3SJTA

Crystal structure of human arginase i in complex with the inhibitor me-abh, resolution 1.60 a, twinned structure
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
313
structure length
313
Chain Sequence
b'RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Binding of alpha,alpha-Disubstituted Amino Acids to Arginase Suggests New Avenues for Inhibitor Design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 114
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 3sjtA00
4HWWA 1WOGA 5RLAA 3THJA 1D3VA 4IU1A 1T5FA 1T4PA 4Q3PA 4Q3VA 1P8PA 1ZPGA 4Q3RA 3F80A 4GWDA 4IU0A 3THEA 3SL1A 2EF5A 5HJAA 3TH7A 4Q3SA 1P8SA 4IU5A 3GN0A 1TBHA 3SJTA 2ZAVA 3E9BA 3PZLA 3NIQA 4RHJA 4GSVA 4GWCA 2PLLA 3RLAA 1P8OA 3CEVA 1R1OA 4RLAA 4RHIA 1P8NA 1PQ3A 2EF4A 3TF3A 4HXQA 1GQ7A 4Q42A 2PHAA 4FCIA 4Q41A 1WOHA 4ITYA 3MFVA 1CEVA 4Q40A 1P8RA 1T4TA 4IE2A 1ZPEA 4IXVA 4G3HA 1RLAA 1HQFA 2PHOA 3M1RA 4MYNA 3SL0A 3THHA 1WVBA 4CEVA 4Q3TA 4I06A 4DZ4A 4MXRA 4HZEA 4GSMA 4FCKA 2AEBA 4MYFA 1GQ6A 3MMRA 1T4SA 1HQ5A 1WVAA 3E6VA 4GSZA 4RHLA 3E8QA 1T5GA 1T4RA 1P8QA 4RHKA 3LP4A 3MFWA 4IE3A 4RHQA 1P8MA 3DJ8A 2EIVA 2RLAA 4IXUA 1TBLA 3E8ZA 3MJLA 4IE1A 3SKKA 4MYKA 5CEVA 1TBJA 1HQXA 1HQHA 5HJ9A 3NIPA 1HQGA 3GMZA 4Q3UA 1TA1A 2CEVA 4MYLA 3LHLA 2A0MA 4RHMA 3LP7A 4IU4A 4Q3RC 3KV2A 3NIOA 1WOIA 3E6KA 4Q3QA 1XFKA
chains in the Genus database with same CATH superfamily
4HWWA 5BWZA 5D1DA 1WOGA 4QA5A 5EF8A 5RLAA 3THJA 3Q9EA 4ZUOA 1D3VA 4ZUNA 4IU1A 1T5FA 3MZ3A 5G0YA 3ZNRA 1T4PA 3MZ7A 3C10A 5THTA 5ICNB 4Q3PA 4CBTA 4Q3VA 1P8PA 3MENA 4BZ5A 5EEKA 4QA2A 4CBYA 1ZPGA 4Q3RA 3F80A 4RN2A 4GWDA 4A69A 4IU0A 3THEA 3SL1A 4BZ9A 2EF5A 4QA7A 4QA4A 5HJAA 4ZUMA 3TH7A 4Q3SA 2V5WA 5G10A 1P8SA 4CQFA 4IU5A 3GN0A 1TBHA 3MZ6A 3SJTA 5LI3A 2ZAVA 3E9BA 3SFHA 3PZLA 3NIQA 4RHJA 5FCWA 4GSVA 5A2SA 4GWCA 2PLLA 4BKXB 3Q9CA 4RN0A 5EEIA 4RN1A 1ZZ1A 5DC5A 2VQWG 5G17A 3RLAA 5EENA 1P8OA 5G12A 3CEVA 1R1OA 4RLAA 5G13A 4RHIA 1C3RA 1P8NA 1PQ3A 2EF4A 5DC8A 3SFFA 3C0ZA 3TF3A 5FUEA 4HXQA 1GQ7A 5EFNA 2GH6A 3EWFA 3C0YA 4Q42A 5EFHA 5G11A 2PHAA 4BZ8A 4FCIA 5DC7A 1T64A 1ZZ3A 4Q41A 1WOHA 4ITYA 5DC6A 3MAXA 5G1CA 1CEVA 3MFVA 5EFBD 5EEFA 4Q40A 1P8RA 3EZTA 1T4TA 4LXZA 3Q9FA 4IE2A 1ZPEA 4IXVA 4G3HA 1RLAA 3RQDA 1HQFA 4QA0A 1W22A 2PHOA 5G0HA 5G0JA 3M1RA 4MYNA 3SL0A 3THHA 5EF7A 5EFKB 3ZNSA 1T67A 5G1AA 4BZ6A 1C3SA 1T69A 1WVBA 2VQJA 3EZPA 4ZURA 4Q3TA 4CEVA 4I06A 5G0XA 4DZ4A 4MXRA 4QA3A 3Q9BA 1C3PA 3F06A 4HZEA 5JI5A 4ZUPA 4GSMA 5G1BA 5G0IA 4FCKA 2AEBA 4MYFA 4QA6A 1GQ6A 3MMRA 1T4SA 1HQ5A 1WVAA 2VQMA 3E6VA 4QA1A 5IX0A 4GSZA 4RHLA 3E8QA 1T5GA 1T4RA 1P8QA 3MZ4A 4RHKA 3LP4A 5EEMA 5G0GA 5THVA 3MFWA 4BZ7A 4IE3A 4RHQA 1P8MA 3DJ8A 5D1CA 3EW8A 2VQOA 4ZUQA 2EIVA 5IWGA 2RLAA 4IXUA 1TBLA 3E8ZA 3F07A 3MJLA 4IE1A 5EFJD 2VCGA 3F0RA 3SKKA 4MYKA 5CEVA 1TBJA 4LY1A 1HQXA 1HQHA 2VQVA 5G3WA 5D1BA 5HJ9A 3NIPA 1HQGA 3GMZA 5THSA 4Q3UA 1TA1A 2CEVA 4MYLA 3LHLA 2A0MA 1ZZ0A 5EFGA 4RHMA 5THUA 3LP7A 4IU4A 2V5XA 4Q3RC 3KV2A 3NIOA 1VKGA 2VQQA 1WOIA 3E6KA 4Q3QA 1XFKA
chains in the Genus database with same CATH topology
4HWWA 1WOGA 5RLAA 3THJA 1D3VA 4IU1A 1T5FA 1T4PA 4Q3PA 4Q3VA 1P8PA 1ZPGA 4Q3RA 3F80A 4GWDA 4IU0A 3THEA 3SL1A 2EF5A 5HJAA 3TH7A 4Q3SA 1P8SA 4IU5A 3GN0A 1TBHA 3SJTA 2ZAVA 3E9BA 3PZLA 3NIQA 4RHJA 4GSVA 4GWCA 2PLLA 3RLAA 1P8OA 3CEVA 1R1OA 4RLAA 4RHIA 1P8NA 1PQ3A 2EF4A 3TF3A 4HXQA 1GQ7A 4Q42A 2PHAA 4FCIA 4Q41A 1WOHA 4ITYA 3MFVA 1CEVA 4Q40A 1P8RA 1T4TA 4IE2A 1ZPEA 4IXVA 4G3HA 1RLAA 1HQFA 2PHOA 3M1RA 4MYNA 3SL0A 3THHA 1WVBA 4CEVA 4Q3TA 4I06A 4DZ4A 4MXRA 4HZEA 4GSMA 4FCKA 2AEBA 4MYFA 1GQ6A 3MMRA 1T4SA 1HQ5A 1WVAA 3E6VA 4GSZA 4RHLA 3E8QA 1T5GA 1T4RA 1P8QA 4RHKA 3LP4A 3MFWA 4IE3A 4RHQA 1P8MA 3DJ8A 2EIVA 2RLAA 4IXUA 1TBLA 3E8ZA 3MJLA 4IE1A 3SKKA 4MYKA 5CEVA 1TBJA 1HQXA 1HQHA 5HJ9A 3NIPA 1HQGA 3GMZA 4Q3UA 1TA1A 2CEVA 4MYLA 3LHLA 2A0MA 4RHMA 3LP7A 4IU4A 4Q3RC 3KV2A 3NIOA 1WOIA 3E6KA 4Q3QA 1XFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWW A;  1WOG A;  5RLA A;  3THJ A;  1D3V A;  4IU1 A;  1T5F A;  1T4P A;  4Q3P A;  4Q3V A;  1P8P A;  1ZPG A;  4Q3R A;  3F80 A;  4GWD A;  4IU0 A;  3THE A;  3SL1 A;  2EF5 A;  5HJA A;  3TH7 A;  4Q3S A;  1P8S A;  4IU5 A;  3GN0 A;  1TBH A;  3SJT A;  2ZAV A;  3E9B A;  3PZL A;  3NIQ A;  4RHJ A;  4GSV A;  4GWC A;  2PLL A;  3RLA A;  1P8O A;  3CEV A;  1R1O A;  4RLA A;  4RHI A;  1P8N A;  1PQ3 A;  2EF4 A;  3TF3 A;  4HXQ A;  1GQ7 A;  4Q42 A;  2PHA A;  4FCI A;  4Q41 A;  1WOH A;  4ITY A;  3MFV A;  1CEV A;  4Q40 A;  1P8R A;  1T4T A;  4IE2 A;  1ZPE A;  4IXV A;  4G3H A;  1RLA A;  1HQF A;  2PHO A;  3M1R A;  4MYN A;  3SL0 A;  3THH A;  1WVB A;  4CEV A;  4Q3T A;  4I06 A;  4DZ4 A;  4MXR A;  4HZE A;  4GSM A;  4FCK A;  2AEB A;  4MYF A;  1GQ6 A;  3MMR A;  1T4S A;  1HQ5 A;  1WVA A;  3E6V A;  4GSZ A;  4RHL A;  3E8Q A;  1T5G A;  1T4R A;  1P8Q A;  4RHK A;  3LP4 A;  3MFW A;  4IE3 A;  4RHQ A;  1P8M A;  3DJ8 A;  2EIV A;  2RLA A;  4IXU A;  1TBL A;  3E8Z A;  3MJL A;  4IE1 A;  3SKK A;  4MYK A;  5CEV A;  1TBJ A;  1HQX A;  1HQH A;  5HJ9 A;  3NIP A;  1HQG A;  3GMZ A;  4Q3U A;  1TA1 A;  2CEV A;  4MYL A;  3LHL A;  2A0M A;  4RHM A;  3LP7 A;  4IU4 A;  4Q3R C;  3KV2 A;  3NIO A;  1WOI A;  3E6K A;  4Q3Q A;  1XFK A; 
#chains in the Genus database with same CATH topology
 4HWW A;  5BWZ A;  5D1D A;  1WOG A;  4QA5 A;  5EF8 A;  5RLA A;  3THJ A;  3Q9E A;  4ZUO A;  1D3V A;  4ZUN A;  4IU1 A;  1T5F A;  3MZ3 A;  5G0Y A;  3ZNR A;  1T4P A;  3MZ7 A;  3C10 A;  5THT A;  5ICN B;  4Q3P A;  4CBT A;  4Q3V A;  1P8P A;  3MEN A;  4BZ5 A;  5EEK A;  4QA2 A;  4CBY A;  1ZPG A;  4Q3R A;  3F80 A;  4RN2 A;  4GWD A;  4A69 A;  4IU0 A;  3THE A;  3SL1 A;  4BZ9 A;  2EF5 A;  4QA7 A;  4QA4 A;  5HJA A;  4ZUM A;  3TH7 A;  4Q3S A;  2V5W A;  5G10 A;  1P8S A;  4CQF A;  4IU5 A;  3GN0 A;  1TBH A;  3MZ6 A;  3SJT A;  5LI3 A;  2ZAV A;  3E9B A;  3SFH A;  3PZL A;  3NIQ A;  4RHJ A;  5FCW A;  4GSV A;  5A2S A;  4GWC A;  2PLL A;  4BKX B;  3Q9C A;  4RN0 A;  5EEI A;  4RN1 A;  1ZZ1 A;  5DC5 A;  2VQW G;  5G17 A;  3RLA A;  5EEN A;  1P8O A;  5G12 A;  3CEV A;  1R1O A;  4RLA A;  5G13 A;  4RHI A;  1C3R A;  1P8N A;  1PQ3 A;  2EF4 A;  5DC8 A;  3SFF A;  3C0Z A;  3TF3 A;  5FUE A;  4HXQ A;  1GQ7 A;  5EFN A;  2GH6 A;  3EWF A;  3C0Y A;  4Q42 A;  5EFH A;  5G11 A;  2PHA A;  4BZ8 A;  4FCI A;  5DC7 A;  1T64 A;  1ZZ3 A;  4Q41 A;  1WOH A;  4ITY A;  5DC6 A;  3MAX A;  5G1C A;  1CEV A;  3MFV A;  5EFB D;  5EEF A;  4Q40 A;  1P8R A;  3EZT A;  1T4T A;  4LXZ A;  3Q9F A;  4IE2 A;  1ZPE A;  4IXV A;  4G3H A;  1RLA A;  3RQD A;  1HQF A;  4QA0 A;  1W22 A;  2PHO A;  5G0H A;  5G0J A;  3M1R A;  4MYN A;  3SL0 A;  3THH A;  5EF7 A;  5EFK B;  3ZNS A;  1T67 A;  5G1A A;  4BZ6 A;  1C3S A;  1T69 A;  1WVB A;  2VQJ A;  3EZP A;  4ZUR A;  4Q3T A;  4CEV A;  4I06 A;  5G0X A;  4DZ4 A;  4MXR A;  4QA3 A;  3Q9B A;  1C3P A;  3F06 A;  4HZE A;  5JI5 A;  4ZUP A;  4GSM A;  5G1B A;  5G0I A;  4FCK A;  2AEB A;  4MYF A;  4QA6 A;  1GQ6 A;  3MMR A;  1T4S A;  1HQ5 A;  1WVA A;  2VQM A;  3E6V A;  4QA1 A;  5IX0 A;  4GSZ A;  4RHL A;  3E8Q A;  1T5G A;  1T4R A;  1P8Q A;  3MZ4 A;  4RHK A;  3LP4 A;  5EEM A;  5G0G A;  5THV A;  3MFW A;  4BZ7 A;  4IE3 A;  4RHQ A;  1P8M A;  3DJ8 A;  5D1C A;  3EW8 A;  2VQO A;  4ZUQ A;  2EIV A;  5IWG A;  2RLA A;  4IXU A;  1TBL A;  3E8Z A;  3F07 A;  3MJL A;  4IE1 A;  5EFJ D;  2VCG A;  3F0R A;  3SKK A;  4MYK A;  5CEV A;  1TBJ A;  4LY1 A;  1HQX A;  1HQH A;  2VQV A;  5G3W A;  5D1B A;  5HJ9 A;  3NIP A;  1HQG A;  3GMZ A;  5THS A;  4Q3U A;  1TA1 A;  2CEV A;  4MYL A;  3LHL A;  2A0M A;  1ZZ0 A;  5EFG A;  4RHM A;  5THU A;  3LP7 A;  4IU4 A;  2V5X A;  4Q3R C;  3KV2 A;  3NIO A;  1VKG A;  2VQQ A;  1WOI A;  3E6K A;  4Q3Q A;  1XFK A; 
#chains in the Genus database with same CATH homology
 4HWW A;  1WOG A;  5RLA A;  3THJ A;  1D3V A;  4IU1 A;  1T5F A;  1T4P A;  4Q3P A;  4Q3V A;  1P8P A;  1ZPG A;  4Q3R A;  3F80 A;  4GWD A;  4IU0 A;  3THE A;  3SL1 A;  2EF5 A;  5HJA A;  3TH7 A;  4Q3S A;  1P8S A;  4IU5 A;  3GN0 A;  1TBH A;  3SJT A;  2ZAV A;  3E9B A;  3PZL A;  3NIQ A;  4RHJ A;  4GSV A;  4GWC A;  2PLL A;  3RLA A;  1P8O A;  3CEV A;  1R1O A;  4RLA A;  4RHI A;  1P8N A;  1PQ3 A;  2EF4 A;  3TF3 A;  4HXQ A;  1GQ7 A;  4Q42 A;  2PHA A;  4FCI A;  4Q41 A;  1WOH A;  4ITY A;  3MFV A;  1CEV A;  4Q40 A;  1P8R A;  1T4T A;  4IE2 A;  1ZPE A;  4IXV A;  4G3H A;  1RLA A;  1HQF A;  2PHO A;  3M1R A;  4MYN A;  3SL0 A;  3THH A;  1WVB A;  4CEV A;  4Q3T A;  4I06 A;  4DZ4 A;  4MXR A;  4HZE A;  4GSM A;  4FCK A;  2AEB A;  4MYF A;  1GQ6 A;  3MMR A;  1T4S A;  1HQ5 A;  1WVA A;  3E6V A;  4GSZ A;  4RHL A;  3E8Q A;  1T5G A;  1T4R A;  1P8Q A;  4RHK A;  3LP4 A;  3MFW A;  4IE3 A;  4RHQ A;  1P8M A;  3DJ8 A;  2EIV A;  2RLA A;  4IXU A;  1TBL A;  3E8Z A;  3MJL A;  4IE1 A;  3SKK A;  4MYK A;  5CEV A;  1TBJ A;  1HQX A;  1HQH A;  5HJ9 A;  3NIP A;  1HQG A;  3GMZ A;  4Q3U A;  1TA1 A;  2CEV A;  4MYL A;  3LHL A;  2A0M A;  4RHM A;  3LP7 A;  4IU4 A;  4Q3R C;  3KV2 A;  3NIO A;  1WOI A;  3E6K A;  4Q3Q A;  1XFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...