3SJLC

Crystal structure of the p107s-maug/pre-methylamine dehydrogenase complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
130
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein mauG
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 34
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3sjlC00
2IUVD 4L3HC 4FA5C 3PXTC 4FANC 2H3XB 4FA4C 1MAEL 4Y5RC 3RN1C 2AGXD 2I0RD 2OIZD 3C75L 3RLMC 2AH1D 3RMZC 3SJLC 2IUPD 2HXCD 2J55L 4FB1C 2HJ4D 2I0SD 2J56L 4FA9C 2AGWD 4L3GC 1MAFL 2Q7QD 3SXTC 2H47B 2GC4B 2OK4D 2AGZD 2AH0D 1MG2B 2GC7B 2AGLD 2IURD 4K3IC 4O1QC 3PXSC 2HJBD 3SVWC 2HKMD 2OJYD 3L4MC 3PXWC 3SWSC 3SLEC 2IAAB 4FAVC 2I0TD 3RN0C 1MDAL 2MTAL 4FA1C 2IUQD 2MADL 1MG3B 2HKRD 2J57K 2BBKL 3ORVC 4L1QC 3L4OC 2OK6D 2AGYD
chains in the Genus database with same CATH superfamily
2IUVD 4L3HC 4FA5C 3PXTC 4FANC 2H3XB 4FA4C 1MAEL 4Y5RC 3RN1C 2AGXD 2I0RD 2OIZD 3C75L 3RLMC 2AH1D 3RMZC 3SJLC 2IUPD 2HXCD 2J55L 4FB1C 2HJ4D 2I0SD 2J56L 4FA9C 2AGWD 4L3GC 1MAFL 2Q7QD 3SXTC 2H47B 2GC4B 2OK4D 2AGZD 2AH0D 1MG2B 2GC7B 2AGLD 2IURD 4K3IC 4O1QC 3PXSC 2HJBD 3SVWC 2HKMD 2OJYD 3L4MC 3PXWC 3SWSC 3SLEC 2IAAB 4FAVC 2I0TD 3RN0C 1MDAL 2MTAL 4FA1C 2IUQD 2MADL 1MG3B 2HKRD 2J57K 2BBKL 3ORVC 4L1QC 3L4OC 2OK6D 2AGYD
chains in the Genus database with same CATH topology
2IUVD 4L3HC 4FA5C 3PXTC 4FANC 2H3XB 4FA4C 1MAEL 4Y5RC 3RN1C 2AGXD 2I0RD 2OIZD 3C75L 3RLMC 2AH1D 3RMZC 3SJLC 2IUPD 2HXCD 2J55L 4FB1C 2HJ4D 2I0SD 2J56L 4FA9C 2AGWD 4L3GC 1MAFL 2Q7QD 3SXTC 2H47B 2GC4B 2OK4D 2AGZD 2AH0D 1MG2B 2GC7B 2AGLD 2IURD 4K3IC 4O1QC 3PXSC 2HJBD 3SVWC 2HKMD 2OJYD 3L4MC 3PXWC 3SWSC 3SLEC 2IAAB 4FAVC 2I0TD 3RN0C 1MDAL 2MTAL 4FA1C 2IUQD 2MADL 1MG3B 2HKRD 2J57K 2BBKL 3ORVC 4L1QC 3L4OC 2OK6D 2AGYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUV D;  4L3H C;  4FA5 C;  3PXT C;  4FAN C;  2H3X B;  4FA4 C;  1MAE L;  4Y5R C;  3RN1 C;  2AGX D;  2I0R D;  2OIZ D;  3C75 L;  3RLM C;  2AH1 D;  3RMZ C;  3SJL C;  2IUP D;  2HXC D;  2J55 L;  4FB1 C;  2HJ4 D;  2I0S D;  2J56 L;  4FA9 C;  2AGW D;  4L3G C;  1MAF L;  2Q7Q D;  3SXT C;  2H47 B;  2GC4 B;  2OK4 D;  2AGZ D;  2AH0 D;  1MG2 B;  2GC7 B;  2AGL D;  2IUR D;  4K3I C;  4O1Q C;  3PXS C;  2HJB D;  3SVW C;  2HKM D;  2OJY D;  3L4M C;  3PXW C;  3SWS C;  3SLE C;  2IAA B;  4FAV C;  2I0T D;  3RN0 C;  1MDA L;  2MTA L;  4FA1 C;  2IUQ D;  2MAD L;  1MG3 B;  2HKR D;  2J57 K;  2BBK L;  3ORV C;  4L1Q C;  3L4O C;  2OK6 D;  2AGY D; 
#chains in the Genus database with same CATH topology
 2IUV D;  4L3H C;  4FA5 C;  3PXT C;  4FAN C;  2H3X B;  4FA4 C;  1MAE L;  4Y5R C;  3RN1 C;  2AGX D;  2I0R D;  2OIZ D;  3C75 L;  3RLM C;  2AH1 D;  3RMZ C;  3SJL C;  2IUP D;  2HXC D;  2J55 L;  4FB1 C;  2HJ4 D;  2I0S D;  2J56 L;  4FA9 C;  2AGW D;  4L3G C;  1MAF L;  2Q7Q D;  3SXT C;  2H47 B;  2GC4 B;  2OK4 D;  2AGZ D;  2AH0 D;  1MG2 B;  2GC7 B;  2AGL D;  2IUR D;  4K3I C;  4O1Q C;  3PXS C;  2HJB D;  3SVW C;  2HKM D;  2OJY D;  3L4M C;  3PXW C;  3SWS C;  3SLE C;  2IAA B;  4FAV C;  2I0T D;  3RN0 C;  1MDA L;  2MTA L;  4FA1 C;  2IUQ D;  2MAD L;  1MG3 B;  2HKR D;  2J57 K;  2BBK L;  3ORV C;  4L1Q C;  3L4O C;  2OK6 D;  2AGY D; 
#chains in the Genus database with same CATH homology
 2IUV D;  4L3H C;  4FA5 C;  3PXT C;  4FAN C;  2H3X B;  4FA4 C;  1MAE L;  4Y5R C;  3RN1 C;  2AGX D;  2I0R D;  2OIZ D;  3C75 L;  3RLM C;  2AH1 D;  3RMZ C;  3SJL C;  2IUP D;  2HXC D;  2J55 L;  4FB1 C;  2HJ4 D;  2I0S D;  2J56 L;  4FA9 C;  2AGW D;  4L3G C;  1MAF L;  2Q7Q D;  3SXT C;  2H47 B;  2GC4 B;  2OK4 D;  2AGZ D;  2AH0 D;  1MG2 B;  2GC7 B;  2AGL D;  2IUR D;  4K3I C;  4O1Q C;  3PXS C;  2HJB D;  3SVW C;  2HKM D;  2OJY D;  3L4M C;  3PXW C;  3SWS C;  3SLE C;  2IAA B;  4FAV C;  2I0T D;  3RN0 C;  1MDA L;  2MTA L;  4FA1 C;  2IUQ D;  2MAD L;  1MG3 B;  2HKR D;  2J57 K;  2BBK L;  3ORV C;  4L1Q C;  3L4O C;  2OK6 D;  2AGY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...