MADL 1MAEL 2IUVD 2HKRD 3ORVC 4FAVC 2AGYD 2H47B 2IAAB 2J55L 2BBKL 2AGWD 2I0RD 2I0SD 2OK4D 2Q7QD 3SVWC 2OIZD 4FANC 4L3GC 3SXTC 1MAFL 3RN0C 3SWSC 2IUPD 3SJLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXS C;  2HJB D;  3RN1 C;  2HKM D;  3SLE C;  1MG2 B;  3PXT C;  3L4O C;  4Y5R C;  3C75 L;  4FA1 C;  2J57 K;  3L4M C;  2OJY D;  3RMZ C;  4L1Q C;  2AH0 D;  2GC7 B;  3RLM C;  4L3H C;  2AGL D;  2I0T D;  2IUQ D;  4FA5 C;  2AGX D;  4FA9 C;  4K3I C;  4FA4 C;  2AH1 D;  2H3X B;  2GC4 B;  2HJ4 D;  2HXC D;  2J56 L;  2IUR D;  2AGZ D;  1MG3 B;  1MDA L;  2MTA L;  3PXW C;  2OK6 D;  4O1Q C;  4FB1 C;  2MAD L;  1MAE L;  2IUV D;  2HKR D;  3ORV C;  4FAV C;  2AGY D;  2H47 B;  2IAA B;  2J55 L;  2BBK L;  2AGW D;  2I0R D;  2I0S D;  2OK4 D;  2Q7Q D;  3SVW C;  2OIZ D;  4FAN C;  4L3G C;  3SXT C;  1MAF L;  3RN0 C;  3SWS C;  2IUP D;  3SJL C; 
#chains in the Genus database with same CATH topology
 3PXS C;  2HJB D;  3RN1 C;  2HKM D;  3SLE C;  1MG2 B;  3PXT C;  3L4O C;  4Y5R C;  3C75 L;  4FA1 C;  2J57 K;  3L4M C;  2OJY D;  3RMZ C;  4L1Q C;  2AH0 D;  2GC7 B;  3RLM C;  4L3H C;  2AGL D;  2I0T D;  2IUQ D;  4FA5 C;  2AGX D;  4FA9 C;  4K3I C;  4FA4 C;  2AH1 D;  2H3X B;  2GC4 B;  2HJ4 D;  2HXC D;  2J56 L;  2IUR D;  2AGZ D;  1MG3 B;  1MDA L;  2MTA L;  3PXW C;  2OK6 D;  4O1Q C;  4FB1 C;  2MAD L;  1MAE L;  2IUV D;  2HKR D;  3ORV C;  4FAV C;  2AGY D;  2H47 B;  2IAA B;  2J55 L;  2BBK L;  2AGW D;  2I0R D;  2I0S D;  2OK4 D;  2Q7Q D;  3SVW C;  2OIZ D;  4FAN C;  4L3G C;  3SXT C;  1MAF L;  3RN0 C;  3SWS C;  2IUP D;  3SJL C; 
#chains in the Genus database with same CATH homology
 3PXS C;  2HJB D;  3RN1 C;  2HKM D;  3SLE C;  1MG2 B;  3PXT C;  3L4O C;  4Y5R C;  3C75 L;  4FA1 C;  2J57 K;  3L4M C;  2OJY D;  3RMZ C;  4L1Q C;  2AH0 D;  2GC7 B;  3RLM C;  4L3H C;  2AGL D;  2I0T D;  2IUQ D;  4FA5 C;  2AGX D;  4FA9 C;  4K3I C;  4FA4 C;  2AH1 D;  2H3X B;  2GC4 B;  2HJ4 D;  2HXC D;  2J56 L;  2IUR D;  2AGZ D;  1MG3 B;  1MDA L;  2MTA L;  3PXW C;  2OK6 D;  4O1Q C;  4FB1 C;  2MAD L;  1MAE L;  2IUV D;  2HKR D;  3ORV C;  4FAV C;  2AGY D;  2H47 B;  2IAA B;  2J55 L;  2BBK L;  2AGW D;  2I0R D;  2I0S D;  2OK4 D;  2Q7Q D;  3SVW C;  2OIZ D;  4FAN C;  4L3G C;  3SXT C;  1MAF L;  3RN0 C;  3SWS C;  2IUP D;  3SJL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...