3SJXA

X-ray structure of human glutamate carboxypeptidase ii (the e424a inactive mutant) in complex with n-acetyl-aspartyl-methionine
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
696
structure length
690
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel Substrate-Based Inhibitors of Human Glutamate Carboxypeptidase II with Enhanced Lipophilicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 264
structure length 690
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3sjxA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3sjxA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3sjxA02
1DE4C 2CF4A 5JGFA 4UIBA 4ONWA 2BOAA 3GB0A 4C8FA 1ARLA 3H8FA 2V8GA 3SJFA 3ISZA 5LRKA 1XRYA 3NA6A 2GREA 4NFRA 2AFXA 3FECA 1YSJA 3QNVA 3D7DA 1QQ9A 1CP6A 3VATA 2RB7A 3N5FA 3SJXA 3B7IA 2V8VA 4MCQA 3KASA 2PJ6A 3HLPA 3KQZA 4C9UA 2C6PA 2PJ7A 2J9AA 4ZI6A 1BAVA 4NJQA 1IGBA 4Z65A 4C8TA 5K8OA 3D7FA 1GYTA 4MCPA 2GLFA 4NGMA 1ZLHA 1LAPA 5F09A 4P4BA 2ZEPA 3KHZA 5LRGA 2PJCA 2OR4A 4YWYA 1M4LA 4ZX9A 3LMSA 2DEAA 1Z5RA 3CT9A 5J1QA 4OP4A 1LFWA 2PJ5A 3FJUA 3B3SA 4DYOA 1CBXA 3I6SA 3HUVA 1CG2A 4C85A 1R43A 2AFUA 3D68A 4OC0A 3KGQA 1AYEA 2O53A 1R3NA 1ZG9A 4MRIA 4FWUA 1V6CA 4UEZA 5K8MA 2QJ8A 5HVGA 4R7MA 2CTBA 2V8DA 2F8HA 3WT4A 4R8FA 5ELYA 5THWA 3WC6A 4MMOA 4X3RA 3RAMA 2AFMA 4DJLA 2EWBA 3WC5A 3B2YA 4EWTA 4DUKA 5LRJA 4R6TA 1ELMP 1BPMA 4WJBA 4OC3A 3PBBA 3SJGA 3KR5A 4OC1A 4ZY0A 3VTAA 4C8CA 4P6YA 2ZEGA 1AMPA 2PJ8A 4MCSA 1XJOA 4YU9A 5K8NA 4TJXA 2QVPA 4TJVA 2XEIA 2AFSA 6CPAA 2JBJA 1F2PA 3PEIA 2RFHA 4LQGA 4A38A 1Z2LA 3PB4X 2PJ1A 4TWEA 2XEGA 2PJ9A 4NGNA 2ANPA 2VL1A 4FBEA 7CPAA 3PRTA 4OIDA 4H2KA 4MHYA 3D66A 3T8WA 1ARMA 2C1CA 3KI9A 4CDKA 1LCPA 2PVVA 2OOTA 2ZEFA 4PXEA 1LANA 1EE3P 1ZG8A 4UIAA 5JM6A 1LOKA 2C6CA 2V8HA 2O4HA 4OC2A 2Q43A 1QMUA 3DLJA 3I74A 4F9VA 1CPSA 3FEDA 4A94A 3MN8A 4CPAA 4CDJA 5HVHA 3D4UA 1NSAA 2BCOA 5D29A 1XFOA 4IK2A 4NGSA 1TKJA 4C84A 4EMEA 1YMEA 3H8EA 3IO1A 4P10A 1HEEA 4JYWA 2ZOFA 5IB9A 3JRUA 3RZAA 5LYFA 1HDUA 3B3WA 5LYLA 3KR4A 3PB9X 1YW6A 4C9AA 3BXMA 3BHXA 4AXVA 1ZLIA 4C9RA 3V38A 3IFEA 3FEEA 2IMOA 3FX6A 4OC4A 2PCUA 1PYTB 2AFOA 2ZEOA 1TXRA 4A39A 3WC7A 3L2NA 3S9MA 1Y9ZA 4RUHA 2AFWA 4ZX8A 1BLLE 2AFZA 3DGVA 2HB6A 3V7ZA 2PVWA 1F57A 1VHOA 2PJ4A 2ZEDA 3IC1A 2Q51A 5HXDA 4F9UA 3LWUA 1Y7EA 2NSMA 1FNOA 1OBRA 3NH8A 3I1UA 2CTCA 1ELLP 4F8ZA 2ZENA 4X8IA 3BI0A 1DTDA 4C8PA 4UF4A 4R76A 4P4EA 3FF3A 4KNGE 2F7VA 3PB6X 4PQAA 3WABA 2PRQA 5D8NA 4IAVA 3S9LA 2Q4ZA 4MHPA 2XEJA 1CPXA 5CBMA 4C99A 2NYQA 2ZELA 3PFEA 4NGTA 1VHEA 2WZNA 2PJ3A 4ZY1A 3CPXA 3SJEA 1Q7LA 2PIYA 4FAIA 2QYVA 5CPAA 8CPAA 2EK9A 2CIJA 2FVGA 3PFOA 4C8AA 2JBKA 3IEHA 3KQXA 4NGQA 4P4FA 1TF9A 4OC5A 2PJ2A 4MHZA 4P44A 4BD9A 3K2KA 4W9YA 1YW4A 2IJZA 3B3CA 4MHNA 3IIBA 3K9TA 1CX8A 1YLOA 4MXUA 4P4DA 3RBUA 4P4IA 4JZ0A 3FH4A 1H8LA 3IJ3A 4TNUA 2EK8A 3ISXA 2ZEHA 5I4MA 3PB7X 4PXCA 1VGYA 4UEFA 2PJAA 3S9NA 1BPNA 3GUXA 4PPZA 2PIZA 1VIXA 1Y0YA 3KHXA 3B35A 2IQ6A 3NH4A 3KL9A 1F2OA 4P45A 3BI1A 1CP7A 2HC9A 3ICUA 3CPAA 4EFDA 3TC8A 1JQGA 2PE3A 3SI0A 2C6GA 4C8UA 4O23A 2G9DA 4MCRA 1WVMA 4NJRA 2JEWA 4NGRA 3KZWA 4C9VA 1RTQA 4K3NA 4Q7AA 4OIWA 3VH9A 2PJBA 2ABZA 5JH9A 4B6ZA 3IWWA 3MRUA 1FT7A 3D7GA 1TF8A 5LYDA 4WWVA 3PB8X 3PBEA 4ZYQA 2POKA 3NH5A 1LAMA 2BO9A 4UEEA 4IHMA 3H8GA 1Z8LA 4FUUA 1XBUA 2ZEMA 4NGPA 1PCAA 4P4JA 1KWMA 5HVFA 2WYRA 1ZG7A 1XF1A 2GU2A 4C9EA 1Y0RA 4KSIA 2ZOGA 2ZEEA 3B3TA 2V77A 5DS0A 3EIFA 1HDQA 3TX8A 3SI2A 1TKHA 4C86A 4GM5A 2GLJA 3D7HA 4A37A 4OMEA 4G1PA 1XMBA 4X2TA 3CDXA 3GLJA 4YN3A 3FVLA 3SI1A 5K8PA 1TKFA 1IY7A 1UWYA 4OKOA 3NFZA 3B3VA 2I3CA 3D67A 4ZY2A 2XEFA 4PXBA 3VARA 4PXDA 3FMCA 5LYIA 2PJ0A
chains in the Genus database with same CATH superfamily
1DE4C 1YREA 3T5MA 1QSOA 2CF4A 3IU1A 3RYOA 2B0AA 3BJ7A 2ZXVA 1P0HA 4Y49C 4B11A 5JGFA 4UIBA 2DIKA 4A2ZA 4ONWA 2BOAA 4ZBGA 3GB0A 4C8FA 1ARLA 2Z3MA 2Q4YA 2V8GA 3SJFA 3H8FA 3ISZA 2B3UA 5LRKA 5HKYA 1WJTA 1XRYA 1JDBC 3VWEA 4CGPA 4M8DA 2Q0YA 3NA6A 2Y1MA 2GREA 2G3AA 2AFXA 4NFRA 4K30A 3FECA 4NF1A 3W91A 2X0SA 2EZBA 1YSJA 4M3SA 3QNVA 3I9SA 3D7DA 1S7NA 2ZPAA 1QSMA 2E28A 2VZZA 4C7HA 4KLVA 1QQ9A 1CP6A 3VATA 2RB7A 2XPNA 2X7BA 1I1DA 1S5KA 3N5FA 2EZAA 2Z10A 4KOXA 4LUAA 5C82A 4IF5A 1UFHA 2P6GA 4CYNA 5KTAA 3OB2B 3SJXA 3SHPA 5F9MA 1MJAA 3B7IA 2V8VA 4R9MA 4KUBA 2J8RA 4MCQA 2Z3NA 3F0AA 3KASA 2PJ6A 5F13A 2XPLA 2Z0ZA 1IU8A 1GHEA 3HLPA 3BUWB 3KQZA 3NE8A 4C9UA 1JWQA 4A4BA 2C6PA 4E5SA 3TLAA 4AVBA 5JQ4A 4MI4A 2PJ7A 2J9AA 1T36B 4ZI6A 1BAVA 4U5YA 4UCMA 3TYXA 2OZUA 3DR6A 4NJQA 5F47A 1IGBA 2VQYA 2OZGA 4Z65A 4C8TA 5K8OA 3S6HA 3D7FA 4DNCA 1GYTA 4MCPA 2GLFA 3CXSA 4KUAA 4NGMA 1ZLHA 1LAPA 4AVCA 4MY3A 5F09A 2AUMA 3PP9A 4P4BA 2CY2A 4MY0A 2ZEPA 4J0NA 3KHZA 5LRGA 2OH1A 4R57A 3R96A 2PJCA 3EFAA 3T9YA 3V8IA 5AGEA 5IB0A 2K5TA 2OR4A 4YWYA 4XPDC 2C27A 1M4LA 4ZX9A 4BPUB 2Q04A 3LMSA 2DEAA 3S6KA 3EZEA 1Z5RA 3T0TA 2Q44A 3CT9A 2Z3PA 5HMNA 2YNEA 2AUNA 1B6BA 1WWZA 5J1QA 2GIVA 3VRRA 1YVKA 3VWDA 4CO9A 4CGMA 4OP4A 1LFWA 2PJ5A 3FJUA 1CE8B 3B3SA 5IX3A 4DYOA 1CBXA 2R82A 1Q5XA 3HUVA 1CG2A 3I6SA 4C85A 1R43A 1XE4A 5JYBA 2AFUA 3D68A 2PDOA 3U1BA 4OC0A 2JDCA 3KGQA 1AYEA 1M6VB 1B47A 2O53A 1R3NA 4ONUA 1ZG9A 1Y9WA 2BUEA 3P2FA 4KVOE 5AG7A 3TOBA 4COGA 1FBVA 4FWUA 4MRIA 1V6CA 5HKZA 2B4DA 4UEZA 5K8MA 2QJ8A 5HVGA 3NOJA 4R7MA 2CTBA 4JJXA 1YK3A 2FIAA 4JWPA 1P4NA 5FD8A 2N3AB 2V8DA 2WPXA 2F8HA 2EZCA 4CYOA 3OAKA 4IIXA 2F5IA 2BEIA 3VRQA 4PSWA 3FIXA 4R8FA 3WT4A 5ELYA 2R8VA 2VI7A 2KCWA 4MBUA 3EXNA 5THWA 3WC6A 2FIWA 4CAVA 4B13A 4MMOA 3PT1A 3E0KA 4NEXA 4X3RA 4PV6A 2AFMA 4UWIA 3RAMA 4A32A 2YNCC 2EWBA 4DJLA 3WC5A 3B2YA 5H86A 2FXFA 4DUKA 4EWTA 4YRHA 2EVNA 4A30A 4CAXA 4KZTA 4CS0B 1EZAA 1VHSA 5LRJA 4R6TA 3TO6A 5BY0A 3NFQA 1ELMP 3TLZA 4CRYB 1NBWA 1BPMA 4WJBA 4AB7A 4OC3A 3PBBA 3SJGA 3HPGG 4JXQA 3LODA 4A33A 3KR5A 4OC1A 4ZY0A 4KOVA 5HKWA 4MFJA 3S6GA 2PSWA 3TLGA 1S7FA 5F46A 3VTAA 4C8CA 4P6YA 2ZEGA 2GP4A 1AMPA 2PJ8A 4MCSA 1WK4A 1XJOA 1Y9KA 3DNSA 3FB3A 4YU9A 2QVPA 5K8NA 4TJVA 4H6ZA 4TJXA 1A2ZA 2XEIA 2AFSA 6CPAA 2FSRA 2JBJA 2Y0MA 2GFQA 3EO4A 4E8OA 1F2PA 3I3GA 1RXTA 4F0XA 3KRVA 3RNZA 3PEIA 2RFHA 4LQGA 2ODFA 1B87A 1IICA 1Z2LA 2PJ1A 3PB4X 2XEGA 2PJ9A 4NGNA 2ANPA 2EO8A 2VL1A 2DPTA 3PRTA 4OIDA 4H2KA 7CPAA 4MHYA 1DIKA 3D66A 1R57A 4MHDA 3T8WA 1MK4A 1ARMA 2C1CA 2VBQA 3KI9A 5GCNA 4CDKA 1LCPA 4QUSA 2PVVA 1CS0B 3VRPA 2OOTA 1VKCA 1M44A 1Z8WA 3PGPA 2ZEFA 2B4JC 1XIXA 3DDDA 4PXEA 1LANA 2BL1A 1EE3P 1ZG8A 4RS2A 5AG4A 2OLSA 3CXQA 3BUXB 4UIAA 1IOFA 5JM6A 1LOKA 4COBA 4A95A 5K99A 3VROA 2C6CA 3TO9A 3FNCA 2OZHA 2VZYA 4AVAA 2BSWA 3G23A 4HNYB 2O28A 3QB8A 4RR2B 4H1HA 1PU9A 2V8HA 2O4HA 2J8MA 4OC2A 2H5MA 3H4QA 4OADA 2Q43A 2R1IA 1QMUA 2DPSA 2R7HA 2PRBA 3DLJA 4LQ6A 2QMLA 3I74A 1PUAA 4F9VA 2VKZG 1CPSA 3FEDA 2Q4VA 2WSAA 4A94A 1N71A 2B5GA 3MN8A 4L8AA 4CPAA 4CDJA 5HVHA 3U88C 3D4UA 2AE6A 2CNSA 3CXPA 1NSAA 2BCOA 5D29A 4XPKA 1XFOA 2CNTA 4IK2A 4NGSA 1Q2DA 5JPHA 2HI6A 1TKJA 4F6AA 4C84A 3C26A 5DWMA 4CAWA 4EMEA 3C8OA 1LRZA 4A4CA 1YMEA 3JUWA 2JEVA 4R3KA 3H8EA 1BXRB 2HV2A 3IO1A 4P10A 4PK3A 3TFYA 4MI1A 1HEEA 3GIUA 2B4BA 5F48A 4JYWA 1TIQA 2ZOFA 5HH1A 5IB9A 2C5QA 3T05A 3JRUA 2YGWA 4HNXB 3EZAA 2WPWA 3PZJA 3A9LA 1HDUA 1Y7RA 5H84A 3RZAA 3B3WA 5LYFA 2JLMA 3P2HA 2FM4A 3ZZIA 2YNCA 2YJVA 1S3ZA 4KSAA 5LYLA 3KR4A 4BPWB 3PB9X 4FBEA 2Y1NA 1KBLA 1YW6A 1XEBA 4BTFA 4KOWA 1YR0A 2A4NA 1XF8A 3BXMA 4NXYA 3RO0A 3BHXA 2HROA 4C9AA 5F5XA 1KC7A 4AXVA 1ZLIA 4C9RA 4IUSA 3JTKA 3V38A 1KUXA 3IFEA 3FEEA 1IYKA 1YX0A 2IMOA 3FX6A 4OC4A 3D3SA 2PCUA 1PYTB 5EBVA 2AFOA 3IU2A 4X5KA 2ZEOA 4ZGYB 4Y49B 1TXRA 4A39A 3WC7A 3F5BA 3EC4A 2D4PA 5EMIA 1MJ9A 3L2NA 4YGOA 3R9GA 3S9MA 1Z4EA 5KTCA 1Y9ZA 2Z3OA 4KORA 4RUHA 2AFWA 4RI1A 4ZX8A 4UA3A 1YLEA 1BLLE 2AFZA 3ZJ0A 3DGVA 4E0AA 3D2PA 1CJWA 3D8PA 2Z3KA 4H6UA 4Q36A 2HB6A 1Z8TA 2VEZA 4MFZA 3V7ZA 2PVWA 3W6XA 4B5OA 1F57A 1VHOA 2PJ4A 3UY5A 2ZEDA 3IC1A 3TLEA 4C7IA 1NMTA 4FD6A 1Q2YA 1XMTA 1QSRA 5AXIA 2Q51A 5HXDA 4F9UA 3NE7A 3TE4A 1NSLA 4E2AA 3LWUA 3TO7A 1Y7EA 2NSMA 1FNOA 1OBRA 4C2ZA 3NH8A 4Q38A 1KEEB 3GKRA 3GYAA 2Q7SA 4JVOA 4XNHC 4A38A 4M6GA 2PQ8A 4YFJA 5FVJA 3I1UA 2CTCA 4GPLB 1ELLP 4F8ZA 2ZENA 2MP0A 4X8IA 3BI0A 1DTDA 3R9EA 4C8PA 3VGOA 2OB0A 3DR8A 4UCNA 4UF4A 4R76A 4OLLA 4P4EA 1KUYA 3FF3A 4BBHA 1EZBA 2ZW7A 5CNPA 2XPPA 3TTHA 4KNGE 2F7VA 4FD5A 3PB6X 4PQAA 4OAEA 4CGNA 2UV8G 1YVOA 3IGRA 3WABA 2PRQA 3EZBA 5D8NA 2PCNA 4IAVA 4UFXA 3S9LA 2Q4ZA 4MHPA 2XEJA 1CPXA 3HMJG 4EVYA 5CBMA 4C99A 2NYQA 2ZELA 2B4DB 1BOBA 3PFEA 5JVLA 4NGTA 2PC1A 2ZW4A 4HNWB 3BUMB 1XOVA 1VHEA 4I49A 2WZNA 2I79A 2PJ3A 4NCZA 4ZY1A 3CPXA 4CAFA 3SJEA 5KTDA 1Q7LA 3HPHE 2NMTA 2PIYA 4FAIA 4FD4A 2QYVA 5CPAA 4QVTA 8CPAA 2QIRA 2YNDA 2EK9A 2CIJA 2FVGA 4C2YA 3PFOA 4C8AA 3FBUA 4UCPA 4MFKA 4KLWA 3ZNIA 2IL4A 3N7ZA 2JBKA 3IEHA 2OU2A 4CAEA 3PLFB 2HWGA 3KQXA 4NGQA 4P4FA 4INJA 1TF9A 2G3TA 4OC5A 2PJ2A 4MHZA 4P44A 4R87A 4BD9A 4HKFA 4KOYA 3K2KA 2P0WA 4W9YA 4FD7A 4JXRA 2ARHA 1YW4A 2IJZA 3B3CA 4AG7A 1NXJA 4MHNA 3IIBA 3K9TA 1CX8A 4BINA 2FCKA 4QBJA 1YLOA 3GY9A 3K9UA 4MJ8A 3KKWA 3PFVA 4MXUA 1ZYMA 3SXOA 2DLAA 1AUGA 2REEA 4P4DA 4PSXA 1ZL0A 5J3XA 3RBUA 2JDDA 3GJZA 4A31A 4P4IA 4JZ0A 2PR1A 4B12A 4H89A 3FH4A 1GGOA 1H8LA 3IJ3A 4TNUA 1J4JA 2EK8A 3ISXA 4AG9A 3IWEA 2ZEHA 4B5PB 3PB7X 5I4MA 4PXCA 3S6FA 3F8KA 3TLYA 1VGYA 1M4GA 4PK2A 4UEFA 4BMHA 1MJBA 2DXQA 2PJAA 5J8FA 2D0PA 2Z11A 3JVNA 5AG5A 1OZPA 4EYSA 3S9NA 1BPNA 3GUXA 2YJTA 4PPZA 2I00A 1IB1E 2B5GB 2CNMA 4GXHA 4LX9A 2EUIA 2PIZA 2J8NA 4CYQA 3OWCA 1VIXA 1Y0YA 3EY5A 3KHXA 4R3LA 4KSFA 4UWJA 3B35A 4XPDB 2IQ6A 3NH4A 4CRZB 3KL9A 4B5PA 1F2OA 2ZW6A 5A28A 1C30B 2CXAA 4U9YA 4P45A 3BI1A 4B10A 1CP7A 1NE9A 2HC9A 3ICUA 2ATRA 4C2XA 3CPAA 4EFDA 3TC8A 1JQGA 2PE3A 3SI0A 5BWAB 3TLCA 2CBLA 2C6GA 4C8UA 1ZO0A 1U6MA 1Q2CA 4O23A 2G9DA 3CZXA 3TLGB 4MCRA 4M6IA 1WVMA 4U9ZA 4NJRA 2JEWA 4NGRA 3H5ZA 3MGDA 3T90A 4MFQA 4II9A 3KZWA 1ZRSA 1SQHA 4C9VA 4TWEA 1S7KA 1V0CA 3QAHA 1RTQA 4K3NA 4Q7AA 4OIWA 3SXNA 3VH9A 3BJ8A 2PJBA 1S60A 2EBJA 2REFA 2ABZA 4QC6A 3IWGA 2FT0A 3W6SA 4B6ZA 5JH9A 3IWWA 2R98A 4F0YA 1Z8XA 3B8GA 3MRUA 1FT7A 1KUVA 4MFLA 1IIDA 1Z9UA 4IIYA 3D7GA 5G21A 1TF8A 5LYDA 4WWVA 4MJXA 1VBGA 3PB8X 4QB9A 1S7LA 3PBEA 2AJ6A 4ZYQA 1RO5A 2POKA 2P6EA 2HQYA 1C3OB 3LD2A 4CGLA 5ISVA 5G22A 4J3GA 2XPOA 1YGHA 3NH5A 1LAMA 1X12A 2BO9A 4UEEA 4IHMA 3H8GA 1Z8LA 1YQEA 4FUUA 4XNHB 4C68A 1BO4A 1XBUA 1KZFA 4NGPA 2ZEMA 3D2MA 1PCAA 1Z4RA 4P4JA 1KWMA 3VRNA 1EO0A 5I0CA 5HVFA 5G20A 3FXTA 1VI4A 2WYRA 5AG6A 2FE7A 1J3LA 1ZG7A 1XF1A 2FL4A 5C88A 2GU2A 4HPSA 3FYNA 4C9EA 1Y0RA 4KSIA 4M6HA 1Z9EA 5G1ZA 3F9KC 2Z3LA 3BUOB 2Q7BA 2ZOGA 2ZEEA 3B3TA 2V77A 4NSQA 5DS0A 5A27A 3EIFA 3TT2A 3TLBA 3O8ZA 1HDQA 4KOTA 2DF5A 3SI2A 3TX8A 3WR7A 1TKHA 4CGOA 2G0BA 5J8CA 4KVXA 3QAYA 1IYLA 3R1KA 3BUNB 4C86A 4E94A 2GE3A 4RN7A 5IR2A 3LACA 3SR3A 4XPLA 2P6FA 4GS4A 5F49A 2QECA 4GM5A 1R61A 5F1YA 4KOUA 4CZ1A 4M85A 1VBHA 1I21A 2GLJA 3D7HA 3BLNA 1I12A 2VXKA 4KS9A 4A37A 2RC4A 3G3SA 3OB1B 4OMEA 1M1DA 4G1PA 4ORFA 3G8WA 1XMBA 1QSNA 4MFPA 4X2TA 3K4IA 3CDXA 3DSBA 5E96A 3GLJA 1A9XB 4UBRA 4JD6A 4YN3A 1K4JA 3FVLA 1YVHA 3SI1A 3FRMA 5K8PA 1TKFA 1IY7A 1UWYA 4OKOA 3R9FA 3NFZA 2D0OA 1X10A 2HUZA 3B3VA 4KOSA 4CYPA 3OP0A 4JLYA 1IOIA 2GANA 2I3CA 2B3VA 3D67A 1QSTA 4ZY2A 3R95A 2XEFA 4BPXB 4PXBA 3TCVA 2D4OA 4UFWA 3VARA 5EC4A 3T07A 1L0CA 2FS5A 1ON0A 4KVME 1M4IA 1FY7A 3TOAA 2B58A 1CM0A 4PXDA 1JDEA 3FMCA 1M4DA 2PR8A 2WUUA 4B14A 5LYIA 5IV0A 2ZW5A 5DWNA 2PJ0A 4L89A 4UFVA
chains in the Genus database with same CATH topology
1DE4C 2CF4A 5JGFA 4UIBA 4ONWA 2BOAA 3GB0A 4C8FA 1ARLA 3H8FA 2V8GA 3SJFA 3ISZA 5LRKA 1XRYA 3NA6A 2GREA 4NFRA 2AFXA 3FECA 1YSJA 3QNVA 3D7DA 1QQ9A 1CP6A 3VATA 2RB7A 3N5FA 3SJXA 3B7IA 2V8VA 4MCQA 3KASA 2PJ6A 3HLPA 3KQZA 4C9UA 2C6PA 2PJ7A 2J9AA 4ZI6A 1BAVA 4NJQA 1IGBA 4Z65A 4C8TA 5K8OA 3D7FA 1GYTA 4MCPA 2GLFA 4NGMA 1ZLHA 1LAPA 5F09A 4P4BA 2ZEPA 3KHZA 5LRGA 2PJCA 2OR4A 4YWYA 1M4LA 4ZX9A 3LMSA 2DEAA 1Z5RA 3CT9A 5J1QA 4OP4A 1LFWA 2PJ5A 3FJUA 3B3SA 4DYOA 1CBXA 3I6SA 3HUVA 1CG2A 4C85A 1R43A 2AFUA 3D68A 4OC0A 3KGQA 1AYEA 2O53A 1R3NA 1ZG9A 4MRIA 4FWUA 1V6CA 4UEZA 5K8MA 2QJ8A 5HVGA 4R7MA 2CTBA 2V8DA 2F8HA 3WT4A 4R8FA 5ELYA 5THWA 3WC6A 4MMOA 4X3RA 3RAMA 2AFMA 4DJLA 2EWBA 3WC5A 3B2YA 4EWTA 4DUKA 5LRJA 4R6TA 1ELMP 1BPMA 4WJBA 4OC3A 3PBBA 3SJGA 3KR5A 4OC1A 4ZY0A 3VTAA 4C8CA 4P6YA 2ZEGA 2GP4A 1AMPA 2PJ8A 4MCSA 1XJOA 4YU9A 5K8NA 4TJXA 2QVPA 4TJVA 2XEIA 2AFSA 6CPAA 2JBJA 1F2PA 3PEIA 2RFHA 4LQGA 4A38A 1Z2LA 3PB4X 2PJ1A 4TWEA 2XEGA 2PJ9A 4NGNA 2ANPA 2VL1A 4FBEA 7CPAA 3PRTA 4OIDA 4H2KA 4MHYA 3D66A 3T8WA 1ARMA 2C1CA 3KI9A 4CDKA 1LCPA 2PVVA 2OOTA 2ZEFA 4PXEA 1LANA 1EE3P 1ZG8A 4UIAA 5JM6A 1LOKA 2C6CA 2V8HA 2O4HA 4OC2A 2Q43A 1QMUA 3DLJA 3I74A 4F9VA 1CPSA 3FEDA 4A94A 3MN8A 4CPAA 4CDJA 5HVHA 3D4UA 1NSAA 2BCOA 5D29A 1XFOA 4IK2A 4NGSA 1TKJA 4C84A 4EMEA 1YMEA 3H8EA 3IO1A 4P10A 1HEEA 4JYWA 2ZOFA 2C5QA 5IB9A 3JRUA 3RZAA 5LYFA 1HDUA 3B3WA 5LYLA 3KR4A 3PB9X 1YW6A 4C9AA 3BXMA 3BHXA 4AXVA 1ZLIA 4C9RA 3V38A 3IFEA 3FEEA 2IMOA 3FX6A 4OC4A 2PCUA 1PYTB 2AFOA 2ZEOA 1TXRA 4A39A 3WC7A 3L2NA 3S9MA 1Y9ZA 4RUHA 2AFWA 4ZX8A 1BLLE 2AFZA 3DGVA 2HB6A 3V7ZA 2PVWA 1F57A 1VHOA 2PJ4A 2ZEDA 3IC1A 2Q51A 5HXDA 4F9UA 3LWUA 1Y7EA 2NSMA 1FNOA 1OBRA 3NH8A 3I1UA 2CTCA 1ELLP 4F8ZA 2ZENA 4X8IA 3BI0A 1DTDA 4C8PA 4UF4A 4R76A 4P4EA 3FF3A 4KNGE 2F7VA 3PB6X 4PQAA 3WABA 2PRQA 5D8NA 4IAVA 3S9LA 2Q4ZA 4MHPA 2XEJA 1CPXA 5CBMA 4C99A 2NYQA 2ZELA 3PFEA 4NGTA 1VHEA 2WZNA 2PJ3A 4ZY1A 3CPXA 3SJEA 1Q7LA 2PIYA 4FAIA 2QYVA 5CPAA 8CPAA 2EK9A 2CIJA 2FVGA 3PFOA 4C8AA 2JBKA 3IEHA 3KQXA 4NGQA 4P4FA 1TF9A 4OC5A 2PJ2A 4MHZA 4P44A 4BD9A 3K2KA 4W9YA 1YW4A 2IJZA 3B3CA 4MHNA 3IIBA 3K9TA 1CX8A 1YLOA 4MXUA 4P4DA 3RBUA 4P4IA 4JZ0A 3FH4A 1H8LA 3IJ3A 4TNUA 2EK8A 3ISXA 2ZEHA 5I4MA 3PB7X 4PXCA 1VGYA 4UEFA 2PJAA 3S9NA 1BPNA 3GUXA 4PPZA 2PIZA 1VIXA 1Y0YA 3KHXA 3B35A 2IQ6A 3NH4A 3KL9A 1F2OA 4P45A 3BI1A 1CP7A 2HC9A 3ICUA 3CPAA 4EFDA 3TC8A 1JQGA 2PE3A 3SI0A 2C6GA 4C8UA 4O23A 2G9DA 4MCRA 1WVMA 4NJRA 2JEWA 4NGRA 3KZWA 4C9VA 1RTQA 4K3NA 4Q7AA 4OIWA 3VH9A 2PJBA 2ABZA 5JH9A 4B6ZA 3IWWA 3MRUA 1FT7A 3D7GA 1TF8A 5LYDA 4WWVA 3PB8X 3PBEA 4ZYQA 2POKA 3NH5A 1LAMA 2BO9A 4UEEA 4IHMA 3H8GA 1Z8LA 4FUUA 1XBUA 2ZEMA 4NGPA 1PCAA 4P4JA 1KWMA 5HVFA 2WYRA 1ZG7A 1XF1A 2GU2A 4C9EA 1Y0RA 4KSIA 2ZOGA 2ZEEA 3B3TA 2V77A 5DS0A 3EIFA 1HDQA 3TX8A 3SI2A 1TKHA 4C86A 5IR2A 4GM5A 2GLJA 3D7HA 4A37A 4OMEA 4G1PA 1XMBA 4X2TA 3CDXA 3GLJA 4YN3A 3FVLA 3SI1A 5K8PA 1TKFA 1IY7A 1UWYA 4OKOA 3NFZA 3B3VA 2I3CA 3D67A 4ZY2A 2XEFA 4PXBA 3VARA 4PXDA 3FMCA 5LYIA 2PJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DE4 C;  2CF4 A;  5JGF A;  4UIB A;  4ONW A;  2BOA A;  3GB0 A;  4C8F A;  1ARL A;  3H8F A;  2V8G A;  3SJF A;  3ISZ A;  5LRK A;  1XRY A;  3NA6 A;  2GRE A;  4NFR A;  2AFX A;  3FEC A;  1YSJ A;  3QNV A;  3D7D A;  1QQ9 A;  1CP6 A;  3VAT A;  2RB7 A;  3N5F A;  3SJX A;  3B7I A;  2V8V A;  4MCQ A;  3KAS A;  2PJ6 A;  3HLP A;  3KQZ A;  4C9U A;  2C6P A;  2PJ7 A;  2J9A A;  4ZI6 A;  1BAV A;  4NJQ A;  1IGB A;  4Z65 A;  4C8T A;  5K8O A;  3D7F A;  1GYT A;  4MCP A;  2GLF A;  4NGM A;  1ZLH A;  1LAP A;  5F09 A;  4P4B A;  2ZEP A;  3KHZ A;  5LRG A;  2PJC A;  2OR4 A;  4YWY A;  1M4L A;  4ZX9 A;  3LMS A;  2DEA A;  1Z5R A;  3CT9 A;  5J1Q A;  4OP4 A;  1LFW A;  2PJ5 A;  3FJU A;  3B3S A;  4DYO A;  1CBX A;  3I6S A;  3HUV A;  1CG2 A;  4C85 A;  1R43 A;  2AFU A;  3D68 A;  4OC0 A;  3KGQ A;  1AYE A;  2O53 A;  1R3N A;  1ZG9 A;  4MRI A;  4FWU A;  1V6C A;  4UEZ A;  5K8M A;  2QJ8 A;  5HVG A;  4R7M A;  2CTB A;  2V8D A;  2F8H A;  3WT4 A;  4R8F A;  5ELY A;  5THW A;  3WC6 A;  4MMO A;  4X3R A;  3RAM A;  2AFM A;  4DJL A;  2EWB A;  3WC5 A;  3B2Y A;  4EWT A;  4DUK A;  5LRJ A;  4R6T A;  1ELM P;  1BPM A;  4WJB A;  4OC3 A;  3PBB A;  3SJG A;  3KR5 A;  4OC1 A;  4ZY0 A;  3VTA A;  4C8C A;  4P6Y A;  2ZEG A;  1AMP A;  2PJ8 A;  4MCS A;  1XJO A;  4YU9 A;  5K8N A;  4TJX A;  2QVP A;  4TJV A;  2XEI A;  2AFS A;  6CPA A;  2JBJ A;  1F2P A;  3PEI A;  2RFH A;  4LQG A;  4A38 A;  1Z2L A;  3PB4 X;  2PJ1 A;  4TWE A;  2XEG A;  2PJ9 A;  4NGN A;  2ANP A;  2VL1 A;  4FBE A;  7CPA A;  3PRT A;  4OID A;  4H2K A;  4MHY A;  3D66 A;  3T8W A;  1ARM A;  2C1C A;  3KI9 A;  4CDK A;  1LCP A;  2PVV A;  2OOT A;  2ZEF A;  4PXE A;  1LAN A;  1EE3 P;  1ZG8 A;  4UIA A;  5JM6 A;  1LOK A;  2C6C A;  2V8H A;  2O4H A;  4OC2 A;  2Q43 A;  1QMU A;  3DLJ A;  3I74 A;  4F9V A;  1CPS A;  3FED A;  4A94 A;  3MN8 A;  4CPA A;  4CDJ A;  5HVH A;  3D4U A;  1NSA A;  2BCO A;  5D29 A;  1XFO A;  4IK2 A;  4NGS A;  1TKJ A;  4C84 A;  4EME A;  1YME A;  3H8E A;  3IO1 A;  4P10 A;  1HEE A;  4JYW A;  2ZOF A;  5IB9 A;  3JRU A;  3RZA A;  5LYF A;  1HDU A;  3B3W A;  5LYL A;  3KR4 A;  3PB9 X;  1YW6 A;  4C9A A;  3BXM A;  3BHX A;  4AXV A;  1ZLI A;  4C9R A;  3V38 A;  3IFE A;  3FEE A;  2IMO A;  3FX6 A;  4OC4 A;  2PCU A;  1PYT B;  2AFO A;  2ZEO A;  1TXR A;  4A39 A;  3WC7 A;  3L2N A;  3S9M A;  1Y9Z A;  4RUH A;  2AFW A;  4ZX8 A;  1BLL E;  2AFZ A;  3DGV A;  2HB6 A;  3V7Z A;  2PVW A;  1F57 A;  1VHO A;  2PJ4 A;  2ZED A;  3IC1 A;  2Q51 A;  5HXD A;  4F9U A;  3LWU A;  1Y7E A;  2NSM A;  1FNO A;  1OBR A;  3NH8 A;  3I1U A;  2CTC A;  1ELL P;  4F8Z A;  2ZEN A;  4X8I A;  3BI0 A;  1DTD A;  4C8P A;  4UF4 A;  4R76 A;  4P4E A;  3FF3 A;  4KNG E;  2F7V A;  3PB6 X;  4PQA A;  3WAB A;  2PRQ A;  5D8N A;  4IAV A;  3S9L A;  2Q4Z A;  4MHP A;  2XEJ A;  1CPX A;  5CBM A;  4C99 A;  2NYQ A;  2ZEL A;  3PFE A;  4NGT A;  1VHE A;  2WZN A;  2PJ3 A;  4ZY1 A;  3CPX A;  3SJE A;  1Q7L A;  2PIY A;  4FAI A;  2QYV A;  5CPA A;  8CPA A;  2EK9 A;  2CIJ A;  2FVG A;  3PFO A;  4C8A A;  2JBK A;  3IEH A;  3KQX A;  4NGQ A;  4P4F A;  1TF9 A;  4OC5 A;  2PJ2 A;  4MHZ A;  4P44 A;  4BD9 A;  3K2K A;  4W9Y A;  1YW4 A;  2IJZ A;  3B3C A;  4MHN A;  3IIB A;  3K9T A;  1CX8 A;  1YLO A;  4MXU A;  4P4D A;  3RBU A;  4P4I A;  4JZ0 A;  3FH4 A;  1H8L A;  3IJ3 A;  4TNU A;  2EK8 A;  3ISX A;  2ZEH A;  5I4M A;  3PB7 X;  4PXC A;  1VGY A;  4UEF A;  2PJA A;  3S9N A;  1BPN A;  3GUX A;  4PPZ A;  2PIZ A;  1VIX A;  1Y0Y A;  3KHX A;  3B35 A;  2IQ6 A;  3NH4 A;  3KL9 A;  1F2O A;  4P45 A;  3BI1 A;  1CP7 A;  2HC9 A;  3ICU A;  3CPA A;  4EFD A;  3TC8 A;  1JQG A;  2PE3 A;  3SI0 A;  2C6G A;  4C8U A;  4O23 A;  2G9D A;  4MCR A;  1WVM A;  4NJR A;  2JEW A;  4NGR A;  3KZW A;  4C9V A;  1RTQ A;  4K3N A;  4Q7A A;  4OIW A;  3VH9 A;  2PJB A;  2ABZ A;  5JH9 A;  4B6Z A;  3IWW A;  3MRU A;  1FT7 A;  3D7G A;  1TF8 A;  5LYD A;  4WWV A;  3PB8 X;  3PBE A;  4ZYQ A;  2POK A;  3NH5 A;  1LAM A;  2BO9 A;  4UEE A;  4IHM A;  3H8G A;  1Z8L A;  4FUU A;  1XBU A;  2ZEM A;  4NGP A;  1PCA A;  4P4J A;  1KWM A;  5HVF A;  2WYR A;  1ZG7 A;  1XF1 A;  2GU2 A;  4C9E A;  1Y0R A;  4KSI A;  2ZOG A;  2ZEE A;  3B3T A;  2V77 A;  5DS0 A;  3EIF A;  1HDQ A;  3TX8 A;  3SI2 A;  1TKH A;  4C86 A;  4GM5 A;  2GLJ A;  3D7H A;  4A37 A;  4OME A;  4G1P A;  1XMB A;  4X2T A;  3CDX A;  3GLJ A;  4YN3 A;  3FVL A;  3SI1 A;  5K8P A;  1TKF A;  1IY7 A;  1UWY A;  4OKO A;  3NFZ A;  3B3V A;  2I3C A;  3D67 A;  4ZY2 A;  2XEF A;  4PXB A;  3VAR A;  4PXD A;  3FMC A;  5LYI A;  2PJ0 A; 
#chains in the Genus database with same CATH topology
 1DE4 C;  1YRE A;  3T5M A;  1QSO A;  2CF4 A;  3IU1 A;  3RYO A;  2B0A A;  3BJ7 A;  2ZXV A;  1P0H A;  4Y49 C;  4B11 A;  5JGF A;  4UIB A;  2DIK A;  4A2Z A;  4ONW A;  2BOA A;  4ZBG A;  3GB0 A;  4C8F A;  1ARL A;  2Z3M A;  2Q4Y A;  2V8G A;  3SJF A;  3H8F A;  3ISZ A;  2B3U A;  5LRK A;  5HKY A;  1WJT A;  1XRY A;  1JDB C;  3VWE A;  4CGP A;  4M8D A;  2Q0Y A;  3NA6 A;  2Y1M A;  2GRE A;  2G3A A;  2AFX A;  4NFR A;  4K30 A;  3FEC A;  4NF1 A;  3W91 A;  2X0S A;  2EZB A;  1YSJ A;  4M3S A;  3QNV A;  3I9S A;  3D7D A;  1S7N A;  2ZPA A;  1QSM A;  2E28 A;  2VZZ A;  4C7H A;  4KLV A;  1QQ9 A;  1CP6 A;  3VAT A;  2RB7 A;  2XPN A;  2X7B A;  1I1D A;  1S5K A;  3N5F A;  2EZA A;  2Z10 A;  4KOX A;  4LUA A;  5C82 A;  4IF5 A;  1UFH A;  2P6G A;  4CYN A;  5KTA A;  3OB2 B;  3SJX A;  3SHP A;  5F9M A;  1MJA A;  3B7I A;  2V8V A;  4R9M A;  4KUB A;  2J8R A;  4MCQ A;  2Z3N A;  3F0A A;  3KAS A;  2PJ6 A;  5F13 A;  2XPL A;  2Z0Z A;  1IU8 A;  1GHE A;  3HLP A;  3BUW B;  3KQZ A;  3NE8 A;  4C9U A;  1JWQ A;  4A4B A;  2C6P A;  4E5S A;  3TLA A;  4AVB A;  5JQ4 A;  4MI4 A;  2PJ7 A;  2J9A A;  1T36 B;  4ZI6 A;  1BAV A;  4U5Y A;  4UCM A;  3TYX A;  2OZU A;  3DR6 A;  4NJQ A;  5F47 A;  1IGB A;  2VQY A;  2OZG A;  4Z65 A;  4C8T A;  5K8O A;  3S6H A;  3D7F A;  4DNC A;  1GYT A;  4MCP A;  2GLF A;  3CXS A;  4KUA A;  4NGM A;  1ZLH A;  1LAP A;  4AVC A;  4MY3 A;  5F09 A;  2AUM A;  3PP9 A;  4P4B A;  2CY2 A;  4MY0 A;  2ZEP A;  4J0N A;  3KHZ A;  5LRG A;  2OH1 A;  4R57 A;  3R96 A;  2PJC A;  3EFA A;  3T9Y A;  3V8I A;  5AGE A;  5IB0 A;  2K5T A;  2OR4 A;  4YWY A;  4XPD C;  2C27 A;  1M4L A;  4ZX9 A;  4BPU B;  2Q04 A;  3LMS A;  2DEA A;  3S6K A;  3EZE A;  1Z5R A;  3T0T A;  2Q44 A;  3CT9 A;  2Z3P A;  5HMN A;  2YNE A;  2AUN A;  1B6B A;  1WWZ A;  5J1Q A;  2GIV A;  3VRR A;  1YVK A;  3VWD A;  4CO9 A;  4CGM A;  4OP4 A;  1LFW A;  2PJ5 A;  3FJU A;  1CE8 B;  3B3S A;  5IX3 A;  4DYO A;  1CBX A;  2R82 A;  1Q5X A;  3HUV A;  1CG2 A;  3I6S A;  4C85 A;  1R43 A;  1XE4 A;  5JYB A;  2AFU A;  3D68 A;  2PDO A;  3U1B A;  4OC0 A;  2JDC A;  3KGQ A;  1AYE A;  1M6V B;  1B47 A;  2O53 A;  1R3N A;  4ONU A;  1ZG9 A;  1Y9W A;  2BUE A;  3P2F A;  4KVO E;  5AG7 A;  3TOB A;  4COG A;  1FBV A;  4FWU A;  4MRI A;  1V6C A;  5HKZ A;  2B4D A;  4UEZ A;  5K8M A;  2QJ8 A;  5HVG A;  3NOJ A;  4R7M A;  2CTB A;  4JJX A;  1YK3 A;  2FIA A;  4JWP A;  1P4N A;  5FD8 A;  2N3A B;  2V8D A;  2WPX A;  2F8H A;  2EZC A;  4CYO A;  3OAK A;  4IIX A;  2F5I A;  2BEI A;  3VRQ A;  4PSW A;  3FIX A;  4R8F A;  3WT4 A;  5ELY A;  2R8V A;  2VI7 A;  2KCW A;  4MBU A;  3EXN A;  5THW A;  3WC6 A;  2FIW A;  4CAV A;  4B13 A;  4MMO A;  3PT1 A;  3E0K A;  4NEX A;  4X3R A;  4PV6 A;  2AFM A;  4UWI A;  3RAM A;  4A32 A;  2YNC C;  2EWB A;  4DJL A;  3WC5 A;  3B2Y A;  5H86 A;  2FXF A;  4DUK A;  4EWT A;  4YRH A;  2EVN A;  4A30 A;  4CAX A;  4KZT A;  4CS0 B;  1EZA A;  1VHS A;  5LRJ A;  4R6T A;  3TO6 A;  5BY0 A;  3NFQ A;  1ELM P;  3TLZ A;  4CRY B;  1NBW A;  1BPM A;  4WJB A;  4AB7 A;  4OC3 A;  3PBB A;  3SJG A;  3HPG G;  4JXQ A;  3LOD A;  4A33 A;  3KR5 A;  4OC1 A;  4ZY0 A;  4KOV A;  5HKW A;  4MFJ A;  3S6G A;  2PSW A;  3TLG A;  1S7F A;  5F46 A;  3VTA A;  4C8C A;  4P6Y A;  2ZEG A;  2GP4 A;  1AMP A;  2PJ8 A;  4MCS A;  1WK4 A;  1XJO A;  1Y9K A;  3DNS A;  3FB3 A;  4YU9 A;  2QVP A;  5K8N A;  4TJV A;  4H6Z A;  4TJX A;  1A2Z A;  2XEI A;  2AFS A;  6CPA A;  2FSR A;  2JBJ A;  2Y0M A;  2GFQ A;  3EO4 A;  4E8O A;  1F2P A;  3I3G A;  1RXT A;  4F0X A;  3KRV A;  3RNZ A;  3PEI A;  2RFH A;  4LQG A;  2ODF A;  1B87 A;  1IIC A;  1Z2L A;  2PJ1 A;  3PB4 X;  2XEG A;  2PJ9 A;  4NGN A;  2ANP A;  2EO8 A;  2VL1 A;  2DPT A;  3PRT A;  4OID A;  4H2K A;  7CPA A;  4MHY A;  1DIK A;  3D66 A;  1R57 A;  4MHD A;  3T8W A;  1MK4 A;  1ARM A;  2C1C A;  2VBQ A;  3KI9 A;  5GCN A;  4CDK A;  1LCP A;  4QUS A;  2PVV A;  1CS0 B;  3VRP A;  2OOT A;  1VKC A;  1M44 A;  1Z8W A;  3PGP A;  2ZEF A;  2B4J C;  1XIX A;  3DDD A;  4PXE A;  1LAN A;  2BL1 A;  1EE3 P;  1ZG8 A;  4RS2 A;  5AG4 A;  2OLS A;  3CXQ A;  3BUX B;  4UIA A;  1IOF A;  5JM6 A;  1LOK A;  4COB A;  4A95 A;  5K99 A;  3VRO A;  2C6C A;  3TO9 A;  3FNC A;  2OZH A;  2VZY A;  4AVA A;  2BSW A;  3G23 A;  4HNY B;  2O28 A;  3QB8 A;  4RR2 B;  4H1H A;  1PU9 A;  2V8H A;  2O4H A;  2J8M A;  4OC2 A;  2H5M A;  3H4Q A;  4OAD A;  2Q43 A;  2R1I A;  1QMU A;  2DPS A;  2R7H A;  2PRB A;  3DLJ A;  4LQ6 A;  2QML A;  3I74 A;  1PUA A;  4F9V A;  2VKZ G;  1CPS A;  3FED A;  2Q4V A;  2WSA A;  4A94 A;  1N71 A;  2B5G A;  3MN8 A;  4L8A A;  4CPA A;  4CDJ A;  5HVH A;  3U88 C;  3D4U A;  2AE6 A;  2CNS A;  3CXP A;  1NSA A;  2BCO A;  5D29 A;  4XPK A;  1XFO A;  2CNT A;  4IK2 A;  4NGS A;  1Q2D A;  5JPH A;  2HI6 A;  1TKJ A;  4F6A A;  4C84 A;  3C26 A;  5DWM A;  4CAW A;  4EME A;  3C8O A;  1LRZ A;  4A4C A;  1YME A;  3JUW A;  2JEV A;  4R3K A;  3H8E A;  1BXR B;  2HV2 A;  3IO1 A;  4P10 A;  4PK3 A;  3TFY A;  4MI1 A;  1HEE A;  3GIU A;  2B4B A;  5F48 A;  4JYW A;  1TIQ A;  2ZOF A;  5HH1 A;  5IB9 A;  2C5Q A;  3T05 A;  3JRU A;  2YGW A;  4HNX B;  3EZA A;  2WPW A;  3PZJ A;  3A9L A;  1HDU A;  1Y7R A;  5H84 A;  3RZA A;  3B3W A;  5LYF A;  2JLM A;  3P2H A;  2FM4 A;  3ZZI A;  2YNC A;  2YJV A;  1S3Z A;  4KSA A;  5LYL A;  3KR4 A;  4BPW B;  3PB9 X;  4FBE A;  2Y1N A;  1KBL A;  1YW6 A;  1XEB A;  4BTF A;  4KOW A;  1YR0 A;  2A4N A;  1XF8 A;  3BXM A;  4NXY A;  3RO0 A;  3BHX A;  2HRO A;  4C9A A;  5F5X A;  1KC7 A;  4AXV A;  1ZLI A;  4C9R A;  4IUS A;  3JTK A;  3V38 A;  1KUX A;  3IFE A;  3FEE A;  1IYK A;  1YX0 A;  2IMO A;  3FX6 A;  4OC4 A;  3D3S A;  2PCU A;  1PYT B;  5EBV A;  2AFO A;  3IU2 A;  4X5K A;  2ZEO A;  4ZGY B;  4Y49 B;  1TXR A;  4A39 A;  3WC7 A;  3F5B A;  3EC4 A;  2D4P A;  5EMI A;  1MJ9 A;  3L2N A;  4YGO A;  3R9G A;  3S9M A;  1Z4E A;  5KTC A;  1Y9Z A;  2Z3O A;  4KOR A;  4RUH A;  2AFW A;  4RI1 A;  4ZX8 A;  4UA3 A;  1YLE A;  1BLL E;  2AFZ A;  3ZJ0 A;  3DGV A;  4E0A A;  3D2P A;  1CJW A;  3D8P A;  2Z3K A;  4H6U A;  4Q36 A;  2HB6 A;  1Z8T A;  2VEZ A;  4MFZ A;  3V7Z A;  2PVW A;  3W6X A;  4B5O A;  1F57 A;  1VHO A;  2PJ4 A;  3UY5 A;  2ZED A;  3IC1 A;  3TLE A;  4C7I A;  1NMT A;  4FD6 A;  1Q2Y A;  1XMT A;  1QSR A;  5AXI A;  2Q51 A;  5HXD A;  4F9U A;  3NE7 A;  3TE4 A;  1NSL A;  4E2A A;  3LWU A;  3TO7 A;  1Y7E A;  2NSM A;  1FNO A;  1OBR A;  4C2Z A;  3NH8 A;  4Q38 A;  1KEE B;  3GKR A;  3GYA A;  2Q7S A;  4JVO A;  4XNH C;  4A38 A;  4M6G A;  2PQ8 A;  4YFJ A;  5FVJ A;  3I1U A;  2CTC A;  4GPL B;  1ELL P;  4F8Z A;  2ZEN A;  2MP0 A;  4X8I A;  3BI0 A;  1DTD A;  3R9E A;  4C8P A;  3VGO A;  2OB0 A;  3DR8 A;  4UCN A;  4UF4 A;  4R76 A;  4OLL A;  4P4E A;  1KUY A;  3FF3 A;  4BBH A;  1EZB A;  2ZW7 A;  5CNP A;  2XPP A;  3TTH A;  4KNG E;  2F7V A;  4FD5 A;  3PB6 X;  4PQA A;  4OAE A;  4CGN A;  2UV8 G;  1YVO A;  3IGR A;  3WAB A;  2PRQ A;  3EZB A;  5D8N A;  2PCN A;  4IAV A;  4UFX A;  3S9L A;  2Q4Z A;  4MHP A;  2XEJ A;  1CPX A;  3HMJ G;  4EVY A;  5CBM A;  4C99 A;  2NYQ A;  2ZEL A;  2B4D B;  1BOB A;  3PFE A;  5JVL A;  4NGT A;  2PC1 A;  2ZW4 A;  4HNW B;  3BUM B;  1XOV A;  1VHE A;  4I49 A;  2WZN A;  2I79 A;  2PJ3 A;  4NCZ A;  4ZY1 A;  3CPX A;  4CAF A;  3SJE A;  5KTD A;  1Q7L A;  3HPH E;  2NMT A;  2PIY A;  4FAI A;  4FD4 A;  2QYV A;  5CPA A;  4QVT A;  8CPA A;  2QIR A;  2YND A;  2EK9 A;  2CIJ A;  2FVG A;  4C2Y A;  3PFO A;  4C8A A;  3FBU A;  4UCP A;  4MFK A;  4KLW A;  3ZNI A;  2IL4 A;  3N7Z A;  2JBK A;  3IEH A;  2OU2 A;  4CAE A;  3PLF B;  2HWG A;  3KQX A;  4NGQ A;  4P4F A;  4INJ A;  1TF9 A;  2G3T A;  4OC5 A;  2PJ2 A;  4MHZ A;  4P44 A;  4R87 A;  4BD9 A;  4HKF A;  4KOY A;  3K2K A;  2P0W A;  4W9Y A;  4FD7 A;  4JXR A;  2ARH A;  1YW4 A;  2IJZ A;  3B3C A;  4AG7 A;  1NXJ A;  4MHN A;  3IIB A;  3K9T A;  1CX8 A;  4BIN A;  2FCK A;  4QBJ A;  1YLO A;  3GY9 A;  3K9U A;  4MJ8 A;  3KKW A;  3PFV A;  4MXU A;  1ZYM A;  3SXO A;  2DLA A;  1AUG A;  2REE A;  4P4D A;  4PSX A;  1ZL0 A;  5J3X A;  3RBU A;  2JDD A;  3GJZ A;  4A31 A;  4P4I A;  4JZ0 A;  2PR1 A;  4B12 A;  4H89 A;  3FH4 A;  1GGO A;  1H8L A;  3IJ3 A;  4TNU A;  1J4J A;  2EK8 A;  3ISX A;  4AG9 A;  3IWE A;  2ZEH A;  4B5P B;  3PB7 X;  5I4M A;  4PXC A;  3S6F A;  3F8K A;  3TLY A;  1VGY A;  1M4G A;  4PK2 A;  4UEF A;  4BMH A;  1MJB A;  2DXQ A;  2PJA A;  5J8F A;  2D0P A;  2Z11 A;  3JVN A;  5AG5 A;  1OZP A;  4EYS A;  3S9N A;  1BPN A;  3GUX A;  2YJT A;  4PPZ A;  2I00 A;  1IB1 E;  2B5G B;  2CNM A;  4GXH A;  4LX9 A;  2EUI A;  2PIZ A;  2J8N A;  4CYQ A;  3OWC A;  1VIX A;  1Y0Y A;  3EY5 A;  3KHX A;  4R3L A;  4KSF A;  4UWJ A;  3B35 A;  4XPD B;  2IQ6 A;  3NH4 A;  4CRZ B;  3KL9 A;  4B5P A;  1F2O A;  2ZW6 A;  5A28 A;  1C30 B;  2CXA A;  4U9Y A;  4P45 A;  3BI1 A;  4B10 A;  1CP7 A;  1NE9 A;  2HC9 A;  3ICU A;  2ATR A;  4C2X A;  3CPA A;  4EFD A;  3TC8 A;  1JQG A;  2PE3 A;  3SI0 A;  5BWA B;  3TLC A;  2CBL A;  2C6G A;  4C8U A;  1ZO0 A;  1U6M A;  1Q2C A;  4O23 A;  2G9D A;  3CZX A;  3TLG B;  4MCR A;  4M6I A;  1WVM A;  4U9Z A;  4NJR A;  2JEW A;  4NGR A;  3H5Z A;  3MGD A;  3T90 A;  4MFQ A;  4II9 A;  3KZW A;  1ZRS A;  1SQH A;  4C9V A;  4TWE A;  1S7K A;  1V0C A;  3QAH A;  1RTQ A;  4K3N A;  4Q7A A;  4OIW A;  3SXN A;  3VH9 A;  3BJ8 A;  2PJB A;  1S60 A;  2EBJ A;  2REF A;  2ABZ A;  4QC6 A;  3IWG A;  2FT0 A;  3W6S A;  4B6Z A;  5JH9 A;  3IWW A;  2R98 A;  4F0Y A;  1Z8X A;  3B8G A;  3MRU A;  1FT7 A;  1KUV A;  4MFL A;  1IID A;  1Z9U A;  4IIY A;  3D7G A;  5G21 A;  1TF8 A;  5LYD A;  4WWV A;  4MJX A;  1VBG A;  3PB8 X;  4QB9 A;  1S7L A;  3PBE A;  2AJ6 A;  4ZYQ A;  1RO5 A;  2POK A;  2P6E A;  2HQY A;  1C3O B;  3LD2 A;  4CGL A;  5ISV A;  5G22 A;  4J3G A;  2XPO A;  1YGH A;  3NH5 A;  1LAM A;  1X12 A;  2BO9 A;  4UEE A;  4IHM A;  3H8G A;  1Z8L A;  1YQE A;  4FUU A;  4XNH B;  4C68 A;  1BO4 A;  1XBU A;  1KZF A;  4NGP A;  2ZEM A;  3D2M A;  1PCA A;  1Z4R A;  4P4J A;  1KWM A;  3VRN A;  1EO0 A;  5I0C A;  5HVF A;  5G20 A;  3FXT A;  1VI4 A;  2WYR A;  5AG6 A;  2FE7 A;  1J3L A;  1ZG7 A;  1XF1 A;  2FL4 A;  5C88 A;  2GU2 A;  4HPS A;  3FYN A;  4C9E A;  1Y0R A;  4KSI A;  4M6H A;  1Z9E A;  5G1Z A;  3F9K C;  2Z3L A;  3BUO B;  2Q7B A;  2ZOG A;  2ZEE A;  3B3T A;  2V77 A;  4NSQ A;  5DS0 A;  5A27 A;  3EIF A;  3TT2 A;  3TLB A;  3O8Z A;  1HDQ A;  4KOT A;  2DF5 A;  3SI2 A;  3TX8 A;  3WR7 A;  1TKH A;  4CGO A;  2G0B A;  5J8C A;  4KVX A;  3QAY A;  1IYL A;  3R1K A;  3BUN B;  4C86 A;  4E94 A;  2GE3 A;  4RN7 A;  5IR2 A;  3LAC A;  3SR3 A;  4XPL A;  2P6F A;  4GS4 A;  5F49 A;  2QEC A;  4GM5 A;  1R61 A;  5F1Y A;  4KOU A;  4CZ1 A;  4M85 A;  1VBH A;  1I21 A;  2GLJ A;  3D7H A;  3BLN A;  1I12 A;  2VXK A;  4KS9 A;  4A37 A;  2RC4 A;  3G3S A;  3OB1 B;  4OME A;  1M1D A;  4G1P A;  4ORF A;  3G8W A;  1XMB A;  1QSN A;  4MFP A;  4X2T A;  3K4I A;  3CDX A;  3DSB A;  5E96 A;  3GLJ A;  1A9X B;  4UBR A;  4JD6 A;  4YN3 A;  1K4J A;  3FVL A;  1YVH A;  3SI1 A;  3FRM A;  5K8P A;  1TKF A;  1IY7 A;  1UWY A;  4OKO A;  3R9F A;  3NFZ A;  2D0O A;  1X10 A;  2HUZ A;  3B3V A;  4KOS A;  4CYP A;  3OP0 A;  4JLY A;  1IOI A;  2GAN A;  2I3C A;  2B3V A;  3D67 A;  1QST A;  4ZY2 A;  3R95 A;  2XEF A;  4BPX B;  4PXB A;  3TCV A;  2D4O A;  4UFW A;  3VAR A;  5EC4 A;  3T07 A;  1L0C A;  2FS5 A;  1ON0 A;  4KVM E;  1M4I A;  1FY7 A;  3TOA A;  2B58 A;  1CM0 A;  4PXD A;  1JDE A;  3FMC A;  1M4D A;  2PR8 A;  2WUU A;  4B14 A;  5LYI A;  5IV0 A;  2ZW5 A;  5DWN A;  2PJ0 A;  4L89 A;  4UFV A; 
#chains in the Genus database with same CATH homology
 1DE4 C;  2CF4 A;  5JGF A;  4UIB A;  4ONW A;  2BOA A;  3GB0 A;  4C8F A;  1ARL A;  3H8F A;  2V8G A;  3SJF A;  3ISZ A;  5LRK A;  1XRY A;  3NA6 A;  2GRE A;  4NFR A;  2AFX A;  3FEC A;  1YSJ A;  3QNV A;  3D7D A;  1QQ9 A;  1CP6 A;  3VAT A;  2RB7 A;  3N5F A;  3SJX A;  3B7I A;  2V8V A;  4MCQ A;  3KAS A;  2PJ6 A;  3HLP A;  3KQZ A;  4C9U A;  2C6P A;  2PJ7 A;  2J9A A;  4ZI6 A;  1BAV A;  4NJQ A;  1IGB A;  4Z65 A;  4C8T A;  5K8O A;  3D7F A;  1GYT A;  4MCP A;  2GLF A;  4NGM A;  1ZLH A;  1LAP A;  5F09 A;  4P4B A;  2ZEP A;  3KHZ A;  5LRG A;  2PJC A;  2OR4 A;  4YWY A;  1M4L A;  4ZX9 A;  3LMS A;  2DEA A;  1Z5R A;  3CT9 A;  5J1Q A;  4OP4 A;  1LFW A;  2PJ5 A;  3FJU A;  3B3S A;  4DYO A;  1CBX A;  3I6S A;  3HUV A;  1CG2 A;  4C85 A;  1R43 A;  2AFU A;  3D68 A;  4OC0 A;  3KGQ A;  1AYE A;  2O53 A;  1R3N A;  1ZG9 A;  4MRI A;  4FWU A;  1V6C A;  4UEZ A;  5K8M A;  2QJ8 A;  5HVG A;  4R7M A;  2CTB A;  2V8D A;  2F8H A;  3WT4 A;  4R8F A;  5ELY A;  5THW A;  3WC6 A;  4MMO A;  4X3R A;  3RAM A;  2AFM A;  4DJL A;  2EWB A;  3WC5 A;  3B2Y A;  4EWT A;  4DUK A;  5LRJ A;  4R6T A;  1ELM P;  1BPM A;  4WJB A;  4OC3 A;  3PBB A;  3SJG A;  3KR5 A;  4OC1 A;  4ZY0 A;  3VTA A;  4C8C A;  4P6Y A;  2ZEG A;  2GP4 A;  1AMP A;  2PJ8 A;  4MCS A;  1XJO A;  4YU9 A;  5K8N A;  4TJX A;  2QVP A;  4TJV A;  2XEI A;  2AFS A;  6CPA A;  2JBJ A;  1F2P A;  3PEI A;  2RFH A;  4LQG A;  4A38 A;  1Z2L A;  3PB4 X;  2PJ1 A;  4TWE A;  2XEG A;  2PJ9 A;  4NGN A;  2ANP A;  2VL1 A;  4FBE A;  7CPA A;  3PRT A;  4OID A;  4H2K A;  4MHY A;  3D66 A;  3T8W A;  1ARM A;  2C1C A;  3KI9 A;  4CDK A;  1LCP A;  2PVV A;  2OOT A;  2ZEF A;  4PXE A;  1LAN A;  1EE3 P;  1ZG8 A;  4UIA A;  5JM6 A;  1LOK A;  2C6C A;  2V8H A;  2O4H A;  4OC2 A;  2Q43 A;  1QMU A;  3DLJ A;  3I74 A;  4F9V A;  1CPS A;  3FED A;  4A94 A;  3MN8 A;  4CPA A;  4CDJ A;  5HVH A;  3D4U A;  1NSA A;  2BCO A;  5D29 A;  1XFO A;  4IK2 A;  4NGS A;  1TKJ A;  4C84 A;  4EME A;  1YME A;  3H8E A;  3IO1 A;  4P10 A;  1HEE A;  4JYW A;  2ZOF A;  2C5Q A;  5IB9 A;  3JRU A;  3RZA A;  5LYF A;  1HDU A;  3B3W A;  5LYL A;  3KR4 A;  3PB9 X;  1YW6 A;  4C9A A;  3BXM A;  3BHX A;  4AXV A;  1ZLI A;  4C9R A;  3V38 A;  3IFE A;  3FEE A;  2IMO A;  3FX6 A;  4OC4 A;  2PCU A;  1PYT B;  2AFO A;  2ZEO A;  1TXR A;  4A39 A;  3WC7 A;  3L2N A;  3S9M A;  1Y9Z A;  4RUH A;  2AFW A;  4ZX8 A;  1BLL E;  2AFZ A;  3DGV A;  2HB6 A;  3V7Z A;  2PVW A;  1F57 A;  1VHO A;  2PJ4 A;  2ZED A;  3IC1 A;  2Q51 A;  5HXD A;  4F9U A;  3LWU A;  1Y7E A;  2NSM A;  1FNO A;  1OBR A;  3NH8 A;  3I1U A;  2CTC A;  1ELL P;  4F8Z A;  2ZEN A;  4X8I A;  3BI0 A;  1DTD A;  4C8P A;  4UF4 A;  4R76 A;  4P4E A;  3FF3 A;  4KNG E;  2F7V A;  3PB6 X;  4PQA A;  3WAB A;  2PRQ A;  5D8N A;  4IAV A;  3S9L A;  2Q4Z A;  4MHP A;  2XEJ A;  1CPX A;  5CBM A;  4C99 A;  2NYQ A;  2ZEL A;  3PFE A;  4NGT A;  1VHE A;  2WZN A;  2PJ3 A;  4ZY1 A;  3CPX A;  3SJE A;  1Q7L A;  2PIY A;  4FAI A;  2QYV A;  5CPA A;  8CPA A;  2EK9 A;  2CIJ A;  2FVG A;  3PFO A;  4C8A A;  2JBK A;  3IEH A;  3KQX A;  4NGQ A;  4P4F A;  1TF9 A;  4OC5 A;  2PJ2 A;  4MHZ A;  4P44 A;  4BD9 A;  3K2K A;  4W9Y A;  1YW4 A;  2IJZ A;  3B3C A;  4MHN A;  3IIB A;  3K9T A;  1CX8 A;  1YLO A;  4MXU A;  4P4D A;  3RBU A;  4P4I A;  4JZ0 A;  3FH4 A;  1H8L A;  3IJ3 A;  4TNU A;  2EK8 A;  3ISX A;  2ZEH A;  5I4M A;  3PB7 X;  4PXC A;  1VGY A;  4UEF A;  2PJA A;  3S9N A;  1BPN A;  3GUX A;  4PPZ A;  2PIZ A;  1VIX A;  1Y0Y A;  3KHX A;  3B35 A;  2IQ6 A;  3NH4 A;  3KL9 A;  1F2O A;  4P45 A;  3BI1 A;  1CP7 A;  2HC9 A;  3ICU A;  3CPA A;  4EFD A;  3TC8 A;  1JQG A;  2PE3 A;  3SI0 A;  2C6G A;  4C8U A;  4O23 A;  2G9D A;  4MCR A;  1WVM A;  4NJR A;  2JEW A;  4NGR A;  3KZW A;  4C9V A;  1RTQ A;  4K3N A;  4Q7A A;  4OIW A;  3VH9 A;  2PJB A;  2ABZ A;  5JH9 A;  4B6Z A;  3IWW A;  3MRU A;  1FT7 A;  3D7G A;  1TF8 A;  5LYD A;  4WWV A;  3PB8 X;  3PBE A;  4ZYQ A;  2POK A;  3NH5 A;  1LAM A;  2BO9 A;  4UEE A;  4IHM A;  3H8G A;  1Z8L A;  4FUU A;  1XBU A;  2ZEM A;  4NGP A;  1PCA A;  4P4J A;  1KWM A;  5HVF A;  2WYR A;  1ZG7 A;  1XF1 A;  2GU2 A;  4C9E A;  1Y0R A;  4KSI A;  2ZOG A;  2ZEE A;  3B3T A;  2V77 A;  5DS0 A;  3EIF A;  1HDQ A;  3TX8 A;  3SI2 A;  1TKH A;  4C86 A;  5IR2 A;  4GM5 A;  2GLJ A;  3D7H A;  4A37 A;  4OME A;  4G1P A;  1XMB A;  4X2T A;  3CDX A;  3GLJ A;  4YN3 A;  3FVL A;  3SI1 A;  5K8P A;  1TKF A;  1IY7 A;  1UWY A;  4OKO A;  3NFZ A;  3B3V A;  2I3C A;  3D67 A;  4ZY2 A;  2XEF A;  4PXB A;  3VAR A;  4PXD A;  3FMC A;  5LYI A;  2PJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...