3SJLC

Crystal structure of the p107s-maug/pre-methylamine dehydrogenase complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
130
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein mauG
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 34
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3sjlC00
3SWSC 2GC7B 1MAEL 2H47B 4L1QC 2MADL 2BBKL 4O1QC 4Y5RC 2J56L 3PXWC 2HKMD 4FA5C 2IAAB 2OJYD 2I0RD 3RN0C 2OK6D 3SXTC 4L3GC 2AGWD 2AGYD 2J57K 3PXSC 2HKRD 2HXCD 4FAVC 2OK4D 2IURD 4L3HC 2HJ4D 2AGXD 2AGZD 2GC4B 3L4OC 3RMZC 1MG3B 2I0TD 2IUQD 2IUVD 2AH1D 2I0SD 2AGLD 3PXTC 1MG2B 4FA1C 2IUPD 2OIZD 1MAFL 3L4MC 3ORVC 4FANC 4FA9C 2MTAL 2H3XB 2Q7QD 3SVWC 4K3IC 3RN1C 3C75L 4FA4C 2J55L 3RLMC 1MDAL 3SJLC 4FB1C 2AH0D 2HJBD 3SLEC
chains in the Genus database with same CATH superfamily
3SWSC 2GC7B 1MAEL 2H47B 4L1QC 2MADL 2BBKL 4O1QC 4Y5RC 2J56L 3PXWC 2HKMD 4FA5C 2IAAB 2OJYD 2I0RD 3RN0C 2OK6D 3SXTC 4L3GC 2AGWD 2AGYD 2J57K 3PXSC 2HKRD 2HXCD 4FAVC 2OK4D 2IURD 4L3HC 2HJ4D 2AGXD 2AGZD 2GC4B 3L4OC 3RMZC 1MG3B 2I0TD 2IUQD 2IUVD 2AH1D 2I0SD 2AGLD 3PXTC 1MG2B 4FA1C 2IUPD 2OIZD 1MAFL 3L4MC 3ORVC 4FANC 4FA9C 2MTAL 2H3XB 2Q7QD 3SVWC 4K3IC 3RN1C 3C75L 4FA4C 2J55L 3RLMC 1MDAL 3SJLC 4FB1C 2AH0D 2HJBD 3SLEC
chains in the Genus database with same CATH topology
3SWSC 2GC7B 1MAEL 2H47B 4L1QC 2MADL 2BBKL 4O1QC 4Y5RC 2J56L 3PXWC 2HKMD 4FA5C 2IAAB 2OJYD 2I0RD 3RN0C 2OK6D 3SXTC 4L3GC 2AGWD 2AGYD 2J57K 3PXSC 2HKRD 2HXCD 4FAVC 2OK4D 2IURD 4L3HC 2HJ4D 2AGXD 2AGZD 2GC4B 3L4OC 3RMZC 1MG3B 2I0TD 2IUQD 2IUVD 2AH1D 2I0SD 2AGLD 3PXTC 1MG2B 4FA1C 2IUPD 2OIZD 1MAFL 3L4MC 3ORVC 4FANC 4FA9C 2MTAL 2H3XB 2Q7QD 3SVWC 4K3IC 3RN1C 3C75L 4FA4C 2J55L 3RLMC 1MDAL 3SJLC 4FB1C 2AH0D 2HJBD 3SLEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWS C;  2GC7 B;  1MAE L;  2H47 B;  4L1Q C;  2MAD L;  2BBK L;  4O1Q C;  4Y5R C;  2J56 L;  3PXW C;  2HKM D;  4FA5 C;  2IAA B;  2OJY D;  2I0R D;  3RN0 C;  2OK6 D;  3SXT C;  4L3G C;  2AGW D;  2AGY D;  2J57 K;  3PXS C;  2HKR D;  2HXC D;  4FAV C;  2OK4 D;  2IUR D;  4L3H C;  2HJ4 D;  2AGX D;  2AGZ D;  2GC4 B;  3L4O C;  3RMZ C;  1MG3 B;  2I0T D;  2IUQ D;  2IUV D;  2AH1 D;  2I0S D;  2AGL D;  3PXT C;  1MG2 B;  4FA1 C;  2IUP D;  2OIZ D;  1MAF L;  3L4M C;  3ORV C;  4FAN C;  4FA9 C;  2MTA L;  2H3X B;  2Q7Q D;  3SVW C;  4K3I C;  3RN1 C;  3C75 L;  4FA4 C;  2J55 L;  3RLM C;  1MDA L;  3SJL C;  4FB1 C;  2AH0 D;  2HJB D;  3SLE C; 
#chains in the Genus database with same CATH topology
 3SWS C;  2GC7 B;  1MAE L;  2H47 B;  4L1Q C;  2MAD L;  2BBK L;  4O1Q C;  4Y5R C;  2J56 L;  3PXW C;  2HKM D;  4FA5 C;  2IAA B;  2OJY D;  2I0R D;  3RN0 C;  2OK6 D;  3SXT C;  4L3G C;  2AGW D;  2AGY D;  2J57 K;  3PXS C;  2HKR D;  2HXC D;  4FAV C;  2OK4 D;  2IUR D;  4L3H C;  2HJ4 D;  2AGX D;  2AGZ D;  2GC4 B;  3L4O C;  3RMZ C;  1MG3 B;  2I0T D;  2IUQ D;  2IUV D;  2AH1 D;  2I0S D;  2AGL D;  3PXT C;  1MG2 B;  4FA1 C;  2IUP D;  2OIZ D;  1MAF L;  3L4M C;  3ORV C;  4FAN C;  4FA9 C;  2MTA L;  2H3X B;  2Q7Q D;  3SVW C;  4K3I C;  3RN1 C;  3C75 L;  4FA4 C;  2J55 L;  3RLM C;  1MDA L;  3SJL C;  4FB1 C;  2AH0 D;  2HJB D;  3SLE C; 
#chains in the Genus database with same CATH homology
 3SWS C;  2GC7 B;  1MAE L;  2H47 B;  4L1Q C;  2MAD L;  2BBK L;  4O1Q C;  4Y5R C;  2J56 L;  3PXW C;  2HKM D;  4FA5 C;  2IAA B;  2OJY D;  2I0R D;  3RN0 C;  2OK6 D;  3SXT C;  4L3G C;  2AGW D;  2AGY D;  2J57 K;  3PXS C;  2HKR D;  2HXC D;  4FAV C;  2OK4 D;  2IUR D;  4L3H C;  2HJ4 D;  2AGX D;  2AGZ D;  2GC4 B;  3L4O C;  3RMZ C;  1MG3 B;  2I0T D;  2IUQ D;  2IUV D;  2AH1 D;  2I0S D;  2AGL D;  3PXT C;  1MG2 B;  4FA1 C;  2IUP D;  2OIZ D;  1MAF L;  3L4M C;  3ORV C;  4FAN C;  4FA9 C;  2MTA L;  2H3X B;  2Q7Q D;  3SVW C;  4K3I C;  3RN1 C;  3C75 L;  4FA4 C;  2J55 L;  3RLM C;  1MDA L;  3SJL C;  4FB1 C;  2AH0 D;  2HJB D;  3SLE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...