3SJXA

X-ray structure of human glutamate carboxypeptidase ii (the e424a inactive mutant) in complex with n-acetyl-aspartyl-methionine
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
696
structure length
690
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Novel Substrate-Based Inhibitors of Human Glutamate Carboxypeptidase II with Enhanced Lipophilicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 264
structure length 690
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3sjxA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3sjxA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3sjxA02
2OOTA 3SI1A 5D8NA 3LWUA 4F9VA 3IC1A 2PIYA 1BAVA 4BD9A 5HVHA 2PJBA 3BI1A 3B2YA 1ARLA 1PYTB 3PB6X 4ZI6A 2PJ1A 2BOAA 1CPXA 4ZY0A 1GYTA 3PB4X 4MCRA 2HC9A 3WT4A 1ZLHA 2QVPA 4H2KA 4NGPA 1QMUA 4OC5A 1HEEA 2Q51A 2WZNA 1TF9A 3KR4A 3KHZA 4B6ZA 3FVLA 3T8WA 3KR5A 1XFOA 5JH9A 1OBRA 2ABZA 4NGMA 2BCOA 3GLJA 4EFDA 4C9VA 1BLLE 2FVGA 1ELMP 3FECA 1CP6A 5K8PA 3NH4A 1AYEA 3BI0A 5LYLA 3SI0A 5F09A 2EK9A 2C6PA 3VH9A 4UEZA 3D7DA 3RZAA 3VATA 1ZLIA 3I6SA 2PVVA 4PPZA 4MHPA 4CDKA 2PE3A 3B3TA 2RB7A 2RFHA 5LYIA 4YU9A 2Q43A 3HLPA 1DE4C 4KNGE 3CT9A 3N5FA 3KL9A 1YMEA 1Y9ZA 3FEDA 3PB9X 2G9DA 3IEHA 4PXEA 5ELYA 1LCPA 3KQZA 3PBBA 2JEWA 3WC6A 2AFWA 5K8OA 3PFOA 1HDQA 3MN8A 3RAMA 4F8ZA 3D7GA 4W9YA 2PRQA 1BPNA 2ZEMA 3FH4A 3GB0A 4X2TA 4OC1A 2AFXA 3PEIA 3D7FA 3SJGA 3D66A 4KSIA 2J9AA 4JZ0A 2JBKA 4O23A 3D4UA 3CPAA 4UEFA 2V8HA 3L2NA 3ICUA 4YN3A 1LOKA 4A39A 3PBEA 4P45A 4TJVA 1TKHA 4OIDA 4AXVA 2EWBA 4R7MA 2ZOGA 2AFZA 2GREA 2JBJA 2XEFA 4DYOA 3IFEA 2GU2A 1Y0YA 4PXDA 6CPAA 4C9EA 1Y7EA 4ZX9A 1TKJA 1R43A 3FJUA 2PJAA 2IQ6A 4ZYQA 2ZEPA 3WC5A 1F57A 1JQGA 2NYQA 2PJ4A 3B3SA 3I74A 2V8DA 1LAMA 3IWWA 1QQ9A 2C6CA 4DUKA 4CDJA 1WVMA 5HVGA 3KGQA 4A37A 2XEJA 4R76A 4NGQA 2Q4ZA 2VL1A 2IJZA 1FNOA 3B3CA 1HDUA 2PJCA 3H8GA 4Q7AA 5HVFA 3FX6A 4K3NA 2ZELA 4MHZA 3ISZA 4C9AA 4UF4A 3CPXA 4RUHA 1TXRA 3LMSA 1IY7A 4X8IA 5DS0A 5D29A 3PRTA 3B3WA 4NGNA 3FMCA 4C85A 5J1QA 4MMOA 5IB9A 5LRKA 2XEIA 2NSMA 3DGVA 3H8FA 3CDXA 2DEAA 3V7ZA 4A38A 3VARA 2POKA 4R6TA 4P4IA 4UEEA 3WC7A 3KQXA 4Z65A 3DLJA 5CPAA 1Z5RA 1UWYA 3KHXA 3SJXA 3VTAA 4MXUA 4ZX8A 4DJLA 1LAPA 4ZY2A 1YW6A 4C86A 4C8CA 1TF8A 4P4EA 3PFEA 1Z2LA 1ZG9A 2CTCA 1YW4A 4MCSA 4OC4A 1XJOA 3RBUA 1Z8LA 4C8PA 1YSJA 4G1PA 1FT7A 4NGRA 2O4HA 4TNUA 3KI9A 3SJFA 2GLJA 4P4BA 1M4LA 2ZEHA 1DTDA 4P4DA 2PVWA 4OC2A 2AFMA 3TX8A 4P6YA 3PB8X 4ZY1A 4P4JA 3B35A 3SJEA 4OC0A 4UIAA 3IIBA 5LYDA 2PJ3A 2O53A 4PXCA 1RTQA 1IGBA 1VIXA 1ARMA 4C8AA 3S9LA 1CPSA 4NGSA 1R3NA 4NGTA 2PJ7A 3JRUA 3K9TA 1LFWA 3SI2A 1TKFA 5HXDA 1F2PA 4WJBA 3B7IA 7CPAA 4JYWA 5K8NA 3S9MA 8CPAA 3GUXA 1LANA 2V8GA 2HB6A 4FAIA 5JGFA 1VHEA 4F9UA 1XMBA 3D68A 3K2KA 4OKOA 2XEGA 2ZEGA 3MRUA 1PCAA 4EWTA 3IJ3A 2IMOA 4UIBA 4PQAA 4EMEA 1VHOA 4NJQA 2AFOA 2QJ8A 3KZWA 4FBEA 2QYVA 4P10A 3S9NA 3IO1A 4C9UA 2WYRA 4ONWA 5JM6A 3PB7X 4X3RA 2AFSA 5I4MA 1CBXA 2F8HA 2BO9A 2ZEEA 4A94A 4NJRA 2ZEDA 3NFZA 1Q7LA 4OP4A 5LRJA 3NH8A 4IK2A 3EIFA 2PJ6A 3FF3A 3NH5A 4C8UA 4MHNA 2EK8A 1F2OA 4C8FA 2C6GA 5CBMA 4FUUA 1XF1A 1CP7A 3D67A 4GM5A 4OIWA 2CF4A 2CIJA 1ELLP 4CPAA 2F7VA 3BHXA 2OR4A 1EE3P 4TJXA 1KWMA 4FWUA 3D7HA 5K8MA 4IHMA 3NA6A 1BPMA 3HUVA 1H8LA 1ZG8A 2ZEFA 4LQGA 1AMPA 2PIZA 2V8VA 2ZENA 4MRIA 4MCQA 4C84A 4PXBA 1YLOA 4IAVA 2I3CA 4MHYA 4R8FA 4WWVA 2C1CA 4MCPA 4OMEA 3H8EA 2PJ9A 5LRGA 3V38A 2CTBA 3KASA 2PJ5A 2AFUA 2PJ0A 3BXMA 1Y0RA 4P4FA 4C99A 2PJ8A 2ZOFA 1VGYA 4OC3A 3ISXA 2GLFA 5LYFA 3FEEA 3QNVA 2PCUA 5THWA 2V77A 1ZG7A 1CG2A 1CX8A 4C8TA 4P44A 3WABA 2ZEOA 2PJ2A 4C9RA 1NSAA 1XRYA 2ANPA 1V6CA 4TWEA 4NFRA 1XBUA 3I1UA 3TC8A 4YWYA 3B3VA
chains in the Genus database with same CATH superfamily
1X10A 2YNEA 4KZTA 2OOTA 4R9MA 3SI1A 2JDCA 5D8NA 3LWUA 4BPXB 4F6AA 4F9VA 5J8CA 3IC1A 2PIYA 2I00A 2ZW7A 3GKRA 1BAVA 1S7FA 4BD9A 5HVHA 2PJBA 3DSBA 3BI1A 3B2YA 4H6UA 1ARLA 1PYTB 5C88A 3TLCA 3PB6X 4ZI6A 4YFJA 3TT2A 1M6VB 5HKYA 4MFQA 2XPLA 2P6GA 4BMHA 3HPHE 1NSLA 2PJ1A 2PCNA 2CNSA 2OZGA 2BOAA 4CAWA 1CPXA 3IU2A 4LQ6A 3VWEA 1BXRB 4ZY0A 1NE9A 3BUMB 1GYTA 3PB4X 1Z9EA 4MCRA 3RNZA 2HC9A 3WT4A 2FCKA 1ZLHA 2QVPA 4H2KA 4NGPA 3PLFB 3T5MA 1QMUA 4J0NA 5DWNA 4OC5A 5DWMA 1HEEA 2Q51A 2WZNA 3DR6A 4A30A 1TF9A 3GYAA 5JVLA 3KR4A 4B13A 2CY2A 3H5ZA 3KHZA 1VKCA 1VBHA 5IV0A 3NOJA 1U6MA 1S60A 3OB1B 4B6ZA 3FVLA 2GP4A 2D4PA 2EVNA 3T8WA 5HKWA 2YNDA 3KR5A 1I1DA 1XFOA 5JH9A 1OBRA 2ABZA 4L89A 4NGMA 2BCOA 2QECA 3GLJA 3HMJG 4EFDA 2VBQA 4PK3A 4C9VA 1YVHA 4B5PA 3T05A 3TLAA 1BLLE 2FVGA 1ELMP 5E96A 1XF8A 2FSRA 2G3AA 3SXOA 3FECA 4CGPA 4CRYB 1CP6A 2HQYA 1Y9WA 3DR8A 2R7HA 4MJ8A 4OLLA 3NH4A 5K8PA 4JXQA 1AYEA 3BI0A 1S3ZA 2FT0A 3BLNA 5LYLA 3VRQA 3SI0A 3T0TA 5G22A 3VRNA 5IB0A 2REFA 5F09A 2EK9A 4B12A 2C6PA 4OADA 3VH9A 1IYLA 4C2ZA 2OLSA 4Q38A 4UEZA 3FBUA 4C7IA 3D7DA 4B14A 1NXJA 3RZAA 3VATA 4GXHA 4R87A 1ZLIA 3T9YA 5CNPA 4B10A 3DNSA 2PVVA 4MY3A 3I6SA 3BUNB 4PPZA 4R3KA 1EZBA 4MHPA 4CDKA 2YJTA 3R9GA 4UWJA 5H84A 2PE3A 3B3TA 4NCZA 5F47A 2Z3LA 4XNHC 2RB7A 3N7ZA 2RFHA 4CAXA 4QUSA 5LYIA 2DIKA 2PSWA 5AG7A 4YU9A 2Q43A 3CXQA 3DDDA 3HLPA 4JJXA 1DE4C 1KUYA 4MY0A 4KNGE 3BUOB 3R9FA 2Q44A 3CT9A 3N5FA 4U9YA 4CGLA 1M44A 3KL9A 1YMEA 3K4IA 4A4BA 1Y9ZA 2Z0ZA 3FEDA 3PB9X 4YGOA 3EZAA 3TOBA 1V0CA 2G9DA 3IEHA 5J3XA 4PXEA 2Y0MA 1BO4A 1M4DA 2DF5A 5ELYA 1YR0A 2ATRA 1LCPA 2R1IA 4UA3A 2B4DB 4XPKA 3KQZA 4HKFA 1GGOA 3PBBA 2JEWA 3WC6A 1S5KA 2AFWA 4MFKA 5K8OA 2KCWA 2QIRA 3FB3A 3PFOA 1HDQA 3MN8A 3RAMA 1Q2DA 1YLEA 2ZW4A 4QB9A 3S6GA 4F8ZA 3D7GA 4W9YA 1KUVA 1BOBA 3CXPA 2PRQA 1BPNA 2ZEMA 3FH4A 2I79A 2Z11A 3GB0A 2ZPAA 4AVAA 2Q04A 3KRVA 4X2TA 4FD7A 4KOYA 4OC1A 2AFXA 2O28A 2OZHA 3PEIA 4L8AA 1ON0A 5A28A 4JVOA 4FD5A 4JD6A 2XPNA 3D7FA 1EZAA 3SJGA 1X12A 3D66A 3QB8A 4KSIA 2J9AA 4JZ0A 1KBLA 2JBKA 3TLEA 4O23A 3D4UA 4IIYA 2Q7SA 4E8OA 4BTFA 4BPWB 4PSWA 2XPPA 3CPAA 4UEFA 2V8HA 4IF5A 1MK4A 2D0PA 3EZEA 3EXNA 3L2NA 1Z4RA 4KUBA 1NBWA 1QSTA 3ICUA 1LOKA 3LACA 3LD2A 4A39A 3PBEA 4A33A 1CS0B 1R61A 4MJXA 1I21A 4P45A 1ZO0A 2DPSA 2YNCC 5KTAA 4TJVA 1TKHA 1TIQA 4OIDA 3BUWB 4A31A 1KEEB 1IYKA 4AXVA 2VZYA 4MI1A 2EWBA 4R7MA 2ZOGA 1MJ9A 3OB2B 1L0CA 2JBJA 2XEFA 1Q2YA 1RO5A 2AFZA 1QSOA 2GREA 3IFEA 2GU2A 4DYOA 3TYXA 4E94A 1Y0YA 2BSWA 3EC4A 2N3AB 1GHEA 4H89A 3FNCA 4PXDA 6CPAA 4UFVA 1S7LA 2WSAA 1Y7EA 4OAEA 4ZBGA 4ZX9A 4C9EA 1TKJA 1R43A 2GANA 3FJUA 3LODA 2PJAA 3TLYA 2IQ6A 1EO0A 4A2ZA 4E0AA 4ZYQA 2ZEPA 4A4CA 1OZPA 1F57A 1B6BA 3ZNIA 1JQGA 2NYQA 2PJ4A 3B3SA 3WC5A 1C30B 1Z8TA 3I74A 4KVME 2BEIA 2V8DA 1P4NA 3U1BA 1LAMA 4K30A 4IIXA 3S6KA 3IWWA 1QQ9A 1Z8XA 2C6CA 4DUKA 2YGWA 2YNCA 4CDJA 1WVMA 5HVGA 3KGQA 5JQ4A 4A37A 2XEJA 1XMTA 1Q5XA 4R76A 4NGQA 3VROA 1QSRA 5KTDA 2Q4ZA 1IU8A 3FXTA 4KSFA 2PRBA 3F8KA 2AUNA 4KOSA 2VL1A 3GIUA 1YREA 4B5PB 2IJZA 1FNOA 2ZXVA 1HDUA 1PU9A 2PJCA 2EUIA 3B3CA 3H8GA 4Q7AA 5HVFA 3FX6A 4K3NA 2X0SA 4KVOE 2ZELA 1Z9UA 4MHZA 3R95A 1YGHA 3ISZA 3PP9A 4DNCA 2Q4YA 1IICA 3JTKA 2P6FA 4C9AA 3S6HA 4UF4A 1S7NA 4E2AA 3CPXA 4RUHA 2OB0A 4NEXA 5EMIA 3ZJ0A 1TXRA 3LMSA 3VRRA 1IY7A 2VEZA 4X8IA 5DS0A 5D29A 5H86A 3PRTA 3B3WA 3VWDA 4CYNA 4NGNA 5FVJA 1R57A 3HPGG 1KC7A 3FMCA 4CAVA 2REEA 5J1QA 4C85A 4EYSA 2PDOA 4MMOA 5IB9A 3TLGB 1SQHA 4RN7A 5LRKA 2XEIA 2GIVA 4MFZA 4M6HA 1JWQA 2NSMA 4KOXA 4B5OA 1B87A 3G3SA 3DGVA 3H8FA 3CDXA 4CO9A 1VBGA 2DEAA 4XPLA 3V7ZA 4U9ZA 2G3TA 4QC6A 4KOVA 4A38A 5F1YA 2B3UA 3VARA 3VGOA 1FY7A 4KOUA 1LRZA 5EC4A 3TC8A 2POKA 4R6TA 4P4IA 4RR2B 4UEEA 2B5GA 3WC7A 2HWGA 3C8OA 2FM4A 4H1HA 3KQXA 4Z65A 3DLJA 5CPAA 1Z5RA 1QSNA 1UWYA 3KHXA 3SJXA 4AG9A 1C3OB 5AGEA 1VI4A 3VTAA 5F48A 4MXUA 4F0YA 3TFYA 2H5MA 4ZX8A 2DPTA 1B47A 4UCPA 4DJLA 1LAPA 4AVBA 4KOTA 1YW6A 4ZY2A 3U88C 2VI7A 2HROA 1TF8A 4P4EA 3PFEA 1Z2LA 4KSAA 2OZUA 4YRHA 4C8CA 1ZG9A 2PR1A 1UFHA 2CTCA 2Z3PA 4J3GA 2ZW5A 1YW4A 4MCSA 4OC4A 2Z3MA 4XNHB 3SHPA 1XJOA 3RBUA 3OP0A 1Z8LA 4UWIA 1XOVA 4C8PA 1YSJA 2JLMA 4G1PA 3TOAA 1FT7A 1IOFA 4NGRA 3GJZA 4NSQA 2O4HA 2PQ8A 3BUXB 4TNUA 5I0CA 2MP0A 3KI9A 3T90A 3H4QA 2ZW6A 1NMTA 3SJFA 1K4JA 2GLJA 4P4BA 1M4LA 2FXFA 4MBUA 2ZEHA 1ZYMA 3WR7A 1DTDA 5HH1A 4FD6A 2F5IA 5BWAB 4P4DA 3TE4A 2B58A 2J8NA 2PVWA 1PUAA 4MFLA 4LX9A 2GFQA 3I9SA 4CGMA 3QAHA 2R8VA 4OC2A 5F5XA 4I49A 3D8PA 2AFMA 3TX8A 4P6YA 4M3SA 3PB8X 4ZY1A 4GS4A 4INJA 4M6IA 4PSXA 1IIDA 4P4JA 3B35A 5F49A 4U5YA 2AE6A 3C26A 2EZBA 3SJEA 2DLAA 4OC0A 2D4OA 2PR8A 3P2FA 4UIAA 2EZCA 2E28A 3IIBA 2VZZA 5LYDA 4Y49C 2PJ3A 2O53A 4PXCA 3TO6A 1RTQA 1IGBA 1VIXA 1ARMA 4C8AA 3A9LA 4YN3A 3S9LA 1CPSA 4A32A 1IB1E 4NGSA 1R3NA 2FE7A 4NGTA 4C7HA 3G8WA 4KORA 2CBLA 2PJ7A 3JRUA 5C82A 2VXKA 3K9TA 1LFWA 3F0AA 3SI2A 1TKFA 2P6EA 3FRMA 4MFJA 4C2YA 4BPUB 3EFAA 4IUSA 1F2PA 4M6GA 4R57A 4WJBA 5HXDA 3JVNA 3B7IA 2FL4A 7CPAA 3MGDA 4JYWA 4FD4A 4UFWA 2Z3KA 2A4NA 5K8NA 2B0AA 3S9MA 2ARHA 3I3GA 2B3VA 3CXSA 3D2PA 3GUXA 1A2ZA 2WUUA 4ORFA 4PK2A 8CPAA 2G0BA 3O8ZA 1LANA 2V8GA 3BJ8A 3FYNA 2WPXA 4AG7A 2HB6A 3IU1A 4H6ZA 4FAIA 5BY0A 1WWZA 1VHEA 5JGFA 4KLWA 5F13A 4COGA 4F9UA 1XMBA 3D68A 3K2KA 4MFPA 4OKOA 2Q0YA 2XEGA 1KZFA 3SXNA 4KUAA 2ZEGA 4BBHA 3TLBA 4CS0B 3MRUA 1RXTA 1PCAA 4EWTA 5GCNA 3IJ3A 2IMOA 1Z8WA 2VKZG 3D2MA 2Z10A 3SR3A 2J8MA 4PQAA 4UIBA 4EMEA 1VHOA 4ONUA 4NJQA 2AFOA 4KLVA 2Z3OA 2EZAA 2QJ8A 5G20A 5HKZA 3KZWA 4CRZB 4FBEA 2BUEA 4A95A 5J8FA 2QYVA 3R96A 1S7KA 4P10A 2B4JC 1YQEA 3IWEA 4X5KA 3S9NA 3IO1A 2PC1A 4C9UA 2XPOA 4EVYA 3FIXA 4CZ1A 4QBJA 1M4IA 2WYRA 2K5TA 4ONWA 4RS2A 3TLGA 3JUWA 3PB7X 5JM6A 4GPLB 4X3RA 1CJWA 2AFSA 5I4MA 1CBXA 1M1DA 2F8HA 2OU2A 2BO9A 2GE3A 4UCNA 4CGOA 2ZEEA 4CYQA 3BJ7A 1MJBA 1T36B 2RC4A 3V8IA 2X7BA 1CE8B 5FD8A 3NE7A 2EBJA 5AG5A 2B5GB 4A94A 4NJRA 1Y7RA 3KKWA 3W6XA 2ZEDA 3NFZA 1Q7LA 5G21A 3TCVA 1ZRSA 4OP4A 3R1KA 5LRJA 5KTCA 1VHSA 2CNMA 3NH8A 2QMLA 2ODFA 1FBVA 4IK2A 3EY5A 3EIFA 2PJ6A 3FF3A 2P0WA 3EO4A 1YVOA 1KUXA 1XIXA 4JXRA 4KOWA 1XE4A 4II9A 3NH5A 4C8UA 3S6FA 4MHNA 4Q36A 4CAEA 2EK8A 5IX3A 1F2OA 2VQYA 2DXQA 3TLZA 2C6GA 5CBMA 4QVTA 4CAFA 5A27A 4C8FA 5ISVA 4FUUA 4C2XA 2HV2A 2Q7BA 1XF1A 4UCMA 2R82A 3TTHA 2FIAA 3F9KC 2WPWA 3B8GA 1CP7A 3D67A 4GM5A 4OIWA 2Y1MA 3E0KA 2CF4A 2CIJA 3PGPA 1ELLP 4CPAA 5EBVA 2F7VA 3BHXA 3UY5A 1A9XB 3RYOA 2NMTA 4KVXA 3K9UA 4COBA 2OR4A 1EE3P 1Y9KA 4JWPA 3P2HA 4TJXA 1KWMA 3PFVA 1YVKA 3NE8A 3D7HA 4FWUA 5K8MA 4IHMA 3OWCA 3NA6A 5K99A 2AJ6A 2Y1NA 4CYOA 1BPMA 3HUVA 1H8LA 1ZG8A 2C5QA 2JEVA 1WJTA 1M4GA 1ZL0A 2ZEFA 3VRPA 3T07A 1Q2CA 4LQGA 1AMPA 2PIZA 2V8VA 2ZENA 4JLYA 4MRIA 4C68A 4HPSA 2YJVA 4MCQA 4C84A 2FS5A 1JDBC 4PXBA 1DIKA 5F9MA 1YLOA 4IAVA 2I3CA 4XPDC 4MHYA 4R8FA 4WWVA 5AG6A 2C1CA 4MCPA 4OMEA 2FIWA 3H8EA 3IGRA 4CGNA 1Z4EA 2CXAA 2PJ9A 2Q4VA 1XEBA 5LRGA 3RO0A 3V38A 2B4BA 4M85A 4R3LA 2CTBA 3KASA 4MI4A 1I12A 2PJ5A 2AFUA 2PJ0A 3W91A 4M8DA 4XPDB 1N71A 4B11A 5AG4A 3NFQA 3BXMA 1Y0RA 2C27A 1P0HA 5G1ZA 4AVCA 4HNWB 4CYPA 4UBRA 1J3LA 4P4FA 5HMNA 4C99A 2PJ8A 2ZOFA 4AB7A 1VGYA 4NF1A 3W6SA 3PT1A 1AUGA 5JPHA 4OC3A 1J4JA 3ISXA 2GLFA 3PZJA 1WK4A 3G23A 3TO7A 5LYFA 3FEEA 4RI1A 5AXIA 2HUZA 3QNVA 1YX0A 4C86A 2UV8G 2PCUA 5THWA 2D0OA 4HNXB 4BINA 4E5SA 5JYBA 4Y49B 4MHDA 4F0XA 4NXYA 2B4DA 2V77A 1ZG7A 1CG2A 3IWGA 1CX8A 1JDEA 4C8TA 3R9EA 4P44A 2EO8A 1YK3A 2Z3NA 1MJAA 2J8RA 2ZEOA 3WABA 3GY9A 3OAKA 3D3SA 2PJ2A 4HNYB 4C9RA 4KS9A 5F46A 2AUMA 1NSAA 1XRYA 4UFXA 3F5BA 3EZBA 2ANPA 2BL1A 1QSMA 1V6CA 2CNTA 3TO9A 2HI6A 4TWEA 4NFRA 3QAYA 3ZZIA 1XBUA 5IR2A 2JDDA 1CM0A 4ZGYB 3CZXA 3I1UA 2OH1A 4LUAA 1IOIA 2IL4A 4YWYA 4PV6A 3B3VA 2R98A
chains in the Genus database with same CATH topology
2OOTA 3SI1A 5D8NA 3LWUA 4F9VA 3IC1A 2PIYA 1BAVA 4BD9A 5HVHA 2PJBA 3BI1A 3B2YA 1ARLA 1PYTB 3PB6X 4ZI6A 2PJ1A 2BOAA 1CPXA 4ZY0A 1GYTA 3PB4X 4MCRA 2HC9A 3WT4A 1ZLHA 2QVPA 4H2KA 4NGPA 1QMUA 4OC5A 1HEEA 2Q51A 2WZNA 1TF9A 3KR4A 3KHZA 4B6ZA 3FVLA 2GP4A 3T8WA 3KR5A 1XFOA 5JH9A 1OBRA 2ABZA 4NGMA 2BCOA 3GLJA 4EFDA 4C9VA 1BLLE 2FVGA 1ELMP 3FECA 1CP6A 5K8PA 3NH4A 1AYEA 3BI0A 5LYLA 3SI0A 5F09A 2EK9A 2C6PA 3VH9A 4UEZA 3D7DA 3RZAA 3VATA 1ZLIA 3I6SA 2PVVA 4PPZA 4MHPA 4CDKA 2PE3A 3B3TA 2RB7A 2RFHA 5LYIA 4YU9A 2Q43A 3HLPA 1DE4C 4KNGE 3CT9A 3N5FA 3KL9A 1YMEA 1Y9ZA 3FEDA 3PB9X 2G9DA 3IEHA 4PXEA 5ELYA 1LCPA 3KQZA 3PBBA 2JEWA 3WC6A 2AFWA 5K8OA 3PFOA 1HDQA 3MN8A 3RAMA 4F8ZA 3D7GA 4W9YA 2PRQA 1BPNA 2ZEMA 3FH4A 3GB0A 4X2TA 4OC1A 2AFXA 3PEIA 3D7FA 3SJGA 3D66A 4KSIA 2J9AA 4JZ0A 2JBKA 4O23A 3D4UA 3CPAA 4UEFA 2V8HA 3L2NA 3ICUA 4YN3A 1LOKA 4A39A 3PBEA 4P45A 4TJVA 1TKHA 4OIDA 4AXVA 2EWBA 4R7MA 2ZOGA 2AFZA 2GREA 2JBJA 2XEFA 4DYOA 3IFEA 2GU2A 1Y0YA 4PXDA 6CPAA 4C9EA 1Y7EA 4ZX9A 1TKJA 1R43A 3FJUA 2PJAA 2IQ6A 4ZYQA 2ZEPA 3WC5A 1F57A 1JQGA 2NYQA 2PJ4A 3B3SA 3I74A 2V8DA 1LAMA 3IWWA 1QQ9A 2C6CA 4DUKA 4CDJA 1WVMA 5HVGA 3KGQA 4A37A 2XEJA 4R76A 4NGQA 2Q4ZA 2VL1A 2IJZA 1FNOA 3B3CA 1HDUA 2PJCA 3H8GA 4Q7AA 5HVFA 3FX6A 4K3NA 2ZELA 4MHZA 3ISZA 4C9AA 4UF4A 3CPXA 4RUHA 1TXRA 3LMSA 1IY7A 4X8IA 5DS0A 5D29A 3PRTA 3B3WA 4NGNA 3FMCA 4C85A 5J1QA 4MMOA 5IB9A 5LRKA 2XEIA 2NSMA 3DGVA 3H8FA 3CDXA 2DEAA 3V7ZA 4A38A 3VARA 2POKA 4R6TA 4P4IA 4UEEA 3WC7A 3KQXA 4Z65A 3DLJA 5CPAA 1Z5RA 1UWYA 3KHXA 3SJXA 3VTAA 4MXUA 4ZX8A 4DJLA 1LAPA 4ZY2A 1YW6A 4C86A 4C8CA 1TF8A 4P4EA 3PFEA 1Z2LA 1ZG9A 2CTCA 1YW4A 4MCSA 4OC4A 1XJOA 3RBUA 1Z8LA 4C8PA 1YSJA 4G1PA 1FT7A 4NGRA 2O4HA 4TNUA 3KI9A 3SJFA 2GLJA 4P4BA 1M4LA 2ZEHA 1DTDA 4P4DA 2PVWA 4OC2A 2AFMA 3TX8A 4P6YA 3PB8X 4ZY1A 4P4JA 3B35A 3SJEA 4OC0A 4UIAA 3IIBA 5LYDA 2PJ3A 2O53A 4PXCA 1RTQA 1IGBA 1VIXA 1ARMA 4C8AA 3S9LA 1CPSA 4NGSA 1R3NA 4NGTA 2PJ7A 3JRUA 3K9TA 1LFWA 3SI2A 1TKFA 5HXDA 1F2PA 4WJBA 3B7IA 7CPAA 4JYWA 5K8NA 3S9MA 8CPAA 3GUXA 1LANA 2V8GA 2HB6A 4FAIA 5JGFA 1VHEA 4F9UA 1XMBA 3D68A 3K2KA 4OKOA 2XEGA 2ZEGA 3MRUA 1PCAA 4EWTA 3IJ3A 2IMOA 4UIBA 4PQAA 4EMEA 1VHOA 4NJQA 2AFOA 2QJ8A 3KZWA 4FBEA 2QYVA 4P10A 3S9NA 3IO1A 4C9UA 2WYRA 4ONWA 5JM6A 3PB7X 4X3RA 2AFSA 5I4MA 1CBXA 2F8HA 2BO9A 2ZEEA 4A94A 4NJRA 2ZEDA 3NFZA 1Q7LA 4OP4A 5LRJA 3NH8A 4IK2A 3EIFA 2PJ6A 3FF3A 3NH5A 4C8UA 4MHNA 2EK8A 1F2OA 4C8FA 2C6GA 5CBMA 4FUUA 1XF1A 1CP7A 3D67A 4GM5A 4OIWA 2CF4A 2CIJA 1ELLP 4CPAA 2F7VA 3BHXA 2OR4A 1EE3P 4TJXA 1KWMA 4FWUA 3D7HA 5K8MA 4IHMA 3NA6A 1BPMA 3HUVA 1H8LA 1ZG8A 2C5QA 2ZEFA 4LQGA 1AMPA 2PIZA 2V8VA 2ZENA 4MRIA 4MCQA 4C84A 4PXBA 1YLOA 4IAVA 2I3CA 4MHYA 4R8FA 4WWVA 2C1CA 4MCPA 4OMEA 3H8EA 2PJ9A 5LRGA 3V38A 2CTBA 3KASA 2PJ5A 2AFUA 2PJ0A 3BXMA 1Y0RA 4P4FA 4C99A 2PJ8A 2ZOFA 1VGYA 4OC3A 3ISXA 2GLFA 5LYFA 3FEEA 3QNVA 2PCUA 5THWA 2V77A 1ZG7A 1CG2A 1CX8A 4C8TA 4P44A 3WABA 2ZEOA 2PJ2A 4C9RA 1NSAA 1XRYA 2ANPA 1V6CA 4TWEA 4NFRA 1XBUA 5IR2A 3I1UA 3TC8A 4YWYA 3B3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOT A;  3SI1 A;  5D8N A;  3LWU A;  4F9V A;  3IC1 A;  2PIY A;  1BAV A;  4BD9 A;  5HVH A;  2PJB A;  3BI1 A;  3B2Y A;  1ARL A;  1PYT B;  3PB6 X;  4ZI6 A;  2PJ1 A;  2BOA A;  1CPX A;  4ZY0 A;  1GYT A;  3PB4 X;  4MCR A;  2HC9 A;  3WT4 A;  1ZLH A;  2QVP A;  4H2K A;  4NGP A;  1QMU A;  4OC5 A;  1HEE A;  2Q51 A;  2WZN A;  1TF9 A;  3KR4 A;  3KHZ A;  4B6Z A;  3FVL A;  3T8W A;  3KR5 A;  1XFO A;  5JH9 A;  1OBR A;  2ABZ A;  4NGM A;  2BCO A;  3GLJ A;  4EFD A;  4C9V A;  1BLL E;  2FVG A;  1ELM P;  3FEC A;  1CP6 A;  5K8P A;  3NH4 A;  1AYE A;  3BI0 A;  5LYL A;  3SI0 A;  5F09 A;  2EK9 A;  2C6P A;  3VH9 A;  4UEZ A;  3D7D A;  3RZA A;  3VAT A;  1ZLI A;  3I6S A;  2PVV A;  4PPZ A;  4MHP A;  4CDK A;  2PE3 A;  3B3T A;  2RB7 A;  2RFH A;  5LYI A;  4YU9 A;  2Q43 A;  3HLP A;  1DE4 C;  4KNG E;  3CT9 A;  3N5F A;  3KL9 A;  1YME A;  1Y9Z A;  3FED A;  3PB9 X;  2G9D A;  3IEH A;  4PXE A;  5ELY A;  1LCP A;  3KQZ A;  3PBB A;  2JEW A;  3WC6 A;  2AFW A;  5K8O A;  3PFO A;  1HDQ A;  3MN8 A;  3RAM A;  4F8Z A;  3D7G A;  4W9Y A;  2PRQ A;  1BPN A;  2ZEM A;  3FH4 A;  3GB0 A;  4X2T A;  4OC1 A;  2AFX A;  3PEI A;  3D7F A;  3SJG A;  3D66 A;  4KSI A;  2J9A A;  4JZ0 A;  2JBK A;  4O23 A;  3D4U A;  3CPA A;  4UEF A;  2V8H A;  3L2N A;  3ICU A;  4YN3 A;  1LOK A;  4A39 A;  3PBE A;  4P45 A;  4TJV A;  1TKH A;  4OID A;  4AXV A;  2EWB A;  4R7M A;  2ZOG A;  2AFZ A;  2GRE A;  2JBJ A;  2XEF A;  4DYO A;  3IFE A;  2GU2 A;  1Y0Y A;  4PXD A;  6CPA A;  4C9E A;  1Y7E A;  4ZX9 A;  1TKJ A;  1R43 A;  3FJU A;  2PJA A;  2IQ6 A;  4ZYQ A;  2ZEP A;  3WC5 A;  1F57 A;  1JQG A;  2NYQ A;  2PJ4 A;  3B3S A;  3I74 A;  2V8D A;  1LAM A;  3IWW A;  1QQ9 A;  2C6C A;  4DUK A;  4CDJ A;  1WVM A;  5HVG A;  3KGQ A;  4A37 A;  2XEJ A;  4R76 A;  4NGQ A;  2Q4Z A;  2VL1 A;  2IJZ A;  1FNO A;  3B3C A;  1HDU A;  2PJC A;  3H8G A;  4Q7A A;  5HVF A;  3FX6 A;  4K3N A;  2ZEL A;  4MHZ A;  3ISZ A;  4C9A A;  4UF4 A;  3CPX A;  4RUH A;  1TXR A;  3LMS A;  1IY7 A;  4X8I A;  5DS0 A;  5D29 A;  3PRT A;  3B3W A;  4NGN A;  3FMC A;  4C85 A;  5J1Q A;  4MMO A;  5IB9 A;  5LRK A;  2XEI A;  2NSM A;  3DGV A;  3H8F A;  3CDX A;  2DEA A;  3V7Z A;  4A38 A;  3VAR A;  2POK A;  4R6T A;  4P4I A;  4UEE A;  3WC7 A;  3KQX A;  4Z65 A;  3DLJ A;  5CPA A;  1Z5R A;  1UWY A;  3KHX A;  3SJX A;  3VTA A;  4MXU A;  4ZX8 A;  4DJL A;  1LAP A;  4ZY2 A;  1YW6 A;  4C86 A;  4C8C A;  1TF8 A;  4P4E A;  3PFE A;  1Z2L A;  1ZG9 A;  2CTC A;  1YW4 A;  4MCS A;  4OC4 A;  1XJO A;  3RBU A;  1Z8L A;  4C8P A;  1YSJ A;  4G1P A;  1FT7 A;  4NGR A;  2O4H A;  4TNU A;  3KI9 A;  3SJF A;  2GLJ A;  4P4B A;  1M4L A;  2ZEH A;  1DTD A;  4P4D A;  2PVW A;  4OC2 A;  2AFM A;  3TX8 A;  4P6Y A;  3PB8 X;  4ZY1 A;  4P4J A;  3B35 A;  3SJE A;  4OC0 A;  4UIA A;  3IIB A;  5LYD A;  2PJ3 A;  2O53 A;  4PXC A;  1RTQ A;  1IGB A;  1VIX A;  1ARM A;  4C8A A;  3S9L A;  1CPS A;  4NGS A;  1R3N A;  4NGT A;  2PJ7 A;  3JRU A;  3K9T A;  1LFW A;  3SI2 A;  1TKF A;  5HXD A;  1F2P A;  4WJB A;  3B7I A;  7CPA A;  4JYW A;  5K8N A;  3S9M A;  8CPA A;  3GUX A;  1LAN A;  2V8G A;  2HB6 A;  4FAI A;  5JGF A;  1VHE A;  4F9U A;  1XMB A;  3D68 A;  3K2K A;  4OKO A;  2XEG A;  2ZEG A;  3MRU A;  1PCA A;  4EWT A;  3IJ3 A;  2IMO A;  4UIB A;  4PQA A;  4EME A;  1VHO A;  4NJQ A;  2AFO A;  2QJ8 A;  3KZW A;  4FBE A;  2QYV A;  4P10 A;  3S9N A;  3IO1 A;  4C9U A;  2WYR A;  4ONW A;  5JM6 A;  3PB7 X;  4X3R A;  2AFS A;  5I4M A;  1CBX A;  2F8H A;  2BO9 A;  2ZEE A;  4A94 A;  4NJR A;  2ZED A;  3NFZ A;  1Q7L A;  4OP4 A;  5LRJ A;  3NH8 A;  4IK2 A;  3EIF A;  2PJ6 A;  3FF3 A;  3NH5 A;  4C8U A;  4MHN A;  2EK8 A;  1F2O A;  4C8F A;  2C6G A;  5CBM A;  4FUU A;  1XF1 A;  1CP7 A;  3D67 A;  4GM5 A;  4OIW A;  2CF4 A;  2CIJ A;  1ELL P;  4CPA A;  2F7V A;  3BHX A;  2OR4 A;  1EE3 P;  4TJX A;  1KWM A;  4FWU A;  3D7H A;  5K8M A;  4IHM A;  3NA6 A;  1BPM A;  3HUV A;  1H8L A;  1ZG8 A;  2ZEF A;  4LQG A;  1AMP A;  2PIZ A;  2V8V A;  2ZEN A;  4MRI A;  4MCQ A;  4C84 A;  4PXB A;  1YLO A;  4IAV A;  2I3C A;  4MHY A;  4R8F A;  4WWV A;  2C1C A;  4MCP A;  4OME A;  3H8E A;  2PJ9 A;  5LRG A;  3V38 A;  2CTB A;  3KAS A;  2PJ5 A;  2AFU A;  2PJ0 A;  3BXM A;  1Y0R A;  4P4F A;  4C99 A;  2PJ8 A;  2ZOF A;  1VGY A;  4OC3 A;  3ISX A;  2GLF A;  5LYF A;  3FEE A;  3QNV A;  2PCU A;  5THW A;  2V77 A;  1ZG7 A;  1CG2 A;  1CX8 A;  4C8T A;  4P44 A;  3WAB A;  2ZEO A;  2PJ2 A;  4C9R A;  1NSA A;  1XRY A;  2ANP A;  1V6C A;  4TWE A;  4NFR A;  1XBU A;  3I1U A;  3TC8 A;  4YWY A;  3B3V A; 
#chains in the Genus database with same CATH topology
 1X10 A;  2YNE A;  4KZT A;  2OOT A;  4R9M A;  3SI1 A;  2JDC A;  5D8N A;  3LWU A;  4BPX B;  4F6A A;  4F9V A;  5J8C A;  3IC1 A;  2PIY A;  2I00 A;  2ZW7 A;  3GKR A;  1BAV A;  1S7F A;  4BD9 A;  5HVH A;  2PJB A;  3DSB A;  3BI1 A;  3B2Y A;  4H6U A;  1ARL A;  1PYT B;  5C88 A;  3TLC A;  3PB6 X;  4ZI6 A;  4YFJ A;  3TT2 A;  1M6V B;  5HKY A;  4MFQ A;  2XPL A;  2P6G A;  4BMH A;  3HPH E;  1NSL A;  2PJ1 A;  2PCN A;  2CNS A;  2OZG A;  2BOA A;  4CAW A;  1CPX A;  3IU2 A;  4LQ6 A;  3VWE A;  1BXR B;  4ZY0 A;  1NE9 A;  3BUM B;  1GYT A;  3PB4 X;  1Z9E A;  4MCR A;  3RNZ A;  2HC9 A;  3WT4 A;  2FCK A;  1ZLH A;  2QVP A;  4H2K A;  4NGP A;  3PLF B;  3T5M A;  1QMU A;  4J0N A;  5DWN A;  4OC5 A;  5DWM A;  1HEE A;  2Q51 A;  2WZN A;  3DR6 A;  4A30 A;  1TF9 A;  3GYA A;  5JVL A;  3KR4 A;  4B13 A;  2CY2 A;  3H5Z A;  3KHZ A;  1VKC A;  1VBH A;  5IV0 A;  3NOJ A;  1U6M A;  1S60 A;  3OB1 B;  4B6Z A;  3FVL A;  2GP4 A;  2D4P A;  2EVN A;  3T8W A;  5HKW A;  2YND A;  3KR5 A;  1I1D A;  1XFO A;  5JH9 A;  1OBR A;  2ABZ A;  4L89 A;  4NGM A;  2BCO A;  2QEC A;  3GLJ A;  3HMJ G;  4EFD A;  2VBQ A;  4PK3 A;  4C9V A;  1YVH A;  4B5P A;  3T05 A;  3TLA A;  1BLL E;  2FVG A;  1ELM P;  5E96 A;  1XF8 A;  2FSR A;  2G3A A;  3SXO A;  3FEC A;  4CGP A;  4CRY B;  1CP6 A;  2HQY A;  1Y9W A;  3DR8 A;  2R7H A;  4MJ8 A;  4OLL A;  3NH4 A;  5K8P A;  4JXQ A;  1AYE A;  3BI0 A;  1S3Z A;  2FT0 A;  3BLN A;  5LYL A;  3VRQ A;  3SI0 A;  3T0T A;  5G22 A;  3VRN A;  5IB0 A;  2REF A;  5F09 A;  2EK9 A;  4B12 A;  2C6P A;  4OAD A;  3VH9 A;  1IYL A;  4C2Z A;  2OLS A;  4Q38 A;  4UEZ A;  3FBU A;  4C7I A;  3D7D A;  4B14 A;  1NXJ A;  3RZA A;  3VAT A;  4GXH A;  4R87 A;  1ZLI A;  3T9Y A;  5CNP A;  4B10 A;  3DNS A;  2PVV A;  4MY3 A;  3I6S A;  3BUN B;  4PPZ A;  4R3K A;  1EZB A;  4MHP A;  4CDK A;  2YJT A;  3R9G A;  4UWJ A;  5H84 A;  2PE3 A;  3B3T A;  4NCZ A;  5F47 A;  2Z3L A;  4XNH C;  2RB7 A;  3N7Z A;  2RFH A;  4CAX A;  4QUS A;  5LYI A;  2DIK A;  2PSW A;  5AG7 A;  4YU9 A;  2Q43 A;  3CXQ A;  3DDD A;  3HLP A;  4JJX A;  1DE4 C;  1KUY A;  4MY0 A;  4KNG E;  3BUO B;  3R9F A;  2Q44 A;  3CT9 A;  3N5F A;  4U9Y A;  4CGL A;  1M44 A;  3KL9 A;  1YME A;  3K4I A;  4A4B A;  1Y9Z A;  2Z0Z A;  3FED A;  3PB9 X;  4YGO A;  3EZA A;  3TOB A;  1V0C A;  2G9D A;  3IEH A;  5J3X A;  4PXE A;  2Y0M A;  1BO4 A;  1M4D A;  2DF5 A;  5ELY A;  1YR0 A;  2ATR A;  1LCP A;  2R1I A;  4UA3 A;  2B4D B;  4XPK A;  3KQZ A;  4HKF A;  1GGO A;  3PBB A;  2JEW A;  3WC6 A;  1S5K A;  2AFW A;  4MFK A;  5K8O A;  2KCW A;  2QIR A;  3FB3 A;  3PFO A;  1HDQ A;  3MN8 A;  3RAM A;  1Q2D A;  1YLE A;  2ZW4 A;  4QB9 A;  3S6G A;  4F8Z A;  3D7G A;  4W9Y A;  1KUV A;  1BOB A;  3CXP A;  2PRQ A;  1BPN A;  2ZEM A;  3FH4 A;  2I79 A;  2Z11 A;  3GB0 A;  2ZPA A;  4AVA A;  2Q04 A;  3KRV A;  4X2T A;  4FD7 A;  4KOY A;  4OC1 A;  2AFX A;  2O28 A;  2OZH A;  3PEI A;  4L8A A;  1ON0 A;  5A28 A;  4JVO A;  4FD5 A;  4JD6 A;  2XPN A;  3D7F A;  1EZA A;  3SJG A;  1X12 A;  3D66 A;  3QB8 A;  4KSI A;  2J9A A;  4JZ0 A;  1KBL A;  2JBK A;  3TLE A;  4O23 A;  3D4U A;  4IIY A;  2Q7S A;  4E8O A;  4BTF A;  4BPW B;  4PSW A;  2XPP A;  3CPA A;  4UEF A;  2V8H A;  4IF5 A;  1MK4 A;  2D0P A;  3EZE A;  3EXN A;  3L2N A;  1Z4R A;  4KUB A;  1NBW A;  1QST A;  3ICU A;  1LOK A;  3LAC A;  3LD2 A;  4A39 A;  3PBE A;  4A33 A;  1CS0 B;  1R61 A;  4MJX A;  1I21 A;  4P45 A;  1ZO0 A;  2DPS A;  2YNC C;  5KTA A;  4TJV A;  1TKH A;  1TIQ A;  4OID A;  3BUW B;  4A31 A;  1KEE B;  1IYK A;  4AXV A;  2VZY A;  4MI1 A;  2EWB A;  4R7M A;  2ZOG A;  1MJ9 A;  3OB2 B;  1L0C A;  2JBJ A;  2XEF A;  1Q2Y A;  1RO5 A;  2AFZ A;  1QSO A;  2GRE A;  3IFE A;  2GU2 A;  4DYO A;  3TYX A;  4E94 A;  1Y0Y A;  2BSW A;  3EC4 A;  2N3A B;  1GHE A;  4H89 A;  3FNC A;  4PXD A;  6CPA A;  4UFV A;  1S7L A;  2WSA A;  1Y7E A;  4OAE A;  4ZBG A;  4ZX9 A;  4C9E A;  1TKJ A;  1R43 A;  2GAN A;  3FJU A;  3LOD A;  2PJA A;  3TLY A;  2IQ6 A;  1EO0 A;  4A2Z A;  4E0A A;  4ZYQ A;  2ZEP A;  4A4C A;  1OZP A;  1F57 A;  1B6B A;  3ZNI A;  1JQG A;  2NYQ A;  2PJ4 A;  3B3S A;  3WC5 A;  1C30 B;  1Z8T A;  3I74 A;  4KVM E;  2BEI A;  2V8D A;  1P4N A;  3U1B A;  1LAM A;  4K30 A;  4IIX A;  3S6K A;  3IWW A;  1QQ9 A;  1Z8X A;  2C6C A;  4DUK A;  2YGW A;  2YNC A;  4CDJ A;  1WVM A;  5HVG A;  3KGQ A;  5JQ4 A;  4A37 A;  2XEJ A;  1XMT A;  1Q5X A;  4R76 A;  4NGQ A;  3VRO A;  1QSR A;  5KTD A;  2Q4Z A;  1IU8 A;  3FXT A;  4KSF A;  2PRB A;  3F8K A;  2AUN A;  4KOS A;  2VL1 A;  3GIU A;  1YRE A;  4B5P B;  2IJZ A;  1FNO A;  2ZXV A;  1HDU A;  1PU9 A;  2PJC A;  2EUI A;  3B3C A;  3H8G A;  4Q7A A;  5HVF A;  3FX6 A;  4K3N A;  2X0S A;  4KVO E;  2ZEL A;  1Z9U A;  4MHZ A;  3R95 A;  1YGH A;  3ISZ A;  3PP9 A;  4DNC A;  2Q4Y A;  1IIC A;  3JTK A;  2P6F A;  4C9A A;  3S6H A;  4UF4 A;  1S7N A;  4E2A A;  3CPX A;  4RUH A;  2OB0 A;  4NEX A;  5EMI A;  3ZJ0 A;  1TXR A;  3LMS A;  3VRR A;  1IY7 A;  2VEZ A;  4X8I A;  5DS0 A;  5D29 A;  5H86 A;  3PRT A;  3B3W A;  3VWD A;  4CYN A;  4NGN A;  5FVJ A;  1R57 A;  3HPG G;  1KC7 A;  3FMC A;  4CAV A;  2REE A;  5J1Q A;  4C85 A;  4EYS A;  2PDO A;  4MMO A;  5IB9 A;  3TLG B;  1SQH A;  4RN7 A;  5LRK A;  2XEI A;  2GIV A;  4MFZ A;  4M6H A;  1JWQ A;  2NSM A;  4KOX A;  4B5O A;  1B87 A;  3G3S A;  3DGV A;  3H8F A;  3CDX A;  4CO9 A;  1VBG A;  2DEA A;  4XPL A;  3V7Z A;  4U9Z A;  2G3T A;  4QC6 A;  4KOV A;  4A38 A;  5F1Y A;  2B3U A;  3VAR A;  3VGO A;  1FY7 A;  4KOU A;  1LRZ A;  5EC4 A;  3TC8 A;  2POK A;  4R6T A;  4P4I A;  4RR2 B;  4UEE A;  2B5G A;  3WC7 A;  2HWG A;  3C8O A;  2FM4 A;  4H1H A;  3KQX A;  4Z65 A;  3DLJ A;  5CPA A;  1Z5R A;  1QSN A;  1UWY A;  3KHX A;  3SJX A;  4AG9 A;  1C3O B;  5AGE A;  1VI4 A;  3VTA A;  5F48 A;  4MXU A;  4F0Y A;  3TFY A;  2H5M A;  4ZX8 A;  2DPT A;  1B47 A;  4UCP A;  4DJL A;  1LAP A;  4AVB A;  4KOT A;  1YW6 A;  4ZY2 A;  3U88 C;  2VI7 A;  2HRO A;  1TF8 A;  4P4E A;  3PFE A;  1Z2L A;  4KSA A;  2OZU A;  4YRH A;  4C8C A;  1ZG9 A;  2PR1 A;  1UFH A;  2CTC A;  2Z3P A;  4J3G A;  2ZW5 A;  1YW4 A;  4MCS A;  4OC4 A;  2Z3M A;  4XNH B;  3SHP A;  1XJO A;  3RBU A;  3OP0 A;  1Z8L A;  4UWI A;  1XOV A;  4C8P A;  1YSJ A;  2JLM A;  4G1P A;  3TOA A;  1FT7 A;  1IOF A;  4NGR A;  3GJZ A;  4NSQ A;  2O4H A;  2PQ8 A;  3BUX B;  4TNU A;  5I0C A;  2MP0 A;  3KI9 A;  3T90 A;  3H4Q A;  2ZW6 A;  1NMT A;  3SJF A;  1K4J A;  2GLJ A;  4P4B A;  1M4L A;  2FXF A;  4MBU A;  2ZEH A;  1ZYM A;  3WR7 A;  1DTD A;  5HH1 A;  4FD6 A;  2F5I A;  5BWA B;  4P4D A;  3TE4 A;  2B58 A;  2J8N A;  2PVW A;  1PUA A;  4MFL A;  4LX9 A;  2GFQ A;  3I9S A;  4CGM A;  3QAH A;  2R8V A;  4OC2 A;  5F5X A;  4I49 A;  3D8P A;  2AFM A;  3TX8 A;  4P6Y A;  4M3S A;  3PB8 X;  4ZY1 A;  4GS4 A;  4INJ A;  4M6I A;  4PSX A;  1IID A;  4P4J A;  3B35 A;  5F49 A;  4U5Y A;  2AE6 A;  3C26 A;  2EZB A;  3SJE A;  2DLA A;  4OC0 A;  2D4O A;  2PR8 A;  3P2F A;  4UIA A;  2EZC A;  2E28 A;  3IIB A;  2VZZ A;  5LYD A;  4Y49 C;  2PJ3 A;  2O53 A;  4PXC A;  3TO6 A;  1RTQ A;  1IGB A;  1VIX A;  1ARM A;  4C8A A;  3A9L A;  4YN3 A;  3S9L A;  1CPS A;  4A32 A;  1IB1 E;  4NGS A;  1R3N A;  2FE7 A;  4NGT A;  4C7H A;  3G8W A;  4KOR A;  2CBL A;  2PJ7 A;  3JRU A;  5C82 A;  2VXK A;  3K9T A;  1LFW A;  3F0A A;  3SI2 A;  1TKF A;  2P6E A;  3FRM A;  4MFJ A;  4C2Y A;  4BPU B;  3EFA A;  4IUS A;  1F2P A;  4M6G A;  4R57 A;  4WJB A;  5HXD A;  3JVN A;  3B7I A;  2FL4 A;  7CPA A;  3MGD A;  4JYW A;  4FD4 A;  4UFW A;  2Z3K A;  2A4N A;  5K8N A;  2B0A A;  3S9M A;  2ARH A;  3I3G A;  2B3V A;  3CXS A;  3D2P A;  3GUX A;  1A2Z A;  2WUU A;  4ORF A;  4PK2 A;  8CPA A;  2G0B A;  3O8Z A;  1LAN A;  2V8G A;  3BJ8 A;  3FYN A;  2WPX A;  4AG7 A;  2HB6 A;  3IU1 A;  4H6Z A;  4FAI A;  5BY0 A;  1WWZ A;  1VHE A;  5JGF A;  4KLW A;  5F13 A;  4COG A;  4F9U A;  1XMB A;  3D68 A;  3K2K A;  4MFP A;  4OKO A;  2Q0Y A;  2XEG A;  1KZF A;  3SXN A;  4KUA A;  2ZEG A;  4BBH A;  3TLB A;  4CS0 B;  3MRU A;  1RXT A;  1PCA A;  4EWT A;  5GCN A;  3IJ3 A;  2IMO A;  1Z8W A;  2VKZ G;  3D2M A;  2Z10 A;  3SR3 A;  2J8M A;  4PQA A;  4UIB A;  4EME A;  1VHO A;  4ONU A;  4NJQ A;  2AFO A;  4KLV A;  2Z3O A;  2EZA A;  2QJ8 A;  5G20 A;  5HKZ A;  3KZW A;  4CRZ B;  4FBE A;  2BUE A;  4A95 A;  5J8F A;  2QYV A;  3R96 A;  1S7K A;  4P10 A;  2B4J C;  1YQE A;  3IWE A;  4X5K A;  3S9N A;  3IO1 A;  2PC1 A;  4C9U A;  2XPO A;  4EVY A;  3FIX A;  4CZ1 A;  4QBJ A;  1M4I A;  2WYR A;  2K5T A;  4ONW A;  4RS2 A;  3TLG A;  3JUW A;  3PB7 X;  5JM6 A;  4GPL B;  4X3R A;  1CJW A;  2AFS A;  5I4M A;  1CBX A;  1M1D A;  2F8H A;  2OU2 A;  2BO9 A;  2GE3 A;  4UCN A;  4CGO A;  2ZEE A;  4CYQ A;  3BJ7 A;  1MJB A;  1T36 B;  2RC4 A;  3V8I A;  2X7B A;  1CE8 B;  5FD8 A;  3NE7 A;  2EBJ A;  5AG5 A;  2B5G B;  4A94 A;  4NJR A;  1Y7R A;  3KKW A;  3W6X A;  2ZED A;  3NFZ A;  1Q7L A;  5G21 A;  3TCV A;  1ZRS A;  4OP4 A;  3R1K A;  5LRJ A;  5KTC A;  1VHS A;  2CNM A;  3NH8 A;  2QML A;  2ODF A;  1FBV A;  4IK2 A;  3EY5 A;  3EIF A;  2PJ6 A;  3FF3 A;  2P0W A;  3EO4 A;  1YVO A;  1KUX A;  1XIX A;  4JXR A;  4KOW A;  1XE4 A;  4II9 A;  3NH5 A;  4C8U A;  3S6F A;  4MHN A;  4Q36 A;  4CAE A;  2EK8 A;  5IX3 A;  1F2O A;  2VQY A;  2DXQ A;  3TLZ A;  2C6G A;  5CBM A;  4QVT A;  4CAF A;  5A27 A;  4C8F A;  5ISV A;  4FUU A;  4C2X A;  2HV2 A;  2Q7B A;  1XF1 A;  4UCM A;  2R82 A;  3TTH A;  2FIA A;  3F9K C;  2WPW A;  3B8G A;  1CP7 A;  3D67 A;  4GM5 A;  4OIW A;  2Y1M A;  3E0K A;  2CF4 A;  2CIJ A;  3PGP A;  1ELL P;  4CPA A;  5EBV A;  2F7V A;  3BHX A;  3UY5 A;  1A9X B;  3RYO A;  2NMT A;  4KVX A;  3K9U A;  4COB A;  2OR4 A;  1EE3 P;  1Y9K A;  4JWP A;  3P2H A;  4TJX A;  1KWM A;  3PFV A;  1YVK A;  3NE8 A;  3D7H A;  4FWU A;  5K8M A;  4IHM A;  3OWC A;  3NA6 A;  5K99 A;  2AJ6 A;  2Y1N A;  4CYO A;  1BPM A;  3HUV A;  1H8L A;  1ZG8 A;  2C5Q A;  2JEV A;  1WJT A;  1M4G A;  1ZL0 A;  2ZEF A;  3VRP A;  3T07 A;  1Q2C A;  4LQG A;  1AMP A;  2PIZ A;  2V8V A;  2ZEN A;  4JLY A;  4MRI A;  4C68 A;  4HPS A;  2YJV A;  4MCQ A;  4C84 A;  2FS5 A;  1JDB C;  4PXB A;  1DIK A;  5F9M A;  1YLO A;  4IAV A;  2I3C A;  4XPD C;  4MHY A;  4R8F A;  4WWV A;  5AG6 A;  2C1C A;  4MCP A;  4OME A;  2FIW A;  3H8E A;  3IGR A;  4CGN A;  1Z4E A;  2CXA A;  2PJ9 A;  2Q4V A;  1XEB A;  5LRG A;  3RO0 A;  3V38 A;  2B4B A;  4M85 A;  4R3L A;  2CTB A;  3KAS A;  4MI4 A;  1I12 A;  2PJ5 A;  2AFU A;  2PJ0 A;  3W91 A;  4M8D A;  4XPD B;  1N71 A;  4B11 A;  5AG4 A;  3NFQ A;  3BXM A;  1Y0R A;  2C27 A;  1P0H A;  5G1Z A;  4AVC A;  4HNW B;  4CYP A;  4UBR A;  1J3L A;  4P4F A;  5HMN A;  4C99 A;  2PJ8 A;  2ZOF A;  4AB7 A;  1VGY A;  4NF1 A;  3W6S A;  3PT1 A;  1AUG A;  5JPH A;  4OC3 A;  1J4J A;  3ISX A;  2GLF A;  3PZJ A;  1WK4 A;  3G23 A;  3TO7 A;  5LYF A;  3FEE A;  4RI1 A;  5AXI A;  2HUZ A;  3QNV A;  1YX0 A;  4C86 A;  2UV8 G;  2PCU A;  5THW A;  2D0O A;  4HNX B;  4BIN A;  4E5S A;  5JYB A;  4Y49 B;  4MHD A;  4F0X A;  4NXY A;  2B4D A;  2V77 A;  1ZG7 A;  1CG2 A;  3IWG A;  1CX8 A;  1JDE A;  4C8T A;  3R9E A;  4P44 A;  2EO8 A;  1YK3 A;  2Z3N A;  1MJA A;  2J8R A;  2ZEO A;  3WAB A;  3GY9 A;  3OAK A;  3D3S A;  2PJ2 A;  4HNY B;  4C9R A;  4KS9 A;  5F46 A;  2AUM A;  1NSA A;  1XRY A;  4UFX A;  3F5B A;  3EZB A;  2ANP A;  2BL1 A;  1QSM A;  1V6C A;  2CNT A;  3TO9 A;  2HI6 A;  4TWE A;  4NFR A;  3QAY A;  3ZZI A;  1XBU A;  5IR2 A;  2JDD A;  1CM0 A;  4ZGY B;  3CZX A;  3I1U A;  2OH1 A;  4LUA A;  1IOI A;  2IL4 A;  4YWY A;  4PV6 A;  3B3V A;  2R98 A; 
#chains in the Genus database with same CATH homology
 2OOT A;  3SI1 A;  5D8N A;  3LWU A;  4F9V A;  3IC1 A;  2PIY A;  1BAV A;  4BD9 A;  5HVH A;  2PJB A;  3BI1 A;  3B2Y A;  1ARL A;  1PYT B;  3PB6 X;  4ZI6 A;  2PJ1 A;  2BOA A;  1CPX A;  4ZY0 A;  1GYT A;  3PB4 X;  4MCR A;  2HC9 A;  3WT4 A;  1ZLH A;  2QVP A;  4H2K A;  4NGP A;  1QMU A;  4OC5 A;  1HEE A;  2Q51 A;  2WZN A;  1TF9 A;  3KR4 A;  3KHZ A;  4B6Z A;  3FVL A;  2GP4 A;  3T8W A;  3KR5 A;  1XFO A;  5JH9 A;  1OBR A;  2ABZ A;  4NGM A;  2BCO A;  3GLJ A;  4EFD A;  4C9V A;  1BLL E;  2FVG A;  1ELM P;  3FEC A;  1CP6 A;  5K8P A;  3NH4 A;  1AYE A;  3BI0 A;  5LYL A;  3SI0 A;  5F09 A;  2EK9 A;  2C6P A;  3VH9 A;  4UEZ A;  3D7D A;  3RZA A;  3VAT A;  1ZLI A;  3I6S A;  2PVV A;  4PPZ A;  4MHP A;  4CDK A;  2PE3 A;  3B3T A;  2RB7 A;  2RFH A;  5LYI A;  4YU9 A;  2Q43 A;  3HLP A;  1DE4 C;  4KNG E;  3CT9 A;  3N5F A;  3KL9 A;  1YME A;  1Y9Z A;  3FED A;  3PB9 X;  2G9D A;  3IEH A;  4PXE A;  5ELY A;  1LCP A;  3KQZ A;  3PBB A;  2JEW A;  3WC6 A;  2AFW A;  5K8O A;  3PFO A;  1HDQ A;  3MN8 A;  3RAM A;  4F8Z A;  3D7G A;  4W9Y A;  2PRQ A;  1BPN A;  2ZEM A;  3FH4 A;  3GB0 A;  4X2T A;  4OC1 A;  2AFX A;  3PEI A;  3D7F A;  3SJG A;  3D66 A;  4KSI A;  2J9A A;  4JZ0 A;  2JBK A;  4O23 A;  3D4U A;  3CPA A;  4UEF A;  2V8H A;  3L2N A;  3ICU A;  4YN3 A;  1LOK A;  4A39 A;  3PBE A;  4P45 A;  4TJV A;  1TKH A;  4OID A;  4AXV A;  2EWB A;  4R7M A;  2ZOG A;  2AFZ A;  2GRE A;  2JBJ A;  2XEF A;  4DYO A;  3IFE A;  2GU2 A;  1Y0Y A;  4PXD A;  6CPA A;  4C9E A;  1Y7E A;  4ZX9 A;  1TKJ A;  1R43 A;  3FJU A;  2PJA A;  2IQ6 A;  4ZYQ A;  2ZEP A;  3WC5 A;  1F57 A;  1JQG A;  2NYQ A;  2PJ4 A;  3B3S A;  3I74 A;  2V8D A;  1LAM A;  3IWW A;  1QQ9 A;  2C6C A;  4DUK A;  4CDJ A;  1WVM A;  5HVG A;  3KGQ A;  4A37 A;  2XEJ A;  4R76 A;  4NGQ A;  2Q4Z A;  2VL1 A;  2IJZ A;  1FNO A;  3B3C A;  1HDU A;  2PJC A;  3H8G A;  4Q7A A;  5HVF A;  3FX6 A;  4K3N A;  2ZEL A;  4MHZ A;  3ISZ A;  4C9A A;  4UF4 A;  3CPX A;  4RUH A;  1TXR A;  3LMS A;  1IY7 A;  4X8I A;  5DS0 A;  5D29 A;  3PRT A;  3B3W A;  4NGN A;  3FMC A;  4C85 A;  5J1Q A;  4MMO A;  5IB9 A;  5LRK A;  2XEI A;  2NSM A;  3DGV A;  3H8F A;  3CDX A;  2DEA A;  3V7Z A;  4A38 A;  3VAR A;  2POK A;  4R6T A;  4P4I A;  4UEE A;  3WC7 A;  3KQX A;  4Z65 A;  3DLJ A;  5CPA A;  1Z5R A;  1UWY A;  3KHX A;  3SJX A;  3VTA A;  4MXU A;  4ZX8 A;  4DJL A;  1LAP A;  4ZY2 A;  1YW6 A;  4C86 A;  4C8C A;  1TF8 A;  4P4E A;  3PFE A;  1Z2L A;  1ZG9 A;  2CTC A;  1YW4 A;  4MCS A;  4OC4 A;  1XJO A;  3RBU A;  1Z8L A;  4C8P A;  1YSJ A;  4G1P A;  1FT7 A;  4NGR A;  2O4H A;  4TNU A;  3KI9 A;  3SJF A;  2GLJ A;  4P4B A;  1M4L A;  2ZEH A;  1DTD A;  4P4D A;  2PVW A;  4OC2 A;  2AFM A;  3TX8 A;  4P6Y A;  3PB8 X;  4ZY1 A;  4P4J A;  3B35 A;  3SJE A;  4OC0 A;  4UIA A;  3IIB A;  5LYD A;  2PJ3 A;  2O53 A;  4PXC A;  1RTQ A;  1IGB A;  1VIX A;  1ARM A;  4C8A A;  3S9L A;  1CPS A;  4NGS A;  1R3N A;  4NGT A;  2PJ7 A;  3JRU A;  3K9T A;  1LFW A;  3SI2 A;  1TKF A;  5HXD A;  1F2P A;  4WJB A;  3B7I A;  7CPA A;  4JYW A;  5K8N A;  3S9M A;  8CPA A;  3GUX A;  1LAN A;  2V8G A;  2HB6 A;  4FAI A;  5JGF A;  1VHE A;  4F9U A;  1XMB A;  3D68 A;  3K2K A;  4OKO A;  2XEG A;  2ZEG A;  3MRU A;  1PCA A;  4EWT A;  3IJ3 A;  2IMO A;  4UIB A;  4PQA A;  4EME A;  1VHO A;  4NJQ A;  2AFO A;  2QJ8 A;  3KZW A;  4FBE A;  2QYV A;  4P10 A;  3S9N A;  3IO1 A;  4C9U A;  2WYR A;  4ONW A;  5JM6 A;  3PB7 X;  4X3R A;  2AFS A;  5I4M A;  1CBX A;  2F8H A;  2BO9 A;  2ZEE A;  4A94 A;  4NJR A;  2ZED A;  3NFZ A;  1Q7L A;  4OP4 A;  5LRJ A;  3NH8 A;  4IK2 A;  3EIF A;  2PJ6 A;  3FF3 A;  3NH5 A;  4C8U A;  4MHN A;  2EK8 A;  1F2O A;  4C8F A;  2C6G A;  5CBM A;  4FUU A;  1XF1 A;  1CP7 A;  3D67 A;  4GM5 A;  4OIW A;  2CF4 A;  2CIJ A;  1ELL P;  4CPA A;  2F7V A;  3BHX A;  2OR4 A;  1EE3 P;  4TJX A;  1KWM A;  4FWU A;  3D7H A;  5K8M A;  4IHM A;  3NA6 A;  1BPM A;  3HUV A;  1H8L A;  1ZG8 A;  2C5Q A;  2ZEF A;  4LQG A;  1AMP A;  2PIZ A;  2V8V A;  2ZEN A;  4MRI A;  4MCQ A;  4C84 A;  4PXB A;  1YLO A;  4IAV A;  2I3C A;  4MHY A;  4R8F A;  4WWV A;  2C1C A;  4MCP A;  4OME A;  3H8E A;  2PJ9 A;  5LRG A;  3V38 A;  2CTB A;  3KAS A;  2PJ5 A;  2AFU A;  2PJ0 A;  3BXM A;  1Y0R A;  4P4F A;  4C99 A;  2PJ8 A;  2ZOF A;  1VGY A;  4OC3 A;  3ISX A;  2GLF A;  5LYF A;  3FEE A;  3QNV A;  2PCU A;  5THW A;  2V77 A;  1ZG7 A;  1CG2 A;  1CX8 A;  4C8T A;  4P44 A;  3WAB A;  2ZEO A;  2PJ2 A;  4C9R A;  1NSA A;  1XRY A;  2ANP A;  1V6C A;  4TWE A;  4NFR A;  1XBU A;  5IR2 A;  3I1U A;  3TC8 A;  4YWY A;  3B3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...