3SK5A

Crystal structure of staphylococcal nuclease variant delta+phs v39d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLDDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V39D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sk5A00
4PMCA 3U9OA 5HURA 1KDBA 2M00A 5M9OA 5CV4A 2F0FA 5J1ZA 3OSOA 1EYCA 3NUCA 3NP8A 1EY5A 3MHBA 4QB4A 4S3SA 3TP5A 5KIXA 2EY1A 2KQ3A 2OXPA 1EY9A 1ENCA 2F0IA 3HEJA 4KD3A 1EY4A 4WORA 3T13A 5IGBA 5I9OA 2SNSA 5C4HA 3OWFA 3TP6A 4B9WA 2F0DA 2F0WA 3EROA 2EYMA 4E6IA 5CC4A 2KHSA 4HMIA 4OL7A 4QMGA 2F0NA 1STNA 5IGGA 1SYDA 2PW5A 3ERQA 2SOBA 2F0QA 3P1HA 2PZUA 4K5XA 1SNPA 4DF7A 4DU9A 1SNCA 1SNOA 4TRDA 4WRDA 5J22A 4K14A 4K8IA 1EZ8A 2PYKA 5IGDA 1EY0A 3SK8A 4IUNA 3SXHA 4KTAA 4B9XA 2F0SA 5J39A 3PMFA 1JOOA 4J6HA 1SYCA 1TT2A 2F0PA 1TQOA 4G57A 3RUZA 3DHQA 4F8MA 1KABA 4ZQ3A 4N9TA 1SYGA 5I6YA 1JORA 5CV9A 4K5VA 5JAVA 1KDAA 4K8JA 2EYJA 4NKLA 1RKNA 1STBA 1A3UA 3NQTA 4ZUIA 2F0UA 3H6MA 4ODGA 2F0OA 1EYDA 1SYEA 3MXPA 4K2KA 2PZTA 3VA5A 4HTHA 3E5SA 4IALA 5DEHA 2F0KA 1A2UA 5F2DA 4R8NA 4DFAA 4K6DA 2NUCA 2RKSA 5KYLA 4EQPA 2EY6A 4ZUJA 3SK5A 4KY7A 4LAAA 1F2MA 4KV6A 3P75A 3SR1A 3D4WA 3MVVA 4PNYA 2EY2A 3R3OA 3OMGA 4IZ8A 3MEHA 1JOQA 5HGTA 1U9RA 2EYFA 1F2YA 4K2LA 4ID6A 4EQNA 1NSNS 2PW7A 1IHZA 1SNMA 5JOBA 2F0TA 3EJIA 2F3WA 4KJNA 5CV8A 5C3WA 5IOCA 3T16A 2F3VA 2SNMA 3DMUA 3D6CA 2WACA 3S9WA 5C6AA 4F7XA 2EY5A 4KJOA 1KAAA 3NHHA 1SYBA 1SNQA 2EYHA 2EYPA 2EYLA 1A3VA 3D4DA 3D8GA 3C1FA 4KY5A 4N9PA 4RKBA 5E1FA 5IGCA 5CGKA 5CV5A 4NP5A 1EQVA 5C3XA 3QB3A 2PQEA 2QDBA 2O4XA 1ENAA 2F0JA 3HZXA 5KYIA 1JOKA 5NUCA 4MIUA 4HMJA 5C5LA 3QOLA 2PZWA 4KY6A 5I6WA 4YIJA 1EY8A 2RDFA 4K5WA 4RKLA 3TMEA 3MZ5A 3TP7A 3LX0A 2F0GA 1EY6A 4H7BA 3BDCA 4PMBA 2HQEA 1STAA 3OMCA 2EYOA 2F0HA 4QF4A 5IIFA 1A2TA 5IGEA 3NK9A 1A3TA 1F2ZA 2ENBA 5KEEA 5C4ZA 5EKKA 5ISRA 1TR5A 2F0VA 5IGFA 5CR3A 3ITPA 4NDXA 2F0MA 4J1MA 4EQOA 1STHA 3EVQA 5EKLA 1STYA 3SHLA 1EZ6A 4I65A 3QOJA 3TP8A 5EGTA 2OF1A 4KHVA 5E3FA 4EVOA 3SK4A 2OEOA 5C5MA 3V2TA 2RBMA 4NMZA 2LKVA 1STGA 1SNDA 5I9PA 5CV6A 5DAUA 1EYAA 1NUCA 3BDLA 2F0LA 5IODA 5KGUA 2EXZA 4DGZA 1II3A 3SK6A 1KDCA 1AEXA 1SYFA 3NXWA 2F0EA 5CV7A 5K5PA 1EY7A 4ME5A 4KD4A 5KRUA 3C1EA
chains in the Genus database with same CATH superfamily
1TWGB 1M8AA 4YCVA 5E4WC 2JA6G 3I56A 1Q1BA 1ENCA 3KF8A 5GAHC 4BY1B 1VQ7A 4LF8L 5IGBA 3S16H 3E9HA 3PIO3 2DUDA 2UUBL 1I3QB 2IWHA 2I46A 4EGVA 5C0XG 1NNXA 1I50B 1WD1A 1S40A 4K5XA 4QY7A 4XXEA 4V0BA 4KKUA 3DUZA 4HJ9A 2R7FA 3SXHA 1CKMA 1I4GA 4DAMA 4B3SQ 1OXUA 4CDCC 1HZCA 3TDQA 1CZWA 1TQOA 3IL8A 5CV9A 4JK1C 4JI6L 2BCOA 5IYDG 1STBA 1E2ZA 2IX1A 4X6AH 2V1CC 2B8GA 4IALA 3VR2A 1PFSA 4JI7Q 3F2BA 2HCCA 2MPMA 2EY6A 1EWHA 4FO2A 3GV3A 4CKCA 3NENA 3S1MB 3MEHA 5IT9E 4EQNA 4OGQC 1Q82C 5JOBA 4A3FB 2LS01 3KF8B 5CV8A 4C3HG 5IWAL 1WVLA 3NWTA 4CJ1B 3E6ZX 1SNQA 2DY8A 5T1IA 4IUPA 5CV5A 1HTPA 2OTLA 1FNUA 2MP1A 3HZXA 3NSWA 3D0FA 3PO3G 3I55A 2K52A 1JJ2A 5FKAC 4A3KG 1I4RA 4BA2I 2HDLA 3TMEA 1AFPA 1D6EC 1EY6A 1B3QA 3I91A 1QOHA 5D65A 4X64Q 3DWAA 2K5WA 2F0VA 1IYJB 3A7AB 2F0MA 1BF4A 2WAQG 3SE0A 3S15B 3HG9A 2E5LQ 1I6HB 1N9WA 3R2IA 5C0XJ 3SEBA 2EZVA 1T5EA 4R4IA 2KCCA 3HFZB 4ZYSA 4JI3Q 4A3DB 2F0EA 1G291 1HFGA 3Q8DA 3K5LA 3GTOH 4NW2A 3AFQA 1U4PA 4K6LA 3CCUA 4JOIC 3UDXA 5JJIA 2NZOA 2E2DC 3T1YQ 4XDXA 5M5WH 1RDPD 2NVTH 3E0JA 3HOWB 5C4JH 3CC7A 2R61A 3HEJA 5C4HA 3PQIA 1VQOA 3GO5A 1N8RC 1MKHA 4P71A 5JPMC 1CHPD 3ERQA 3C2PA 4BBRG 2NB0A 4DU9A 3I4NG 1K73C 1OTCA 1I4PA 1QILA 1EZ8A 1EY0A 4G7OC 4TQUS 4FNFA 3V96A 2AQ3B 3J81L 2D5DA 2ZT9C 4MTNA 5JAVA 4OX9L 2JYOA 3FPPA 4CKBA 2EYJA 4NKLA 3U4VA 5CYUA 2B2TA 4HTHA 4L5TA 5DEHA 1Z9FA 2K5DA 4KMUC 1N32L 2ZM6L 4OEMB 4G7ZC 1HZBA 2NZHA 3CCQA 3VA7A 3D4WA 4IZ8A 4DV4L 3NTIA 3J7A5 3L3OC 4L5QA 1Q8KA 5M5XH 3J7ZC 2OCEA 2I5LX 3G7LA 4APVA 1FNVA 3J80L 2EJMA 3H0GH 4C3IG 1JWMD 2E8GA 5C3WA 3A54A 2WACA 4Q0FA 1PH5A 2PCFB 4NXNQ 1SN8A 3AYHB 3T56B 4DV2L 3CQZH 4PMWA 1KRTA 4DV7L 4HJ5A 4WJ3M 2UXBL 1TU2B 3E0EA 3Q6SA 4FF4A 1BO0A 3GTQH 5NUCA 2Z9HA 1JJGA 3GTLB 3TP7A 1G6ZA 4H7BA 4LUOA 1K3RA 5BR8L 1PTOF 3S1RB 1P8LA 3OMCA 2O5JC 1YNNC 3I4OA 5EKKA 1HNWL 1D7QA 1K0RA 3EVQA 4RG1A 3TQYA 2QEJC 1E24A 2VY3A 2BDNA 3MFYA 2Z6KA 2RF4A 2WAQE 4LJZC 3S1QH 3VYSA 5C3EG 3FP9A 2B8FA 4KLKA 3I4MG 2GVAA 2CH4W 2E75C 3EIVA 4FXGC 3SK6A 3PO2B 1WCMG 1MIUA 1K8AC 4DUZL 5CBEE 4BY7G 1SFOB 4A3LH 1DGSA 4DV1L 4ID6A 1MJEA 1IBLQ 1WOCA 1E7ZA 4LF9Q 3VR6A 5M9OA 3BZDB 3VYRA 3CCJA 1XNQQ 2FMMA 4A3CG 1UE7A 2VNUD 1QZGA 3AMUA 1CTMA 2Q8IB 2JA7H 1D2BA 3ZJYC 4YY3Q 1JB7A 2F0WA 3I73A 3L0OA 5IP7G 2IY5B 1PVOA 4KKTA 4X3SA 2NVQB 4DPGA 5A35A 4OIJA 4P2CB 2CVRA 2H5XA 1LTGD 4BY1H 4HSPA 2B2WA 1YHQA 1VMPA 1JOOA 2E2IB 2FMCA 2VUMG 2B2YC 1SRUA 4XQQA 4N9TA 1AZQA 4FYDA 1I50H 5JEAH 1K28A 1KHIA 4ABNA 3GTGB 3MXNB 3IFDA 4ODGA 5IYCG 1EYDA 3GV6A 1IYUA 4TKOB 3H09A 3Q0AA 2L11A 4EQPA 1UE5A 4ZUJA 4JYAQ 1F2MA 4ZRZA 1QNUA 2A68C 2K14A 5FK9C 4K2LA 1F2YA 1L1OC 4OELB 3CCMA 2BH8A 3K8AA 2QW7A 4YWMA 2UUCQ 4PZ8A 2ICIA 1N33L 1H9MA 5E7NA 2F3VA 3STBC 3GTPB 1KNAA 3I2ZA 3RNUA 5IGCA 2XWBB 5E1FA 1L2FA 3UDFA 1BDOA 2L5TA 1IBKL 1A6XA 2IL8A 4MIUA 1SE3A 5C5LA 3KOJA 3HOZH 2RDFA 2Q8RE 1VQKA 1CHQD 3MZ5A 1CQFA 3K57A 1WYDA 3J7AV 1BCPC 1MGSA 1F2LA 1S72A 2YU9B 4MN3A 2JXMB 5ISRA 2Q8TA 2EXDA 4R4OA 1VQDA 2UUAL 4K0KL 1JJCB 1S5CD 4PZ6A 3G4SA 3TP8A 3RR5A 2OF1A 4LFBQ 1TWHH 1SMYC 5C5MA 5FLMH 1QVFA 3CXCA 4CBVA 3E9IA 4DR5L 3KLSA 1NR4A 2EXZA 1AEXA 4X66Q 3D4RA 5KRUA 1HR0Q 5FO8B 2IX3A 2CHBD 4GNXA 2VQFQ 1DOMA 5J1ZA 1XXGA 4KHPL 1B4OA 2A6EC 2JP1A 4DV6Q 1XMQL 3HOXG 4LF4Q 2RVLA 4A3EG 1U0LA 1LTRD 4H0LC 2ZTDA 2SNSA 4E6IA 2JA8B 4KHZA 5IP9H 2NVYH 4HMIA 2KA7A 2G9HD 1K0SA 1CK1A 2WFWA 2VL6A 2QKIC 5J22A 1IKMA 3OW2A 3BVZA 1EOVA 3PGZA 5GADC 3ULJA 3MFGA 1CM9A 2M2LA 4A3GG 4K5VA 1KDAA 1RF2D 1ML0D 3K5OA 3K6OA 4X65L 1HA5A 2PZTA 3FEWX 3VA5A 3OTOL 1XPOA 1EEFD 5LMNQ 4R8NA 5GAEC 3K5NA 3K58A 1TY2A 4DKAC 3OPOA 2L55A 2YV5A 3CP0A 4JI5Q 3MVVA 4P74A 1TXYA 1YJ9A 1SEBD 1I5FA 4FXDA 4DAYA 2MNAA 1LTAD 1QE6A 2HQLA 3Q22A 4KJOA 3NHHA 2Z0SA 4MNOA 3D8GA 1GUSA 4LW1A 1GD7A 1HHVA 5KNCA 1LV9A 4C3JH 4ULLA 3QB3A 1ENAA 2E2JB 3DEPA 3S14B 2MO1A 2Z4HA 3BZCA 4RKLA 4YHHQ 5COYA 5M3FB 1JT8A 1HJPA 1L0YB 3BZKA 2JK8A 1F9PA 3H0GG 5CBAE 2P5ZX 1HNXQ 1FJGL 1MI2A 2EJGC 4DUYQ 3S1RH 2LKVA 4B3TQ 4BBSB 2XNAC 3NTKA 3J81j 1II3A 5K5PA 1SJHD 1TWAB 4TVAB 4KD4A 2CH4A 2EQSA 2NYZD 3FDTA 1M4VA 2BA1A 3MHBA 1WTWA 4RGTA 2R92G 4HCEA 4A75A 5JJZA 4IN3A 1H9RA 5G3LD 3GTOB 2F0IA 1G91A 2UXDQ 1J9OA 1CKOA 1IYVA 3TP6A 1SFOH 1QG7A 5AFWA 5M5WB 5LL6S 2NVTB 5C4XG 4YCUA 2Y0SB 1CKNA 4B3SL 4AYBG 3GDEA 5C4JB 4DF7A 1IKLA 4TRDA 3I70A 3WOEA 3K7UC 2LMCB 3ZYYX 1SXTA 4A3LG 4IUNA 1X3PA 2DGYA 3PMFA 3R2TA 1J8IA 3DHQA 4JI7L 4KN7C 2NVQH 1QJOA 1Y1WB 4ZUIA 4DV3Q 5ELCA 1QZHA 1F77A 5F2DA 3S2DH 2Y0SE 2IX0A 2J0TD 4NPSA 1W6JA 1LTTD 1VQJA 4KV6A 2JEAI 1HPCA 1PRTB 1JOQA 3GTGH 2M9VA 1GXDC 4O42A 4DNRB 1IHZA 3JAMc 4BY1G 2F0TA 1MBYA 4JBKA 2UXCL 3EJIA 1ASYA 3KFUA 5A2QE 3H15A 3DMUA 1FL0A 4RHSA 1RCVD 3OIQA 4RGMA 5JEAG 1CSPA 3RN2A 2CKZB 1KQSA 4IPDA 2EJFC 2RSNA 1DZ1A 2K4KA 1DCZA 1GO3E 5I6WA 4A3MH 1PHJA 2BE5C 3GTPH 3CQZB 1YIJA 2YYZA 1X32A 1X6OA 2E5LL 3GTQB 2KEEA 1TR5A 2WKDA 2MJ8A 4FDBA 4RAUC 4HJ7A 4JV5Q 3M4OH 3FHWA 4C1NI 1ASZA 5KGUA 1AH9A 2A8VA 3U58A 4F87A 5K36H 3T1YL 4A3FG 1VMCA 1K3BC 4OWTB 3I8ZA 1K8MA 1WTVA 3AEVA 4CKEA 3NBHB 2WKCA 2K01A 3S1QB 1OXSC 2F4IA 1RL2A 5CV4A 3M4PA 3E3XA 5JPNC 1YI2A 1YNJD 3HOUH 3KBXA 1B44D 3CC4A 1RIPA 5EQ0A 4DK6C 2NN6I 4IURA 3G48A 2F0DA 3HKSA 2X6LA 5FLXc 2VXWA 1R4PB 1PYSB 1ICFB 3U9SA 3OYYA 5FLMG 2CQAA 4AH6A 2QEXA 2JA7B 2QGQA 3HGBA 3KDFB 2BH2A 2VW9A 3CAMA 1WTOA 1PTOC 3KJOA 3RMHA 5E4XA 5CORA 2RQXA 1EIHA 1MD2D 2JA8H 1E2WA 4LF7Q 2R93B 1YBYA 3ER0A 5BN5A 1W3SA 2F0UA 1SYEA 3QWNA 5T1GA 4IJLA 4A3DG 1CUKA 4B3MQ 2JN4A 2HDMA 2JE6I 4ME3A 4QGUA 3P75A 3SR1A 1GHKA 2RCFA 3VYUA 3HOWG 4NXNL 4DR3Q 4UP9A 4UP8A 3QIAA 1FVIA 3GTMB 3EFXD 3ULPA 4JOIA 1Q7YC 2CQOA 4DR1Q 1PLFA 1SYBA 4TSSA 4B3RQ 2B3GA 1XMOL 2O5IC 2IPKD 1TS5A 3K0XA 4BXXG 4RHRA 1XX8A 4RMFA 4N8X1 4DV5L 4HMJA 2V4DA 4GOPC 1EYGA 4YIJA 5FJ8H 5IY0A 1EUJA 2NTSA 1GHJA 3OWEB 2N49A 2HIXA 5J3BA 4LFCQ 3NPPA 1EIYB 3HOZB 4ALPA 2ZXPA 2E2JH 1STHA 3S14H 3P20A 1EIGA 3T1HQ 1GUWA 3WDNA 4JPBW 2PO4A 4L8JA 5M3FH 1GUOA 2OEOA 4LUVA 2F0LA 1B3AA 1DYQA 3KBGA 3RZDH 4P73A 3NXWA 3W1BA 1XNQL 2Z4IA 2DJFC 1VQ8A 1LT5D 1TWHB 5HURA 1KDBA 3A74A 3M4YA 2K5QA 3D6WA 4YY3L 1AZPA 5BN4A 1CQVA 3K80C 1PFNA 3CPFA 3J7YW 4DR2Q 4FP5D 2KQ3A 3ND8A 4BBSH 2VB2X 1NY4A 1TWAH 5CC4A 1RTNA 1HRJA 1HXYD 1IW7C 4OL7A 2BDOA 2A1AA 1UWVA 5ELFA 1YVCA 1WTHA 1Y14B 2NVYB 4JI0Q 1M90C 4KTAA 3HKZB 3AFPA 4J6HA 3IAYA 3RUZA 2CCZA 4GKKQ 5I6YA 4PG3A 1LYLA 3MA2B 4JYAL 1VQPA 2VZAA 4JG2A 1B7YB 3A55A 1X65A 4DN4M 3PO2G 5C0XI 2HT1A 2NUCA 4J8QA 2F3IA 3BG3A 3KJPA 4KY7A 3H3VC 2UUCL 3PIP3 4XQJA 1SDFA 3A8IE 4G7HC 1GM5A 1Y1WH 4NB3A 2B63B 3GTJH 2BOSA 4LUZA 1WTQA 1BXTA 2AWOA 1Y69U 2FXQA 4JI8Q 4CDDC 4DV0Q 1CT1D 1IBML 1IL8A 2C35B 1S4ZA 2HHHQ 3SGIA 4RFBA 1O80A 4O0AA 1N34Q 2EIFA 1TKWB 3K81C 4DR4Q 1QVCA 1VQMA 1JOKA 2D0OA 4CHTB 3UDIA 2JQOA 2L12A 4JI4L 4KN4C 1E0BA 1IL2A 5EBCA 4C3JB 4HCSA 2A6HC 4LFBL 2PQAA 2VS1A 3PUZA 2I5HA 2LSSA 2B2YA 1U5KA 2H1EA 2RHQB 3BS1A 2B2VA 2PPBC 4X66L 1PMRA 4DA2A 1ESRA 1HR0L 2B2UA 5I9PA 5IYBH 2A69D 1DJRD 1O7IA 4OO1I 4DR7Q 2UUBQ 1A62A 1XTCD 4LF4L 1E22A 1BR9A 3L2PA 1PH1A 1DM0B 4S3SA 2EE1A 3EA6A 1EOTA 3JAML 4RWSC 1PTOH 2DNCA 5D3DA 2OWOA 2N78A 1O7LA 1ZYRD 4FXKC 3MXNA 1PZJD 1STNA 4IJHA 1RODA 5LHY1 1SNPA 4PQXA 2DN8A 1Z47A 1X55A 1FYCA 1GOZA 3RZOH 2PQAB 4RGNA 4B9XA 3U50C 3F2DA 3CCLA 4X3UA 3HOVH 4L6TB 5C44H 1KABA 1CA6A 4XYOA 3MEFA 4R4CA 1V1PA 5LMNL 3N6RA 2VQEQ 2KOLA 1AW7A 1RKNA 2K5VA 4JCVE 4JI5L 3KLSX 3AU7A 2L0CA 5IWAQ 1PH9A 3A0JA 3TS0A 1F9SA 3T53B 3IKJA 2CW0D 1JE5A 1NBWA 4PNYA 2R93H 2C5CA 3R3OA 1L1OB 1PZKD 1U9RA 1U4LA 3S2DB 5GAGC 1Q12A 1W2BA 3EN2A 2JA8G 5IOCA 1X3QA 1I4HA 3FPUB 4X62L 4GN3B 1TS3A 3D4DA 4A93H 2YTYA 4RKBA 3X3MA 3X3NA 2ID0A 2WB1B 4YHHL 1V1QA 3CRKC 4XQNA 3I72A 5D3IB 2ZJRA 3QOLA 3CPWA 3GTMH 1EY8A 5FLXL 1FR3A 1BCPB 5M3MH 2B39A 2E2HH 1EIFA 4QF4A 3H94A 1HNXL 1V1PB 3UI2A 3D31A 4A3MB 2R7DA 1NCVA 2OQKA 1PH4A 2XVSA 4IO9A 2X6GA 2E76C 1DOLA 3HS0C 2WB1E 3V05A 4MTKA 2RBMA 4NMZA 4OHJA 1SLJA 2I5MX 1PRTD 2JA5B 3HRZC 1V9PA 5M5YB 5JVH3 5FJ8G 1Q86C 3C1EA 3M4OB 1B1ZA 5ELNA 1ZEQX 1C4QA 3CKIB 2UXDL 2KJXA 3HOYH 1UNSA 5HY6A 3S2HB 1LM0A 1EY9A 5ELEA 2Z6KC 1JC7A 2KHSA 1WTRA 2R7ZH 2LXJA 5M3FG 4RCOA 3HOUB 3DLLA 3TS2A 5G3LF 4OIKA 4M1UB 4K8IA 2K05A 4HAEA 5ELBA 2F0SA 2SEBD 1DONA 4DV3L 2OT2A 1YEZA 4ZQ3A 1HUMA 1QNKA 2KEDA 4K8JA 4A3JH 3RLFA 4BBSG 3H6MA 3AB9A 5BN3A 3F1ZA 3PF4A 4K2KA 4R4QA 4POFA 4P72A 4HN7A 1G2SA 1VQCA 3WWVA 5KYLA 4DV2Q 2K6AA 4DV7Q 1YJWA 1HNZQ 1GKHA 2JA6H 4LK1C 2WINB 2EYFA 3VR3A 2ZJQA 1EU3A 2PW7A 3QJYA 1EQRA 4IOCA 2PNHA 5IT9c 1VQ5A 2QCPX 2F3WA 4LWCA 1VQNA 1VQGA 1SROA 1BBUA 4IPHA 4F7XA 2AMCB 2Y0SG 3C1FA 5C0XH 1HNWQ 4X3TA 1VQAA 4X3KA 2KENA 4IFDI 2B63H 2IHFA 5DNFA 1VF7A 1NJIC 2A19A 4BA1I 3SDZA 4HIDA 4IOAA 1DD2A 2GN5A 2F0HA 5IIFA 4DXGA 1BOSA 2RHSB 3NK9A 1Y1WG 4DK1A 4DUZQ 5IGFA 3C3LA 5IYDH 4J1MA 5I4DA 1NR2A 5EKLA 4CDEC 3KLWA 4C1NK 1QVGA 5AJ3Q 1OXXK 4ZKCB 1DOKA 5EJWA 4QCLA 1SYFA 1TIID 1EY7A 3UE1A 1JWUD 4GN4B 2M00A 1X3FA 3RZDB 2GVBA 1WI5A 4XIGS 4ILWA 4WORA 4OWXB 1C9OA 1B70B 4OO1H 5I2YA 2FJ2A 4A3KH 4QMGA 3CF5A 1L0XB 1E3PA 1LTLA 3ONAB 4QQBX 3GP7A 5IYBG 1JE4A 1SNCA 1STEA 2WV6D 3WOFA 4GNXC 1X3GA 1VQHA 3B6YA 4K14A 4LF7L 2PYKA 5IGDA 2K03A 1PFMA 4JI1Q 2MUYA 1PV4A 1ICWA 4LFAQ 4Z9CB 1I4QA 1EL0A 4B3ML 2XIWA 4AQYQ 2XTIA 3R8BA 1H9SA 2Z6BA 3DM1A 3M3YH 1LUZA 2CFMA 3S17H 1BUVT 1SBBB 1Y1VB 4DR3L 1G2TA 2ZTCA 3OIPA 3DWQA 3A8JE 1ZYRC 1D8LA 1IBKQ 2PI2A 2XN9C 4DR1L 1VQ4A 2MQHA 4B3RL 5HGQA 1VQFA 2A73B 3T16A 3RLOA 3A8KE 3L9AX 1I6VC 3LWEA 4KY5A 2EYPA 1DXMA 1YNXA 1A3VA 4EQOA 1S5BD 3PIOA 2JA7G 1YITA 3GTJB 3D3RA 1QUQB 3I90A 1EQVA 1B50A 4BBRH 3I4NH 2J4XA 5FOBB 3M9BA 2A74C 5EKIA 2PZWA 4LFCL 2LY7A 4K5WA 1VCIA 3O13A 1B2TA 2AUKA 2F0GA 1S5DD 4GLAC 2R93G 3A5ZB 1SR3A 5CMDA 2CW0C 3T1HL 2EVBA 1GUGA 3NBHA 1YZ6A 3S24A 5CR3A 4NDXA 1H9SB 1QB5D 5KNDA 4LNQA 1NMFA 3GTKH 2MFIA 4QUFA 4I65A 1HQMC 2J7ZA 2F4VQ 4KKSA 5A2QL 4A3BB 2C9OA 3M4QA 1X3EA 1TWCB 2K04A 4I7ZC 4KK7A 1PH7A 1YJNA 3F2CA 1KDCA 4X64L 1HA6A 1FD7D 4ME5A 1S3OA 4DR2L 1UEBA 4A76A 3PCOB 4PMCA 1JCKB 4C3IH 2KBNA 3PSIA 1PH2A 3KDFA 3CCSA 3OSOA 1EYCA 1J5EQ 1AE3A 5KIXA 1V43A 1HTLD 3RN5A 4GKJQ 4EX5A 2JA5H 1KRSA 3DM3A 1KIXA 5M5YH 4JI3L 4C2MH 4L5SA 1O7ZA 2AHOB 4UHVA 4IUQA 2PI2E 4JI0L 5DM63 2SOBA 2AQ1B 3S2HH 1LO5D 1PTOB 1UE1A 2QA4A 1ZKOA 2K5NA 4GKKL 1KL9A 3HOZG 4ZKBB 3NWSA 4A4IA 1NTGA 1MHWC 1D5XC 4ZAIA 1SYGA 1UEAB 5EPJA 5IE8A 4DAVA 4RA8A 4KI0A 3RZOB 1KXLA 2OQ0A 5C3EH 3P7JA 2PMZB 3E5SA 3I4MH 1D5ZC 4CJ0B 3HOVB 5C44B 1WCMH 4BY7H 1VQEA 2AQ2B 4LAAA 2R6GA 4QUCA 3ULLA 2AWNA 4JI8L 4GLVB 1HH2P 4A3CH 3URYA 3S1NH 4PZ7A 4KJNA 2HHHL 1GVPA 3FKIB 5LMUQ 2MGSA 1N34L 4DR4L 5JEAJ 3ICEA 5IP7H 1CI3M 5JVG3 2PMZE 5CGKA 4NP5A 2NVXB 4GOPB 1O78A 2D62A 3PIPA 5IP9G 3IRBA 4KY6A 4Y7NH 1BKBA 3HKZG 4JC0A 4HJAA 4A93B 4MZ9A 3CCEA 4GLXA 2VUMH 2FINB 4UAIA 3FRPB 1LLRD 4CJ2C 1PYBA 1PFBA 2QF7A 4JI2Q 4HJ8A 1WD0A 1I94Q 5IYCH 1OXTA 2G9DA 1BBWA 4R4TA 2E74C 5M3MB 4DR7L 2E2HB 1AE2A 1PDQA 4IFDH 5GQOA 2PNRC 4L63B 1M1KC 3MWYW 1C0AA 2O2LD 2A68D 5DAUA 2EPBA 1NUCA 4DR6Q 1VQLA 3U4ZA 4JBMA 2B63G 1B53A 2XRSD 4YCWA 4FF2A 2EOTA 3NQIA 3I4LA 3STBD 4LMQD 3HP3A 3U9OA 2ALYB 2KCTA 3UE0A 1F9RA 5FO7B 4UPAA 2R3ZA 5ELOA 4IUUA 5IT9L 4A3IB 4DXFA 4Q5VA 1EY4A 4B9WA 2RCNA 1NMGA 3BJUA 3HOYB 3F2UA 1BCPD 1B8AA 5IGGA 4HIMA 1GUTA 1IBLL 4LF9L 2F0QA 3P1HA 2ZJPA 4C3JG 3K59A 4WRDA 3DWPA 2TMPA 3JC66 2VQEL 2NZ1D 2JJQA 1QCBD 3VR4A 3A56A 4POGA 2R7ZB 2AUJD 1JICA 1JORA 1SMYD 3I7FA 2KCMA 4LF5Q 3H3VI 2UXCQ 5JJKA 5FO9B 3G6JB 3OHXC 1EFWA 1HFNA 2F0KA 1RTOA 1RD9D 4OO1G 2GA4B 2EDGA 3TSSA 3N52A 4A3JB 2ICEC 1K83B 2A6ED 4RH6A 4PV1C 1HZAA 3CMAA 4QL5A 5HGTA 5H1SE 4U673 1P16A 3HOXH 1G8ZD 3VYTA 4A3EH 3UDGA 1KLUD 2Q2HA 4CDFC 2ES2A 4GS3A 2K33A 1K8OA 3S9WA 3MC0B 1XNRQ 5C6AA 1Y1VH 2EY5A 2JA6B 2A5HA 2EYHA 2EYLA 5L37A 3IFTA 4LF6Q 1BQQT 3PV0A 5D14A 2O4XA 1PZID 1IXRA 5KYIA 2K1BA 4JW0A 1C8CA 4AIMA 3TEHB 1R9TB 1ENFA 3RD4A 2YTXA 1SAPA 1VQ9A 3Q23A 3HKZE 2N8NA 3K7AH 2EYOA 3T4AC 4A3GH 2UU9Q 4DNTB 1WJJA 1AP0A 2B29A 1N36Q 2KVMA 3FVQA 5I2XA 1STYA 1XYIA 4DNIA 3NEMA 1RJTA 5IODA 4NXMQ 1E1TA 3J81E 1EWIA 3G6EA 5DM73 2F1MA 1PRTF 2L1BA 1Z6HA 4N8FA 1XJVA 3NP8A 1EY5A 4UDUC 3MXUA 4A3BH 1FGUA 4JBJA 2BA0A 1TWFB 1TWCH 2WB1G 4UY8C 3KYHC 1HUNA 1K8GA 4C3HB 1I4XA 1WFQA 4U68A 4LF8Q 1Q81C 2VQFL 1VF5C 1SE8A 3W5OA 1SNOA 3J80E 4DV6L 4A3MG 1LTSD 1Y8PB 2ZXRA 3PO3B 2K7VA 3SK8A 3SVMA 4A3KB 5J39A 2TSSA 2IHEA 3QO2A 3F8TA 1L1OA 1TS4A 2F0PA 3L7ZC 5EPKA 4H44C 2N3SA 4HEDA 2MHVA 3QG1A 1TS2A 4R9WA 1X54A 1K9MC 1CSQA 4B08A 2JA5G 2WAQB 1LTID 4H13C 1HNZL 4DFAA 4JI6Q 2FFKB 1X56A 1Q3LA 1XMOQ 1GJXA 1H95A 2EY2A 1XPUA 1O7YA 1LT3D 3JAME 2Q2UA 4DV5Q 5K36G 1ESFA 2R92H 3M3YB 3S17B 1PA6A 3D6CA 1VQBA 5JJLA 2NN6H 1KAAA 3HOUG 4R1JA 1G51A 1YNJC 5C4XH 1HZ9A 3PUWA 1E2VA 1UAPA 1T5XD 4HSVA 4YWLA 2HIVA 3BU2A 3A5UA 3FKIH 1Y8NB 1STAA 2D0PA 2KHIA 1D1KA 1ET6A 1FGBD 1MSGA 2MO0A 4BBRB 5IGEA 3I4NB 2NBFA 5C4ZA 4M8AA 1KC8C 2NVXH 5AJ3L 2IJ0A 2DY7A 1D5MC 1UE6A 1A0IA 2B2TC 4KHVA 5E3FA 1TWGH 3SK4A 3TBIB 1STGA 5CV6A 3BDLA 4XT1B 1OO9B 2NWGA 3EQLC 3M85A 3GTKB 1KLGD 4DAPA 1Y8OB 1JR0D 3I3CA 5GROA 4IUVA 2XRQD 3DXJC 1V8QA 1I3QH 1AN8A 2F03A 2EY1A 4DUYL 2X69A 2B2VC 4B3TL 5FLXE 2WP8J 5I9OA 3W2DA 2BE5D 2SDFA 2B2UC 3EROA 2HCIA 4C3IB 1VS0A 3Q24A 3BYTB 3QR8A 1CZGA 4IFDG 4JI1L 1SYDA 1OXVA 1E1OA 4LFAL 3T51B 2IT1A 2CWAA 3LNNA 4RCNA 4GN5A 4C2MB 4AQYL 3KUPA 1QWYA 5TSSA 4A3IH 1ET9A 4G4KA 1HCZA 1TY0A 1SYCA 1TT2A 1SE4A 2H4OA 1H9KA 4G57A 2DJGC 1LABA 2F52A 3MTSA 1A3UA 3PUYA 3S1MH 1LACA 4IPGA 4EQ5A 3J81i 1A2UA 1RHPA 1PH8A 1IBMQ 4OX9Q 4K6DA 4A3FH 3LGJA 4RGOS 2VB3X 1MSHA 2I0QA 1BBXC 2L4NA 1WTPA 5C3EB 3BDOA 1F9QA 3OMGA 1N32Q 2HUGA 3I4MB 2ZM6Q 1WCMB 4BY7B 1Q90A 4JI4Q 4IUTA 4DV4Q 2SNMA 3H3VH 2IW3A 2RA4A 4Y52H 1SSOA 4N9PA 4V190 1K83H 1PTOD 3BVMA 3S1NB 3J80i 3RLNA 1ILQA 1PH6A 5EPLA 2JA9A 4HIOA 1YHBA 4XTCS 2UXBQ 1KNEA 2B2WC 2K28A 3BDCA 4PMBA 3S15H 2JSOA 2HQEA 4XYQA 1BVSA 2XGTA 2JEBI 2YTVA 1I6HH 1L0WA 1A2TA 4F88A 1F2ZA 2L9HA 3OW7A 1A63A 2F4VL 3CRLC 4Y7NB 3ITPA 3VR5A 5BR8Q 1HQRD 4A3DH 1GUNA 2Q2IA 1EZ6A 1IZ6A 1R9TH 2VUMB 2WIIB 1Y1VG 2D9UA 3CCRA 1EEID 1B9NA 4EVOA 4IFDJ 1SNDA 4JBWA 3JAMi 3NTHA 1J5EL 3HOWH 5CV7A 3S16B 2OTJA 1S5FD 2Z1CA 2D2CC 4GKJL 2N55A 4OXPA 3PF5A 1D1IA 1UUPA 2F0FA 3NUCA 4JV5L 3A7LA 4QB4A 4ZK9B 4DV1Q 2K5HA 1TVXA 1ZXTA 4BXXH 4KD3A 3GD7A 2EYMA 1YHAA 3CCVA 1EU4A 2ATWA 1A15A 4MHEA 4UP7A 2PZUA 4GNXB 2FHTA 1C48A 1A8VA 1TWFH 3C46A 1XWEA 3BVGA 4C3HH 1JB3A 4F8MA 1XTDA 3J7AF 4A3BG 3AQQA 3K5MA 3NQTA 2XSCA 3MXPA 3PO3H 1CFMA 4X62Q 3SK5A 1QUQA 1SE2A 4FF1A 1VQIA 5LMUL 2AKWB 2A69C 3TZDA 1EQTA 4I7AA 1SNMA 1KTKA 2G5DA 1C7YA 1IW7D 4YWKA 1PYWD 3GTLH 3R93A 3HOXB 3PUVA 4QIWB 2XWJB 4A3EB 1N33Q 1JQYD 1FNWA 2KHJA 5C3XA 2F0JA 4BS9A 4BWGB 1X9NA 2I07B 4JI2L 2LFNA 3J81c 4DAYB 3H91A 1I94L 1ILPA 4P75A 1NE3A 1T9HA 2Q2TA 5KEEA 1Q1EA 3NE5B 1EWCA 4J15A 1JWSD 1EQQA 1U4RA 3HOVG 5C44G 3SHLA 3PO2H 4DR6L 4QIWE 3QOJA 1HR0W 2ASBA 2NN6G 3K7AB 4DK0A 4A3GB 3MAQA 2UUAQ 3V2TA 1CA5A 4K0KQ 3TN2A 4GZYC 3W3AA 1EYAA 3ND9A 4OONA 4H02A 5EAYA 1NAPA 1WTXA 3J80c 1B9MA 2RSOA 3FKIG 4DR5Q 3TZUA 3BYYB 2DNEA 2ZXOA 3TP5A 3K0YA 4WJWA 2OXPA 3T13A 3VDYA 3NELA 4ZLTF 3OWFA 4KHPQ 4FVMA 1VQ6A 1XMQQ 3ERSX 1LT4D 4O2DA 3CD6A 1SMXA 4A93G 2F0NA 2E2IH 4HR7B 2LXKA 2PW5A 4ZCKA 1W6KA 2A6HD 2RDGA 3M7GA 4LF5L 1S5ED 2ZTEA 3NBIA 1BCPF 3GQBA 5DLQE 5LMNW 2KECA 5M3MG 1LTBD 3EBEA 4L5RC 1Q8IA 3KK7A 5M5XB 3CHBD 2Z8LA 1CKNB 5KNBA 2F0OA 3KF6A 5EBDA 4WFN3 3G71A 3H0GB 2HD3A 5LL6X 1KAWA 2RKSA 1G6PA 3DEOA 5ELDA 2QDLA 1PXUA 4X65Q 1YNND 3OTOQ 1J6QA 1Z7TA 4JVZA 4IPCA 4GOPA 1XNRL 1VDZA 4XT3B 2L15A 1PRTC 1NSNS 4QJFA 2NTTA 4O1NA 4LF6L 4A3IG 3TRZA 4HIKA 1JMCA 2K32A 3HOYG 3M7NA 1SJED 1BNZA 2KCNA 3MXGA 2R92B 2YU9H 4C56C 2K75A 2PQEA 2QDBA 4DK3C 3CW2C 1MJCA 1KD1C 3CMEA 4IQZA 2UU9L 3FMCA 2R7ZG 3LWUA 1N36L 3LX0A 2QILA 3PUXA 3W1GA 5C4XB 4DV0L 4CGYB 1PH3A 4AYBB 1A3TA 2ENBA 2N88A 4R8IA 1H9JA 3TREA 1ONLA 3CU7A 2K50A 3KF6B 1U4MA 3OOCA 4WJ4A 3CC2A 4NXML 1XPRA 5EGTA 4A3JG 4FF3A 2RDHA 2KUMA 4OWWB 2CWPA 1Q46A 1V1OA 1FJGQ 4DGZA 1LT6D 1R4QB 1EFID 3KLRA 4AYBE
chains in the Genus database with same CATH topology
1TWGB 1M8AA 5E4WC 1Q1BA 1ENCA 3KF8A 4BY1B 5IGBA 3PIO3 1I3QB 2IWHA 2I46A 4EGVA 5C0XG 1I50B 1WD1A 4K5XA 4XXEA 4V0BA 4KKUA 3DUZA 3SXHA 1I4GA 1OXUA 3TDQA 1CZWA 1TQOA 3IL8A 5CV9A 4JK1C 2BCOA 1STBA 1E2ZA 2IX1A 2B8GA 4IALA 3VR2A 2HCCA 2MPMA 2EY6A 1EWHA 4FO2A 3GV3A 4CKCA 3S1MB 3MEHA 5IT9E 4EQNA 4OGQC 5JOBA 4A3FB 2LS01 5CV8A 4C3HG 1WVLA 3NWTA 4CJ1B 3E6ZX 1SNQA 2DY8A 5T1IA 4IUPA 5CV5A 1HTPA 1FNUA 2MP1A 3HZXA 3NSWA 5FKAC 1I4RA 4BA2I 2HDLA 3TMEA 1AFPA 1D6EC 1EY6A 3I91A 1QOHA 5D65A 3DWAA 2K5WA 2F0VA 3A7AB 2F0MA 1BF4A 3SE0A 3S15B 3HG9A 1I6HB 3R2IA 5C0XJ 3SEBA 2EZVA 1T5EA 2KCCA 4ZYSA 4A3DB 2F0EA 1G291 1HFGA 3K5LA 4NW2A 1U4PA 4K6LA 2E2DC 4XDXA 1RDPD 3E0JA 3HOWB 2R61A 3HEJA 5C4HA 3GO5A 5JPMC 1CHPD 3ERQA 3C2PA 2NB0A 4DU9A 1I4PA 1QILA 1EZ8A 1EY0A 4G7OC 4TQUS 4FNFA 3V96A 2AQ3B 3J81L 2D5DA 2ZT9C 5JAVA 2JYOA 3FPPA 4CKBA 2EYJA 4NKLA 5CYUA 2B2TA 4HTHA 5DEHA 2K5DA 4KMUC 4G7ZC 3VA7A 3D4WA 4IZ8A 3NTIA 3L3OC 3G7LA 1FNVA 3J80L 2EJMA 4C3IG 1JWMD 5C3WA 3A54A 2WACA 4Q0FA 2PCFB 3T56B 4PMWA 1TU2B 3Q6SA 4FF4A 1BO0A 5NUCA 3GTLB 3TP7A 1G6ZA 4H7BA 1PTOF 3S1RB 3OMCA 2O5JC 1YNNC 5EKKA 3EVQA 2QEJC 2BDNA 3MFYA 4LJZC 3VYSA 2B8FA 2E75C 4FXGC 3SK6A 3PO2B 5CBEE 1SFOB 4ID6A 3VR6A 5M9OA 3BZDB 3VYRA 2FMMA 2VNUD 3AMUA 1CTMA 2Q8IB 1D2BA 2F0WA 3I73A 4KKTA 4X3SA 2NVQB 5A35A 4OIJA 4P2CB 2CVRA 1LTGD 4HSPA 2B2WA 1VMPA 1JOOA 2E2IB 2FMCA 2B2YC 4FYDA 4XQQA 4N9TA 1AZQA 5JEAH 4ABNA 3GTGB 3IFDA 4ODGA 1EYDA 3GV6A 1IYUA 4TKOB 3H09A 3Q0AA 2L11A 4EQPA 4ZUJA 1F2MA 4ZRZA 1QNUA 2A68C 5FK9C 4K2LA 1F2YA 2ICIA 1H9MA 2F3VA 3GTPB 1KNAA 5IGCA 2XWBB 5E1FA 1BDOA 2L5TA 1A6XA 2IL8A 4MIUA 1SE3A 5C5LA 2RDFA 2Q8RE 1CHQD 3MZ5A 1CQFA 3K57A 3J7AV 1BCPC 1MGSA 1F2LA 2YU9B 4MN3A 2JXMB 5ISRA 2Q8TA 1S5CD 3TP8A 2OF1A 1SMYC 5C5MA 4CBVA 3KLSA 1NR4A 2EXZA 1AEXA 3D4RA 5KRUA 5FO8B 2IX3A 2CHBD 1DOMA 5J1ZA 1XXGA 1B4OA 2A6EC 2JP1A 2RVLA 1LTRD 4H0LC 2SNSA 4E6IA 2JA8B 4KHZA 4HMIA 2KA7A 2G9HD 1CK1A 2QKIC 5J22A 1IKMA 3BVZA 3MFGA 1CM9A 2M2LA 4K5VA 1KDAA 1RF2D 1ML0D 3K5OA 3K6OA 1HA5A 2PZTA 3FEWX 3VA5A 1EEFD 4R8NA 3K5NA 3K58A 1TY2A 3OPOA 2L55A 3MVVA 1SEBD 4FXDA 4DAYA 1LTAD 1QE6A 3Q22A 4KJOA 3NHHA 3D8GA 1GUSA 1HHVA 5KNCA 1LV9A 4ULLA 3QB3A 1ENAA 2E2JB 3DEPA 3S14B 2Z4HA 4RKLA 5COYA 5M3FB 1L0YB 1F9PA 5CBAE 1MI2A 2EJGC 2LKVA 4BBSB 2XNAC 3NTKA 1II3A 5K5PA 1SJHD 1TWAB 4KD4A 2NYZD 3FDTA 1M4VA 2BA1A 3MHBA 1WTWA 4RGTA 4HCEA 5JJZA 4IN3A 1H9RA 5G3LD 3GTOB 2F0IA 1G91A 1J9OA 1IYVA 3TP6A 1QG7A 5AFWA 5M5WB 5LL6S 2NVTB 2Y0SB 5C4JB 4DF7A 1IKLA 4TRDA 3I70A 3WOEA 2LMCB 3ZYYX 1SXTA 4IUNA 1X3PA 3PMFA 3R2TA 1J8IA 3DHQA 4KN7C 1QJOA 1Y1WB 4ZUIA 5ELCA 1F77A 5F2DA 2IX0A 2J0TD 1W6JA 1LTTD 4KV6A 2JEAI 1HPCA 1PRTB 1JOQA 2M9VA 1GXDC 4O42A 4DNRB 1IHZA 2F0TA 1MBYA 3EJIA 5A2QE 3DMUA 4RHSA 1RCVD 3OIQA 4RGMA 5JEAG 1DZ1A 2EJFC 2RSNA 1DCZA 5I6WA 2BE5C 3CQZB 2YYZA 1X32A 3GTQB 2KEEA 1TR5A 2WKDA 2MJ8A 4RAUC 4C1NI 5KGUA 4F87A 5K36H 1VMCA 3I8ZA 1K8MA 1WTVA 4CKEA 2WKCA 2K01A 3S1QB 1OXSC 2F4IA 5CV4A 5JPNC 1YNJD 3KBXA 1B44D 5EQ0A 2NN6I 4IURA 2F0DA 2X6LA 2VXWA 1R4PB 3U9SA 2CQAA 2JA7B 3HGBA 1WTOA 1PTOC 3RMHA 5E4XA 5CORA 2RQXA 1EIHA 1MD2D 1E2WA 2R93B 5BN5A 2F0UA 1SYEA 3QWNA 5T1GA 2HDMA 2JE6I 3P75A 3SR1A 1GHKA 3VYUA 3QIAA 3GTMB 3EFXD 1PLFA 1SYBA 4TSSA 2O5IC 2IPKD 1TS5A 4RHRA 1XX8A 4HMJA 2V4DA 4YIJA 2NTSA 1GHJA 3OWEB 3NPPA 3HOZB 2ZXPA 1STHA 3P20A 1EIGA 1GUWA 3WDNA 2PO4A 4L8JA 1GUOA 2OEOA 2F0LA 1B3AA 1DYQA 3KBGA 3NXWA 2Z4IA 1LT5D 1TWHB 5HURA 1KDBA 3M4YA 2K5QA 3D6WA 1AZPA 5BN4A 1CQVA 1PFNA 3J7YW 4FP5D 2KQ3A 3ND8A 2VB2X 5CC4A 1RTNA 1HRJA 1HXYD 1IW7C 4OL7A 2BDOA 5ELFA 2NVYB 4KTAA 3HKZB 4J6HA 3IAYA 3RUZA 5I6YA 3MA2B 3A55A 4DN4M 5C0XI 2NUCA 4J8QA 3BG3A 4KY7A 3H3VC 3PIP3 4XQJA 1SDFA 3A8IE 4G7HC 2B63B 2BOSA 1WTQA 1BXTA 2AWOA 1Y69U 1CT1D 1IL8A 1S4ZA 4RFBA 1O80A 1TKWB 1JOKA 4CHTB 2L12A 4KN4C 1E0BA 5EBCA 4C3JB 4HCSA 2A6HC 3PUZA 2B2YA 2H1EA 3BS1A 2B2VA 2PPBC 1PMRA 4DA2A 1ESRA 2B2UA 5I9PA 4OO1I 2A69D 1DJRD 1XTCD 1BR9A 1DM0B 4S3SA 2EE1A 3EA6A 1EOTA 3JAML 4RWSC 1PTOH 2DNCA 5D3DA 1O7LA 1ZYRD 4FXKC 1PZJD 3MXNA 1STNA 1RODA 5LHY1 1SNPA 4PQXA 2DN8A 1Z47A 1FYCA 1GOZA 4RGNA 4B9XA 4X3UA 4L6TB 1KABA 1CA6A 4XYOA 1V1PA 3N6RA 2KOLA 1AW7A 1RKNA 3KLSX 3AU7A 2L0CA 1F9SA 3T53B 3IKJA 2CW0D 4PNYA 2C5CA 3R3OA 1PZKD 1U9RA 1U4LA 3S2DB 1Q12A 5IOCA 1X3QA 1I4HA 3FPUB 1TS3A 3D4DA 4RKBA 3X3MA 3X3NA 2ID0A 2WB1B 3CRKC 4XQNA 3I72A 5D3IB 3QOLA 1EY8A 5FLXL 1FR3A 1BCPB 2B39A 4QF4A 3H94A 1V1PB 3UI2A 3D31A 4A3MB 1NCVA 2XVSA 2X6GA 2E76C 1DOLA 3HS0C 3V05A 2RBMA 4NMZA 4OHJA 1PRTD 2JA5B 3HRZC 5M5YB 5JVH3 3C1EA 3M4OB 1B1ZA 1ZEQX 1C4QA 3CKIB 2KJXA 1UNSA 3S2HB 1EY9A 5ELEA 1JC7A 2KHSA 1WTRA 3HOUB 4RCOA 5G3LF 4OIKA 4M1UB 4K8IA 2K05A 4HAEA 5ELBA 2F0SA 2SEBD 1DONA 2OT2A 4ZQ3A 1HUMA 1QNKA 2KEDA 4K8JA 3RLFA 3H6MA 3AB9A 5BN3A 4K2KA 4HN7A 1G2SA 5KYLA 2K6AA 4LK1C 2WINB 2EYFA 3VR3A 1EU3A 2PW7A 3QJYA 2QCPX 2F3WA 4F7XA 3C1FA 5C0XH 4X3TA 4X3KA 4IFDI 5DNFA 1VF7A 4BA1I 3SDZA 1DD2A 2F0HA 5IIFA 4DXGA 1BOSA 3NK9A 4DK1A 5IGFA 3C3LA 4J1MA 5I4DA 1NR2A 5EKLA 4C1NK 1OXXK 4ZKCB 1DOKA 5EJWA 4QCLA 1SYFA 1TIID 1EY7A 1JWUD 2M00A 3RZDB 4XIGS 4ILWA 4WORA 4OO1H 5I2YA 2FJ2A 4QMGA 1L0XB 3ONAB 3GP7A 1JE4A 1SNCA 1STEA 2WV6D 3WOFA 4K14A 2PYKA 5IGDA 2K03A 1PFMA 2MUYA 1ICWA 4Z9CB 1I4QA 1EL0A 2XIWA 3R8BA 1H9SA 3DM1A 1BUVT 1SBBB 1Y1VB 1G2TA 3OIPA 3DWQA 3A8JE 1ZYRC 2XN9C 2A73B 3T16A 3A8KE 3L9AX 1I6VC 3LWEA 4KY5A 2EYPA 1DXMA 4EQOA 1A3VA 1S5BD 3GTJB 3D3RA 3I90A 1EQVA 1B50A 2J4XA 5FOBB 2A74C 5EKIA 2PZWA 2LY7A 4K5WA 1VCIA 3O13A 1B2TA 2AUKA 2F0GA 1S5DD 5CMDA 2CW0C 2EVBA 1GUGA 3NBHA 5CR3A 4NDXA 1H9SB 1QB5D 5KNDA 4QUFA 4I65A 1HQMC 2J7ZA 4KKSA 5A2QL 4A3BB 2C9OA 1TWCB 2K04A 4I7ZC 4KK7A 1KDCA 1HA6A 1FD7D 4ME5A 4PMCA 1JCKB 3OSOA 1EYCA 5KIXA 1V43A 1HTLD 1O7ZA 4IUQA 5DM63 2SOBA 2AQ1B 1LO5D 1PTOB 1ZKOA 4ZKBB 3NWSA 4ZAIA 1D5XC 1SYGA 1UEAB 5EPJA 4DAVA 4RA8A 4KI0A 3RZOB 3P7JA 2PMZB 3E5SA 1D5ZC 4CJ0B 3HOVB 5C44B 2AQ2B 4LAAA 2R6GA 4QUCA 2AWNA 3URYA 4KJNA 3FKIB 2MGSA 5JEAJ 1CI3M 5JVG3 5CGKA 4NP5A 2NVXB 1O78A 2D62A 4KY6A 4A93B 2FINB 4UAIA 3FRPB 1LLRD 4CJ2C 1PFBA 2QF7A 1WD0A 1OXTA 2G9DA 5M3MB 2E74C 2E2HB 1PDQA 4IFDH 2PNRC 4L63B 3MWYW 2O2LD 2A68D 5DAUA 2EPBA 1NUCA 1B53A 2XRSD 4FF2A 2EOTA 3NQIA 3I4LA 4LMQD 3HP3A 3U9OA 1F9RA 5FO7B 2R3ZA 4IUUA 5IT9L 4A3IB 4DXFA 4Q5VA 1EY4A 4B9WA 3HOYB 3F2UA 1BCPD 5IGGA 1GUTA 2F0QA 3P1HA 4C3JG 3K59A 4WRDA 3DWPA 2TMPA 2NZ1D 1QCBD 3VR4A 3A56A 2R7ZB 2AUJD 1JICA 1JORA 1SMYD 5FO9B 3G6JB 3OHXC 1HFNA 2F0KA 1RTOA 1RD9D 4OO1G 2GA4B 2EDGA 3TSSA 3N52A 4A3JB 2ICEC 1K83B 2A6ED 4RH6A 4PV1C 5HGTA 4U673 1G8ZD 3VYTA 1KLUD 2K33A 1K8OA 3S9WA 3MC0B 5C6AA 2EY5A 2JA6B 2A5HA 2EYHA 2EYLA 3IFTA 1BQQT 3PV0A 5D14A 2O4XA 1PZID 5KYIA 2K1BA 1C8CA 1R9TB 1ENFA 3RD4A 1SAPA 3Q23A 2EYOA 3T4AC 4DNTB 1AP0A 2KVMA 3FVQA 5I2XA 1STYA 1XYIA 1RJTA 5IODA 3J81E 5DM73 2F1MA 1PRTF 2L1BA 1Z6HA 3NP8A 1EY5A 4UDUC 3MXUA 2BA0A 1TWFB 1HUNA 4C3HB 1I4XA 4U68A 1VF5C 1SNOA 3J80E 1LTSD 1Y8PB 2ZXRA 3PO3B 2K7VA 3SK8A 3SVMA 4A3KB 5J39A 2TSSA 3QO2A 5EPKA 1TS4A 2F0PA 3L7ZC 4H44C 4HEDA 2MHVA 3QG1A 1TS2A 4R9WA 4B08A 2WAQB 1LTID 4H13C 4DFAA 2FFKB 1Q3LA 1GJXA 2EY2A 1O7YA 1LT3D 3JAME 5K36G 1ESFA 3M3YB 3S17B 3D6CA 2NN6H 1KAAA 1YNJC 3PUWA 1E2VA 1UAPA 1T5XD 4HSVA 1Y8NB 1STAA 1D1KA 1ET6A 1FGBD 1MSGA 4BBRB 5IGEA 3I4NB 2NBFA 5C4ZA 4M8AA 2IJ0A 2DY7A 1D5MC 2B2TC 4KHVA 5E3FA 3SK4A 3TBIB 1STGA 5CV6A 3BDLA 4XT1B 1OO9B 2NWGA 3EQLC 3M85A 3GTKB 1KLGD 4DAPA 1Y8OB 1JR0D 3I3CA 4IUVA 2XRQD 3DXJC 1V8QA 1AN8A 2F03A 2EY1A 2X69A 2B2VC 5FLXE 2WP8J 5I9OA 3W2DA 2BE5D 2SDFA 2B2UC 3EROA 2HCIA 4C3IB 3Q24A 3BYTB 1CZGA 4IFDG 1SYDA 1OXVA 3T51B 2IT1A 3LNNA 4RCNA 4C2MB 3KUPA 1QWYA 5TSSA 1ET9A 4G4KA 1HCZA 1TY0A 1SYCA 1TT2A 1SE4A 2H4OA 1H9KA 4G57A 1LABA 3MTSA 1A3UA 3PUYA 1LACA 1A2UA 1RHPA 4K6DA 4RGOS 2VB3X 1MSHA 1BBXC 2L4NA 1WTPA 5C3EB 3BDOA 1F9QA 3OMGA 2HUGA 3I4MB 1WCMB 4BY7B 1Q90A 4IUTA 2SNMA 2IW3A 2RA4A 1SSOA 4N9PA 4V190 1PTOD 3BVMA 3S1NB 1ILQA 5EPLA 4XTCS 1KNEA 2B2WC 2K28A 3BDCA 4PMBA 2JSOA 2HQEA 4XYQA 2JEBI 4F88A 1A2TA 1F2ZA 2L9HA 3OW7A 3CRLC 4Y7NB 3ITPA 3VR5A 1HQRD 1GUNA 1EZ6A 2VUMB 2WIIB 2D9UA 1EEID 1B9NA 4EVOA 4IFDJ 1SNDA 4JBWA 3NTHA 5CV7A 3S16B 1S5FD 2Z1CA 2D2CC 2N55A 1D1IA 1UUPA 2F0FA 3NUCA 3A7LA 4QB4A 4ZK9B 1TVXA 1ZXTA 4KD3A 3GD7A 2EYMA 1EU4A 1A15A 4MHEA 2PZUA 2FHTA 1C48A 3C46A 1XWEA 3BVGA 1JB3A 4F8MA 3J7AF 3K5MA 3NQTA 2XSCA 3MXPA 1CFMA 3SK5A 1SE2A 4FF1A 2A69C 3TZDA 1EQTA 1SNMA 1KTKA 1IW7D 1PYWD 3R93A 3HOXB 3PUVA 4QIWB 2XWJB 4A3EB 1JQYD 1FNWA 5C3XA 2F0JA 4BS9A 4BWGB 2I07B 2LFNA 3H91A 1ILPA 5KEEA 1Q1EA 3NE5B 1EWCA 1JWSD 1U4RA 3SHLA 3QOJA 2NN6G 3K7AB 4DK0A 4A3GB 3MAQA 3V2TA 1CA5A 3TN2A 4GZYC 3W3AA 1EYAA 3ND9A 1NAPA 1WTXA 1B9MA 2RSOA 3TZUA 3BYYB 2DNEA 2ZXOA 3TP5A 3K0YA 4WJWA 2OXPA 3T13A 4ZLTF 3OWFA 4FVMA 1LT4D 2F0NA 4HR7B 2PW5A 1W6KA 2A6HD 2RDGA 3M7GA 1S5ED 3NBIA 1BCPF 3GQBA 2KECA 1LTBD 1Q8IA 3KK7A 5M5XB 3CHBD 2Z8LA 5KNBA 2F0OA 5EBDA 4WFN3 3H0GB 5LL6X 2RKSA 3DEOA 5ELDA 1PXUA 1YNND 1Z7TA 1VDZA 4XT3B 1PRTC 1NSNS 2NTTA 4O1NA 2K32A 3M7NA 1SJED 1BNZA 2KCNA 3MXGA 2R92B 4C56C 2PQEA 2QDBA 4IQZA 3FMCA 3LWUA 3LX0A 2QILA 3PUXA 5C4XB 4CGYB 4AYBB 1A3TA 2ENBA 2N88A 4R8IA 1H9JA 1ONLA 3CU7A 1U4MA 3OOCA 5EGTA 4FF3A 2RDHA 2KUMA 1V1OA 4DGZA 1LT6D 1R4QB 1EFID 3KLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PMC A;  3U9O A;  5HUR A;  1KDB A;  2M00 A;  5M9O A;  5CV4 A;  2F0F A;  5J1Z A;  3OSO A;  1EYC A;  3NUC A;  3NP8 A;  1EY5 A;  3MHB A;  4QB4 A;  4S3S A;  3TP5 A;  5KIX A;  2EY1 A;  2KQ3 A;  2OXP A;  1EY9 A;  1ENC A;  2F0I A;  3HEJ A;  4KD3 A;  1EY4 A;  4WOR A;  3T13 A;  5IGB A;  5I9O A;  2SNS A;  5C4H A;  3OWF A;  3TP6 A;  4B9W A;  2F0D A;  2F0W A;  3ERO A;  2EYM A;  4E6I A;  5CC4 A;  2KHS A;  4HMI A;  4OL7 A;  4QMG A;  2F0N A;  1STN A;  5IGG A;  1SYD A;  2PW5 A;  3ERQ A;  2SOB A;  2F0Q A;  3P1H A;  2PZU A;  4K5X A;  1SNP A;  4DF7 A;  4DU9 A;  1SNC A;  1SNO A;  4TRD A;  4WRD A;  5J22 A;  4K14 A;  4K8I A;  1EZ8 A;  2PYK A;  5IGD A;  1EY0 A;  3SK8 A;  4IUN A;  3SXH A;  4KTA A;  4B9X A;  2F0S A;  5J39 A;  3PMF A;  1JOO A;  4J6H A;  1SYC A;  1TT2 A;  2F0P A;  1TQO A;  4G57 A;  3RUZ A;  3DHQ A;  4F8M A;  1KAB A;  4ZQ3 A;  4N9T A;  1SYG A;  5I6Y A;  1JOR A;  5CV9 A;  4K5V A;  5JAV A;  1KDA A;  4K8J A;  2EYJ A;  4NKL A;  1RKN A;  1STB A;  1A3U A;  3NQT A;  4ZUI A;  2F0U A;  3H6M A;  4ODG A;  2F0O A;  1EYD A;  1SYE A;  3MXP A;  4K2K A;  2PZT A;  3VA5 A;  4HTH A;  3E5S A;  4IAL A;  5DEH A;  2F0K A;  1A2U A;  5F2D A;  4R8N A;  4DFA A;  4K6D A;  2NUC A;  2RKS A;  5KYL A;  4EQP A;  2EY6 A;  4ZUJ A;  3SK5 A;  4KY7 A;  4LAA A;  1F2M A;  4KV6 A;  3P75 A;  3SR1 A;  3D4W A;  3MVV A;  4PNY A;  2EY2 A;  3R3O A;  3OMG A;  4IZ8 A;  3MEH A;  1JOQ A;  5HGT A;  1U9R A;  2EYF A;  1F2Y A;  4K2L A;  4ID6 A;  4EQN A;  1NSN S;  2PW7 A;  1IHZ A;  1SNM A;  5JOB A;  2F0T A;  3EJI A;  2F3W A;  4KJN A;  5CV8 A;  5C3W A;  5IOC A;  3T16 A;  2F3V A;  2SNM A;  3DMU A;  3D6C A;  2WAC A;  3S9W A;  5C6A A;  4F7X A;  2EY5 A;  4KJO A;  1KAA A;  3NHH A;  1SYB A;  1SNQ A;  2EYH A;  2EYP A;  2EYL A;  1A3V A;  3D4D A;  3D8G A;  3C1F A;  4KY5 A;  4N9P A;  4RKB A;  5E1F A;  5IGC A;  5CGK A;  5CV5 A;  4NP5 A;  1EQV A;  5C3X A;  3QB3 A;  2PQE A;  2QDB A;  2O4X A;  1ENA A;  2F0J A;  3HZX A;  5KYI A;  1JOK A;  5NUC A;  4MIU A;  4HMJ A;  5C5L A;  3QOL A;  2PZW A;  4KY6 A;  5I6W A;  4YIJ A;  1EY8 A;  2RDF A;  4K5W A;  4RKL A;  3TME A;  3MZ5 A;  3TP7 A;  3LX0 A;  2F0G A;  1EY6 A;  4H7B A;  3BDC A;  4PMB A;  2HQE A;  1STA A;  3OMC A;  2EYO A;  2F0H A;  4QF4 A;  5IIF A;  1A2T A;  5IGE A;  3NK9 A;  1A3T A;  1F2Z A;  2ENB A;  5KEE A;  5C4Z A;  5EKK A;  5ISR A;  1TR5 A;  2F0V A;  5IGF A;  5CR3 A;  3ITP A;  4NDX A;  2F0M A;  4J1M A;  4EQO A;  1STH A;  3EVQ A;  5EKL A;  1STY A;  3SHL A;  1EZ6 A;  4I65 A;  3QOJ A;  3TP8 A;  5EGT A;  2OF1 A;  4KHV A;  5E3F A;  4EVO A;  3SK4 A;  2OEO A;  5C5M A;  3V2T A;  2RBM A;  4NMZ A;  2LKV A;  1STG A;  1SND A;  5I9P A;  5CV6 A;  5DAU A;  1EYA A;  1NUC A;  3BDL A;  2F0L A;  5IOD A;  5KGU A;  2EXZ A;  4DGZ A;  1II3 A;  3SK6 A;  1KDC A;  1AEX A;  1SYF A;  3NXW A;  2F0E A;  5CV7 A;  5K5P A;  1EY7 A;  4ME5 A;  4KD4 A;  5KRU A;  3C1E A; 
#chains in the Genus database with same CATH topology
 1TWG B;  1M8A A;  4YCV A;  5E4W C;  2JA6 G;  3I56 A;  1Q1B A;  1ENC A;  3KF8 A;  5GAH C;  4BY1 B;  1VQ7 A;  4LF8 L;  5IGB A;  3S16 H;  3E9H A;  3PIO 3;  2DUD A;  2UUB L;  1I3Q B;  2IWH A;  2I46 A;  4EGV A;  5C0X G;  1NNX A;  1I50 B;  1WD1 A;  1S40 A;  4K5X A;  4QY7 A;  4XXE A;  4V0B A;  4KKU A;  3DUZ A;  4HJ9 A;  2R7F A;  3SXH A;  1CKM A;  1I4G A;  4DAM A;  4B3S Q;  1OXU A;  4CDC C;  1HZC A;  3TDQ A;  1CZW A;  1TQO A;  3IL8 A;  5CV9 A;  4JK1 C;  4JI6 L;  2BCO A;  5IYD G;  1STB A;  1E2Z A;  2IX1 A;  4X6A H;  2V1C C;  2B8G A;  4IAL A;  3VR2 A;  1PFS A;  4JI7 Q;  3F2B A;  2HCC A;  2MPM A;  2EY6 A;  1EWH A;  4FO2 A;  3GV3 A;  4CKC A;  3NEN A;  3S1M B;  3MEH A;  5IT9 E;  4EQN A;  4OGQ C;  1Q82 C;  5JOB A;  4A3F B;  2LS0 1;  3KF8 B;  5CV8 A;  4C3H G;  5IWA L;  1WVL A;  3NWT A;  4CJ1 B;  3E6Z X;  1SNQ A;  2DY8 A;  5T1I A;  4IUP A;  5CV5 A;  1HTP A;  2OTL A;  1FNU A;  2MP1 A;  3HZX A;  3NSW A;  3D0F A;  3PO3 G;  3I55 A;  2K52 A;  1JJ2 A;  5FKA C;  4A3K G;  1I4R A;  4BA2 I;  2HDL A;  3TME A;  1AFP A;  1D6E C;  1EY6 A;  1B3Q A;  3I91 A;  1QOH A;  5D65 A;  4X64 Q;  3DWA A;  2K5W A;  2F0V A;  1IYJ B;  3A7A B;  2F0M A;  1BF4 A;  2WAQ G;  3SE0 A;  3S15 B;  3HG9 A;  2E5L Q;  1I6H B;  1N9W A;  3R2I A;  5C0X J;  3SEB A;  2EZV A;  1T5E A;  4R4I A;  2KCC A;  3HFZ B;  4ZYS A;  4JI3 Q;  4A3D B;  2F0E A;  1G29 1;  1HFG A;  3Q8D A;  3K5L A;  3GTO H;  4NW2 A;  3AFQ A;  1U4P A;  4K6L A;  3CCU A;  4JOI C;  3UDX A;  5JJI A;  2NZO A;  2E2D C;  3T1Y Q;  4XDX A;  5M5W H;  1RDP D;  2NVT H;  3E0J A;  3HOW B;  5C4J H;  3CC7 A;  2R61 A;  3HEJ A;  5C4H A;  3PQI A;  1VQO A;  3GO5 A;  1N8R C;  1MKH A;  4P71 A;  5JPM C;  1CHP D;  3ERQ A;  3C2P A;  4BBR G;  2NB0 A;  4DU9 A;  3I4N G;  1K73 C;  1OTC A;  1I4P A;  1QIL A;  1EZ8 A;  1EY0 A;  4G7O C;  4TQU S;  4FNF A;  3V96 A;  2AQ3 B;  3J81 L;  2D5D A;  2ZT9 C;  4MTN A;  5JAV A;  4OX9 L;  2JYO A;  3FPP A;  4CKB A;  2EYJ A;  4NKL A;  3U4V A;  5CYU A;  2B2T A;  4HTH A;  4L5T A;  5DEH A;  1Z9F A;  2K5D A;  4KMU C;  1N32 L;  2ZM6 L;  4OEM B;  4G7Z C;  1HZB A;  2NZH A;  3CCQ A;  3VA7 A;  3D4W A;  4IZ8 A;  4DV4 L;  3NTI A;  3J7A 5;  3L3O C;  4L5Q A;  1Q8K A;  5M5X H;  3J7Z C;  2OCE A;  2I5L X;  3G7L A;  4APV A;  1FNV A;  3J80 L;  2EJM A;  3H0G H;  4C3I G;  1JWM D;  2E8G A;  5C3W A;  3A54 A;  2WAC A;  4Q0F A;  1PH5 A;  2PCF B;  4NXN Q;  1SN8 A;  3AYH B;  3T56 B;  4DV2 L;  3CQZ H;  4PMW A;  1KRT A;  4DV7 L;  4HJ5 A;  4WJ3 M;  2UXB L;  1TU2 B;  3E0E A;  3Q6S A;  4FF4 A;  1BO0 A;  3GTQ H;  5NUC A;  2Z9H A;  1JJG A;  3GTL B;  3TP7 A;  1G6Z A;  4H7B A;  4LUO A;  1K3R A;  5BR8 L;  1PTO F;  3S1R B;  1P8L A;  3OMC A;  2O5J C;  1YNN C;  3I4O A;  5EKK A;  1HNW L;  1D7Q A;  1K0R A;  3EVQ A;  4RG1 A;  3TQY A;  2QEJ C;  1E24 A;  2VY3 A;  2BDN A;  3MFY A;  2Z6K A;  2RF4 A;  2WAQ E;  4LJZ C;  3S1Q H;  3VYS A;  5C3E G;  3FP9 A;  2B8F A;  4KLK A;  3I4M G;  2GVA A;  2CH4 W;  2E75 C;  3EIV A;  4FXG C;  3SK6 A;  3PO2 B;  1WCM G;  1MIU A;  1K8A C;  4DUZ L;  5CBE E;  4BY7 G;  1SFO B;  4A3L H;  1DGS A;  4DV1 L;  4ID6 A;  1MJE A;  1IBL Q;  1WOC A;  1E7Z A;  4LF9 Q;  3VR6 A;  5M9O A;  3BZD B;  3VYR A;  3CCJ A;  1XNQ Q;  2FMM A;  4A3C G;  1UE7 A;  2VNU D;  1QZG A;  3AMU A;  1CTM A;  2Q8I B;  2JA7 H;  1D2B A;  3ZJY C;  4YY3 Q;  1JB7 A;  2F0W A;  3I73 A;  3L0O A;  5IP7 G;  2IY5 B;  1PVO A;  4KKT A;  4X3S A;  2NVQ B;  4DPG A;  5A35 A;  4OIJ A;  4P2C B;  2CVR A;  2H5X A;  1LTG D;  4BY1 H;  4HSP A;  2B2W A;  1YHQ A;  1VMP A;  1JOO A;  2E2I B;  2FMC A;  2VUM G;  2B2Y C;  1SRU A;  4XQQ A;  4N9T A;  1AZQ A;  4FYD A;  1I50 H;  5JEA H;  1K28 A;  1KHI A;  4ABN A;  3GTG B;  3MXN B;  3IFD A;  4ODG A;  5IYC G;  1EYD A;  3GV6 A;  1IYU A;  4TKO B;  3H09 A;  3Q0A A;  2L11 A;  4EQP A;  1UE5 A;  4ZUJ A;  4JYA Q;  1F2M A;  4ZRZ A;  1QNU A;  2A68 C;  2K14 A;  5FK9 C;  4K2L A;  1F2Y A;  1L1O C;  4OEL B;  3CCM A;  2BH8 A;  3K8A A;  2QW7 A;  4YWM A;  2UUC Q;  4PZ8 A;  2ICI A;  1N33 L;  1H9M A;  5E7N A;  2F3V A;  3STB C;  3GTP B;  1KNA A;  3I2Z A;  3RNU A;  5IGC A;  2XWB B;  5E1F A;  1L2F A;  3UDF A;  1BDO A;  2L5T A;  1IBK L;  1A6X A;  2IL8 A;  4MIU A;  1SE3 A;  5C5L A;  3KOJ A;  3HOZ H;  2RDF A;  2Q8R E;  1VQK A;  1CHQ D;  3MZ5 A;  1CQF A;  3K57 A;  1WYD A;  3J7A V;  1BCP C;  1MGS A;  1F2L A;  1S72 A;  2YU9 B;  4MN3 A;  2JXM B;  5ISR A;  2Q8T A;  2EXD A;  4R4O A;  1VQD A;  2UUA L;  4K0K L;  1JJC B;  1S5C D;  4PZ6 A;  3G4S A;  3TP8 A;  3RR5 A;  2OF1 A;  4LFB Q;  1TWH H;  1SMY C;  5C5M A;  5FLM H;  1QVF A;  3CXC A;  4CBV A;  3E9I A;  4DR5 L;  3KLS A;  1NR4 A;  2EXZ A;  1AEX A;  4X66 Q;  3D4R A;  5KRU A;  1HR0 Q;  5FO8 B;  2IX3 A;  2CHB D;  4GNX A;  2VQF Q;  1DOM A;  5J1Z A;  1XXG A;  4KHP L;  1B4O A;  2A6E C;  2JP1 A;  4DV6 Q;  1XMQ L;  3HOX G;  4LF4 Q;  2RVL A;  4A3E G;  1U0L A;  1LTR D;  4H0L C;  2ZTD A;  2SNS A;  4E6I A;  2JA8 B;  4KHZ A;  5IP9 H;  2NVY H;  4HMI A;  2KA7 A;  2G9H D;  1K0S A;  1CK1 A;  2WFW A;  2VL6 A;  2QKI C;  5J22 A;  1IKM A;  3OW2 A;  3BVZ A;  1EOV A;  3PGZ A;  5GAD C;  3ULJ A;  3MFG A;  1CM9 A;  2M2L A;  4A3G G;  4K5V A;  1KDA A;  1RF2 D;  1ML0 D;  3K5O A;  3K6O A;  4X65 L;  1HA5 A;  2PZT A;  3FEW X;  3VA5 A;  3OTO L;  1XPO A;  1EEF D;  5LMN Q;  4R8N A;  5GAE C;  3K5N A;  3K58 A;  1TY2 A;  4DKA C;  3OPO A;  2L55 A;  2YV5 A;  3CP0 A;  4JI5 Q;  3MVV A;  4P74 A;  1TXY A;  1YJ9 A;  1SEB D;  1I5F A;  4FXD A;  4DAY A;  2MNA A;  1LTA D;  1QE6 A;  2HQL A;  3Q22 A;  4KJO A;  3NHH A;  2Z0S A;  4MNO A;  3D8G A;  1GUS A;  4LW1 A;  1GD7 A;  1HHV A;  5KNC A;  1LV9 A;  4C3J H;  4ULL A;  3QB3 A;  1ENA A;  2E2J B;  3DEP A;  3S14 B;  2MO1 A;  2Z4H A;  3BZC A;  4RKL A;  4YHH Q;  5COY A;  5M3F B;  1JT8 A;  1HJP A;  1L0Y B;  3BZK A;  2JK8 A;  1F9P A;  3H0G G;  5CBA E;  2P5Z X;  1HNX Q;  1FJG L;  1MI2 A;  2EJG C;  4DUY Q;  3S1R H;  2LKV A;  4B3T Q;  4BBS B;  2XNA C;  3NTK A;  3J81 j;  1II3 A;  5K5P A;  1SJH D;  1TWA B;  4TVA B;  4KD4 A;  2CH4 A;  2EQS A;  2NYZ D;  3FDT A;  1M4V A;  2BA1 A;  3MHB A;  1WTW A;  4RGT A;  2R92 G;  4HCE A;  4A75 A;  5JJZ A;  4IN3 A;  1H9R A;  5G3L D;  3GTO B;  2F0I A;  1G91 A;  2UXD Q;  1J9O A;  1CKO A;  1IYV A;  3TP6 A;  1SFO H;  1QG7 A;  5AFW A;  5M5W B;  5LL6 S;  2NVT B;  5C4X G;  4YCU A;  2Y0S B;  1CKN A;  4B3S L;  4AYB G;  3GDE A;  5C4J B;  4DF7 A;  1IKL A;  4TRD A;  3I70 A;  3WOE A;  3K7U C;  2LMC B;  3ZYY X;  1SXT A;  4A3L G;  4IUN A;  1X3P A;  2DGY A;  3PMF A;  3R2T A;  1J8I A;  3DHQ A;  4JI7 L;  4KN7 C;  2NVQ H;  1QJO A;  1Y1W B;  4ZUI A;  4DV3 Q;  5ELC A;  1QZH A;  1F77 A;  5F2D A;  3S2D H;  2Y0S E;  2IX0 A;  2J0T D;  4NPS A;  1W6J A;  1LTT D;  1VQJ A;  4KV6 A;  2JEA I;  1HPC A;  1PRT B;  1JOQ A;  3GTG H;  2M9V A;  1GXD C;  4O42 A;  4DNR B;  1IHZ A;  3JAM c;  4BY1 G;  2F0T A;  1MBY A;  4JBK A;  2UXC L;  3EJI A;  1ASY A;  3KFU A;  5A2Q E;  3H15 A;  3DMU A;  1FL0 A;  4RHS A;  1RCV D;  3OIQ A;  4RGM A;  5JEA G;  1CSP A;  3RN2 A;  2CKZ B;  1KQS A;  4IPD A;  2EJF C;  2RSN A;  1DZ1 A;  2K4K A;  1DCZ A;  1GO3 E;  5I6W A;  4A3M H;  1PHJ A;  2BE5 C;  3GTP H;  3CQZ B;  1YIJ A;  2YYZ A;  1X32 A;  1X6O A;  2E5L L;  3GTQ B;  2KEE A;  1TR5 A;  2WKD A;  2MJ8 A;  4FDB A;  4RAU C;  4HJ7 A;  4JV5 Q;  3M4O H;  3FHW A;  4C1N I;  1ASZ A;  5KGU A;  1AH9 A;  2A8V A;  3U58 A;  4F87 A;  5K36 H;  3T1Y L;  4A3F G;  1VMC A;  1K3B C;  4OWT B;  3I8Z A;  1K8M A;  1WTV A;  3AEV A;  4CKE A;  3NBH B;  2WKC A;  2K01 A;  3S1Q B;  1OXS C;  2F4I A;  1RL2 A;  5CV4 A;  3M4P A;  3E3X A;  5JPN C;  1YI2 A;  1YNJ D;  3HOU H;  3KBX A;  1B44 D;  3CC4 A;  1RIP A;  5EQ0 A;  4DK6 C;  2NN6 I;  4IUR A;  3G48 A;  2F0D A;  3HKS A;  2X6L A;  5FLX c;  2VXW A;  1R4P B;  1PYS B;  1ICF B;  3U9S A;  3OYY A;  5FLM G;  2CQA A;  4AH6 A;  2QEX A;  2JA7 B;  2QGQ A;  3HGB A;  3KDF B;  2BH2 A;  2VW9 A;  3CAM A;  1WTO A;  1PTO C;  3KJO A;  3RMH A;  5E4X A;  5COR A;  2RQX A;  1EIH A;  1MD2 D;  2JA8 H;  1E2W A;  4LF7 Q;  2R93 B;  1YBY A;  3ER0 A;  5BN5 A;  1W3S A;  2F0U A;  1SYE A;  3QWN A;  5T1G A;  4IJL A;  4A3D G;  1CUK A;  4B3M Q;  2JN4 A;  2HDM A;  2JE6 I;  4ME3 A;  4QGU A;  3P75 A;  3SR1 A;  1GHK A;  2RCF A;  3VYU A;  3HOW G;  4NXN L;  4DR3 Q;  4UP9 A;  4UP8 A;  3QIA A;  1FVI A;  3GTM B;  3EFX D;  3ULP A;  4JOI A;  1Q7Y C;  2CQO A;  4DR1 Q;  1PLF A;  1SYB A;  4TSS A;  4B3R Q;  2B3G A;  1XMO L;  2O5I C;  2IPK D;  1TS5 A;  3K0X A;  4BXX G;  4RHR A;  1XX8 A;  4RMF A;  4N8X 1;  4DV5 L;  4HMJ A;  2V4D A;  4GOP C;  1EYG A;  4YIJ A;  5FJ8 H;  5IY0 A;  1EUJ A;  2NTS A;  1GHJ A;  3OWE B;  2N49 A;  2HIX A;  5J3B A;  4LFC Q;  3NPP A;  1EIY B;  3HOZ B;  4ALP A;  2ZXP A;  2E2J H;  1STH A;  3S14 H;  3P20 A;  1EIG A;  3T1H Q;  1GUW A;  3WDN A;  4JPB W;  2PO4 A;  4L8J A;  5M3F H;  1GUO A;  2OEO A;  4LUV A;  2F0L A;  1B3A A;  1DYQ A;  3KBG A;  3RZD H;  4P73 A;  3NXW A;  3W1B A;  1XNQ L;  2Z4I A;  2DJF C;  1VQ8 A;  1LT5 D;  1TWH B;  5HUR A;  1KDB A;  3A74 A;  3M4Y A;  2K5Q A;  3D6W A;  4YY3 L;  1AZP A;  5BN4 A;  1CQV A;  3K80 C;  1PFN A;  3CPF A;  3J7Y W;  4DR2 Q;  4FP5 D;  2KQ3 A;  3ND8 A;  4BBS H;  2VB2 X;  1NY4 A;  1TWA H;  5CC4 A;  1RTN A;  1HRJ A;  1HXY D;  1IW7 C;  4OL7 A;  2BDO A;  2A1A A;  1UWV A;  5ELF A;  1YVC A;  1WTH A;  1Y14 B;  2NVY B;  4JI0 Q;  1M90 C;  4KTA A;  3HKZ B;  3AFP A;  4J6H A;  3IAY A;  3RUZ A;  2CCZ A;  4GKK Q;  5I6Y A;  4PG3 A;  1LYL A;  3MA2 B;  4JYA L;  1VQP A;  2VZA A;  4JG2 A;  1B7Y B;  3A55 A;  1X65 A;  4DN4 M;  3PO2 G;  5C0X I;  2HT1 A;  2NUC A;  4J8Q A;  2F3I A;  3BG3 A;  3KJP A;  4KY7 A;  3H3V C;  2UUC L;  3PIP 3;  4XQJ A;  1SDF A;  3A8I E;  4G7H C;  1GM5 A;  1Y1W H;  4NB3 A;  2B63 B;  3GTJ H;  2BOS A;  4LUZ A;  1WTQ A;  1BXT A;  2AWO A;  1Y69 U;  2FXQ A;  4JI8 Q;  4CDD C;  4DV0 Q;  1CT1 D;  1IBM L;  1IL8 A;  2C35 B;  1S4Z A;  2HHH Q;  3SGI A;  4RFB A;  1O80 A;  4O0A A;  1N34 Q;  2EIF A;  1TKW B;  3K81 C;  4DR4 Q;  1QVC A;  1VQM A;  1JOK A;  2D0O A;  4CHT B;  3UDI A;  2JQO A;  2L12 A;  4JI4 L;  4KN4 C;  1E0B A;  1IL2 A;  5EBC A;  4C3J B;  4HCS A;  2A6H C;  4LFB L;  2PQA A;  2VS1 A;  3PUZ A;  2I5H A;  2LSS A;  2B2Y A;  1U5K A;  2H1E A;  2RHQ B;  3BS1 A;  2B2V A;  2PPB C;  4X66 L;  1PMR A;  4DA2 A;  1ESR A;  1HR0 L;  2B2U A;  5I9P A;  5IYB H;  2A69 D;  1DJR D;  1O7I A;  4OO1 I;  4DR7 Q;  2UUB Q;  1A62 A;  1XTC D;  4LF4 L;  1E22 A;  1BR9 A;  3L2P A;  1PH1 A;  1DM0 B;  4S3S A;  2EE1 A;  3EA6 A;  1EOT A;  3JAM L;  4RWS C;  1PTO H;  2DNC A;  5D3D A;  2OWO A;  2N78 A;  1O7L A;  1ZYR D;  4FXK C;  3MXN A;  1PZJ D;  1STN A;  4IJH A;  1ROD A;  5LHY 1;  1SNP A;  4PQX A;  2DN8 A;  1Z47 A;  1X55 A;  1FYC A;  1GOZ A;  3RZO H;  2PQA B;  4RGN A;  4B9X A;  3U50 C;  3F2D A;  3CCL A;  4X3U A;  3HOV H;  4L6T B;  5C44 H;  1KAB A;  1CA6 A;  4XYO A;  3MEF A;  4R4C A;  1V1P A;  5LMN L;  3N6R A;  2VQE Q;  2KOL A;  1AW7 A;  1RKN A;  2K5V A;  4JCV E;  4JI5 L;  3KLS X;  3AU7 A;  2L0C A;  5IWA Q;  1PH9 A;  3A0J A;  3TS0 A;  1F9S A;  3T53 B;  3IKJ A;  2CW0 D;  1JE5 A;  1NBW A;  4PNY A;  2R93 H;  2C5C A;  3R3O A;  1L1O B;  1PZK D;  1U9R A;  1U4L A;  3S2D B;  5GAG C;  1Q12 A;  1W2B A;  3EN2 A;  2JA8 G;  5IOC A;  1X3Q A;  1I4H A;  3FPU B;  4X62 L;  4GN3 B;  1TS3 A;  3D4D A;  4A93 H;  2YTY A;  4RKB A;  3X3M A;  3X3N A;  2ID0 A;  2WB1 B;  4YHH L;  1V1Q A;  3CRK C;  4XQN A;  3I72 A;  5D3I B;  2ZJR A;  3QOL A;  3CPW A;  3GTM H;  1EY8 A;  5FLX L;  1FR3 A;  1BCP B;  5M3M H;  2B39 A;  2E2H H;  1EIF A;  4QF4 A;  3H94 A;  1HNX L;  1V1P B;  3UI2 A;  3D31 A;  4A3M B;  2R7D A;  1NCV A;  2OQK A;  1PH4 A;  2XVS A;  4IO9 A;  2X6G A;  2E76 C;  1DOL A;  3HS0 C;  2WB1 E;  3V05 A;  4MTK A;  2RBM A;  4NMZ A;  4OHJ A;  1SLJ A;  2I5M X;  1PRT D;  2JA5 B;  3HRZ C;  1V9P A;  5M5Y B;  5JVH 3;  5FJ8 G;  1Q86 C;  3C1E A;  3M4O B;  1B1Z A;  5ELN A;  1ZEQ X;  1C4Q A;  3CKI B;  2UXD L;  2KJX A;  3HOY H;  1UNS A;  5HY6 A;  3S2H B;  1LM0 A;  1EY9 A;  5ELE A;  2Z6K C;  1JC7 A;  2KHS A;  1WTR A;  2R7Z H;  2LXJ A;  5M3F G;  4RCO A;  3HOU B;  3DLL A;  3TS2 A;  5G3L F;  4OIK A;  4M1U B;  4K8I A;  2K05 A;  4HAE A;  5ELB A;  2F0S A;  2SEB D;  1DON A;  4DV3 L;  2OT2 A;  1YEZ A;  4ZQ3 A;  1HUM A;  1QNK A;  2KED A;  4K8J A;  4A3J H;  3RLF A;  4BBS G;  3H6M A;  3AB9 A;  5BN3 A;  3F1Z A;  3PF4 A;  4K2K A;  4R4Q A;  4POF A;  4P72 A;  4HN7 A;  1G2S A;  1VQC A;  3WWV A;  5KYL A;  4DV2 Q;  2K6A A;  4DV7 Q;  1YJW A;  1HNZ Q;  1GKH A;  2JA6 H;  4LK1 C;  2WIN B;  2EYF A;  3VR3 A;  2ZJQ A;  1EU3 A;  2PW7 A;  3QJY A;  1EQR A;  4IOC A;  2PNH A;  5IT9 c;  1VQ5 A;  2QCP X;  2F3W A;  4LWC A;  1VQN A;  1VQG A;  1SRO A;  1BBU A;  4IPH A;  4F7X A;  2AMC B;  2Y0S G;  3C1F A;  5C0X H;  1HNW Q;  4X3T A;  1VQA A;  4X3K A;  2KEN A;  4IFD I;  2B63 H;  2IHF A;  5DNF A;  1VF7 A;  1NJI C;  2A19 A;  4BA1 I;  3SDZ A;  4HID A;  4IOA A;  1DD2 A;  2GN5 A;  2F0H A;  5IIF A;  4DXG A;  1BOS A;  2RHS B;  3NK9 A;  1Y1W G;  4DK1 A;  4DUZ Q;  5IGF A;  3C3L A;  5IYD H;  4J1M A;  5I4D A;  1NR2 A;  5EKL A;  4CDE C;  3KLW A;  4C1N K;  1QVG A;  5AJ3 Q;  1OXX K;  4ZKC B;  1DOK A;  5EJW A;  4QCL A;  1SYF A;  1TII D;  1EY7 A;  3UE1 A;  1JWU D;  4GN4 B;  2M00 A;  1X3F A;  3RZD B;  2GVB A;  1WI5 A;  4XIG S;  4ILW A;  4WOR A;  4OWX B;  1C9O A;  1B70 B;  4OO1 H;  5I2Y A;  2FJ2 A;  4A3K H;  4QMG A;  3CF5 A;  1L0X B;  1E3P A;  1LTL A;  3ONA B;  4QQB X;  3GP7 A;  5IYB G;  1JE4 A;  1SNC A;  1STE A;  2WV6 D;  3WOF A;  4GNX C;  1X3G A;  1VQH A;  3B6Y A;  4K14 A;  4LF7 L;  2PYK A;  5IGD A;  2K03 A;  1PFM A;  4JI1 Q;  2MUY A;  1PV4 A;  1ICW A;  4LFA Q;  4Z9C B;  1I4Q A;  1EL0 A;  4B3M L;  2XIW A;  4AQY Q;  2XTI A;  3R8B A;  1H9S A;  2Z6B A;  3DM1 A;  3M3Y H;  1LUZ A;  2CFM A;  3S17 H;  1BUV T;  1SBB B;  1Y1V B;  4DR3 L;  1G2T A;  2ZTC A;  3OIP A;  3DWQ A;  3A8J E;  1ZYR C;  1D8L A;  1IBK Q;  2PI2 A;  2XN9 C;  4DR1 L;  1VQ4 A;  2MQH A;  4B3R L;  5HGQ A;  1VQF A;  2A73 B;  3T16 A;  3RLO A;  3A8K E;  3L9A X;  1I6V C;  3LWE A;  4KY5 A;  2EYP A;  1DXM A;  1YNX A;  1A3V A;  4EQO A;  1S5B D;  3PIO A;  2JA7 G;  1YIT A;  3GTJ B;  3D3R A;  1QUQ B;  3I90 A;  1EQV A;  1B50 A;  4BBR H;  3I4N H;  2J4X A;  5FOB B;  3M9B A;  2A74 C;  5EKI A;  2PZW A;  4LFC L;  2LY7 A;  4K5W A;  1VCI A;  3O13 A;  1B2T A;  2AUK A;  2F0G A;  1S5D D;  4GLA C;  2R93 G;  3A5Z B;  1SR3 A;  5CMD A;  2CW0 C;  3T1H L;  2EVB A;  1GUG A;  3NBH A;  1YZ6 A;  3S24 A;  5CR3 A;  4NDX A;  1H9S B;  1QB5 D;  5KND A;  4LNQ A;  1NMF A;  3GTK H;  2MFI A;  4QUF A;  4I65 A;  1HQM C;  2J7Z A;  2F4V Q;  4KKS A;  5A2Q L;  4A3B B;  2C9O A;  3M4Q A;  1X3E A;  1TWC B;  2K04 A;  4I7Z C;  4KK7 A;  1PH7 A;  1YJN A;  3F2C A;  1KDC A;  4X64 L;  1HA6 A;  1FD7 D;  4ME5 A;  1S3O A;  4DR2 L;  1UEB A;  4A76 A;  3PCO B;  4PMC A;  1JCK B;  4C3I H;  2KBN A;  3PSI A;  1PH2 A;  3KDF A;  3CCS A;  3OSO A;  1EYC A;  1J5E Q;  1AE3 A;  5KIX A;  1V43 A;  1HTL D;  3RN5 A;  4GKJ Q;  4EX5 A;  2JA5 H;  1KRS A;  3DM3 A;  1KIX A;  5M5Y H;  4JI3 L;  4C2M H;  4L5S A;  1O7Z A;  2AHO B;  4UHV A;  4IUQ A;  2PI2 E;  4JI0 L;  5DM6 3;  2SOB A;  2AQ1 B;  3S2H H;  1LO5 D;  1PTO B;  1UE1 A;  2QA4 A;  1ZKO A;  2K5N A;  4GKK L;  1KL9 A;  3HOZ G;  4ZKB B;  3NWS A;  4A4I A;  1NTG A;  1MHW C;  1D5X C;  4ZAI A;  1SYG A;  1UEA B;  5EPJ A;  5IE8 A;  4DAV A;  4RA8 A;  4KI0 A;  3RZO B;  1KXL A;  2OQ0 A;  5C3E H;  3P7J A;  2PMZ B;  3E5S A;  3I4M H;  1D5Z C;  4CJ0 B;  3HOV B;  5C44 B;  1WCM H;  4BY7 H;  1VQE A;  2AQ2 B;  4LAA A;  2R6G A;  4QUC A;  3ULL A;  2AWN A;  4JI8 L;  4GLV B;  1HH2 P;  4A3C H;  3URY A;  3S1N H;  4PZ7 A;  4KJN A;  2HHH L;  1GVP A;  3FKI B;  5LMU Q;  2MGS A;  1N34 L;  4DR4 L;  5JEA J;  3ICE A;  5IP7 H;  1CI3 M;  5JVG 3;  2PMZ E;  5CGK A;  4NP5 A;  2NVX B;  4GOP B;  1O78 A;  2D62 A;  3PIP A;  5IP9 G;  3IRB A;  4KY6 A;  4Y7N H;  1BKB A;  3HKZ G;  4JC0 A;  4HJA A;  4A93 B;  4MZ9 A;  3CCE A;  4GLX A;  2VUM H;  2FIN B;  4UAI A;  3FRP B;  1LLR D;  4CJ2 C;  1PYB A;  1PFB A;  2QF7 A;  4JI2 Q;  4HJ8 A;  1WD0 A;  1I94 Q;  5IYC H;  1OXT A;  2G9D A;  1BBW A;  4R4T A;  2E74 C;  5M3M B;  4DR7 L;  2E2H B;  1AE2 A;  1PDQ A;  4IFD H;  5GQO A;  2PNR C;  4L63 B;  1M1K C;  3MWY W;  1C0A A;  2O2L D;  2A68 D;  5DAU A;  2EPB A;  1NUC A;  4DR6 Q;  1VQL A;  3U4Z A;  4JBM A;  2B63 G;  1B53 A;  2XRS D;  4YCW A;  4FF2 A;  2EOT A;  3NQI A;  3I4L A;  3STB D;  4LMQ D;  3HP3 A;  3U9O A;  2ALY B;  2KCT A;  3UE0 A;  1F9R A;  5FO7 B;  4UPA A;  2R3Z A;  5ELO A;  4IUU A;  5IT9 L;  4A3I B;  4DXF A;  4Q5V A;  1EY4 A;  4B9W A;  2RCN A;  1NMG A;  3BJU A;  3HOY B;  3F2U A;  1BCP D;  1B8A A;  5IGG A;  4HIM A;  1GUT A;  1IBL L;  4LF9 L;  2F0Q A;  3P1H A;  2ZJP A;  4C3J G;  3K59 A;  4WRD A;  3DWP A;  2TMP A;  3JC6 6;  2VQE L;  2NZ1 D;  2JJQ A;  1QCB D;  3VR4 A;  3A56 A;  4POG A;  2R7Z B;  2AUJ D;  1JIC A;  1JOR A;  1SMY D;  3I7F A;  2KCM A;  4LF5 Q;  3H3V I;  2UXC Q;  5JJK A;  5FO9 B;  3G6J B;  3OHX C;  1EFW A;  1HFN A;  2F0K A;  1RTO A;  1RD9 D;  4OO1 G;  2GA4 B;  2EDG A;  3TSS A;  3N52 A;  4A3J B;  2ICE C;  1K83 B;  2A6E D;  4RH6 A;  4PV1 C;  1HZA A;  3CMA A;  4QL5 A;  5HGT A;  5H1S E;  4U67 3;  1P16 A;  3HOX H;  1G8Z D;  3VYT A;  4A3E H;  3UDG A;  1KLU D;  2Q2H A;  4CDF C;  2ES2 A;  4GS3 A;  2K33 A;  1K8O A;  3S9W A;  3MC0 B;  1XNR Q;  5C6A A;  1Y1V H;  2EY5 A;  2JA6 B;  2A5H A;  2EYH A;  2EYL A;  5L37 A;  3IFT A;  4LF6 Q;  1BQQ T;  3PV0 A;  5D14 A;  2O4X A;  1PZI D;  1IXR A;  5KYI A;  2K1B A;  4JW0 A;  1C8C A;  4AIM A;  3TEH B;  1R9T B;  1ENF A;  3RD4 A;  2YTX A;  1SAP A;  1VQ9 A;  3Q23 A;  3HKZ E;  2N8N A;  3K7A H;  2EYO A;  3T4A C;  4A3G H;  2UU9 Q;  4DNT B;  1WJJ A;  1AP0 A;  2B29 A;  1N36 Q;  2KVM A;  3FVQ A;  5I2X A;  1STY A;  1XYI A;  4DNI A;  3NEM A;  1RJT A;  5IOD A;  4NXM Q;  1E1T A;  3J81 E;  1EWI A;  3G6E A;  5DM7 3;  2F1M A;  1PRT F;  2L1B A;  1Z6H A;  4N8F A;  1XJV A;  3NP8 A;  1EY5 A;  4UDU C;  3MXU A;  4A3B H;  1FGU A;  4JBJ A;  2BA0 A;  1TWF B;  1TWC H;  2WB1 G;  4UY8 C;  3KYH C;  1HUN A;  1K8G A;  4C3H B;  1I4X A;  1WFQ A;  4U68 A;  4LF8 Q;  1Q81 C;  2VQF L;  1VF5 C;  1SE8 A;  3W5O A;  1SNO A;  3J80 E;  4DV6 L;  4A3M G;  1LTS D;  1Y8P B;  2ZXR A;  3PO3 B;  2K7V A;  3SK8 A;  3SVM A;  4A3K B;  5J39 A;  2TSS A;  2IHE A;  3QO2 A;  3F8T A;  1L1O A;  1TS4 A;  2F0P A;  3L7Z C;  5EPK A;  4H44 C;  2N3S A;  4HED A;  2MHV A;  3QG1 A;  1TS2 A;  4R9W A;  1X54 A;  1K9M C;  1CSQ A;  4B08 A;  2JA5 G;  2WAQ B;  1LTI D;  4H13 C;  1HNZ L;  4DFA A;  4JI6 Q;  2FFK B;  1X56 A;  1Q3L A;  1XMO Q;  1GJX A;  1H95 A;  2EY2 A;  1XPU A;  1O7Y A;  1LT3 D;  3JAM E;  2Q2U A;  4DV5 Q;  5K36 G;  1ESF A;  2R92 H;  3M3Y B;  3S17 B;  1PA6 A;  3D6C A;  1VQB A;  5JJL A;  2NN6 H;  1KAA A;  3HOU G;  4R1J A;  1G51 A;  1YNJ C;  5C4X H;  1HZ9 A;  3PUW A;  1E2V A;  1UAP A;  1T5X D;  4HSV A;  4YWL A;  2HIV A;  3BU2 A;  3A5U A;  3FKI H;  1Y8N B;  1STA A;  2D0P A;  2KHI A;  1D1K A;  1ET6 A;  1FGB D;  1MSG A;  2MO0 A;  4BBR B;  5IGE A;  3I4N B;  2NBF A;  5C4Z A;  4M8A A;  1KC8 C;  2NVX H;  5AJ3 L;  2IJ0 A;  2DY7 A;  1D5M C;  1UE6 A;  1A0I A;  2B2T C;  4KHV A;  5E3F A;  1TWG H;  3SK4 A;  3TBI B;  1STG A;  5CV6 A;  3BDL A;  4XT1 B;  1OO9 B;  2NWG A;  3EQL C;  3M85 A;  3GTK B;  1KLG D;  4DAP A;  1Y8O B;  1JR0 D;  3I3C A;  5GRO A;  4IUV A;  2XRQ D;  3DXJ C;  1V8Q A;  1I3Q H;  1AN8 A;  2F03 A;  2EY1 A;  4DUY L;  2X69 A;  2B2V C;  4B3T L;  5FLX E;  2WP8 J;  5I9O A;  3W2D A;  2BE5 D;  2SDF A;  2B2U C;  3ERO A;  2HCI A;  4C3I B;  1VS0 A;  3Q24 A;  3BYT B;  3QR8 A;  1CZG A;  4IFD G;  4JI1 L;  1SYD A;  1OXV A;  1E1O A;  4LFA L;  3T51 B;  2IT1 A;  2CWA A;  3LNN A;  4RCN A;  4GN5 A;  4C2M B;  4AQY L;  3KUP A;  1QWY A;  5TSS A;  4A3I H;  1ET9 A;  4G4K A;  1HCZ A;  1TY0 A;  1SYC A;  1TT2 A;  1SE4 A;  2H4O A;  1H9K A;  4G57 A;  2DJG C;  1LAB A;  2F52 A;  3MTS A;  1A3U A;  3PUY A;  3S1M H;  1LAC A;  4IPG A;  4EQ5 A;  3J81 i;  1A2U A;  1RHP A;  1PH8 A;  1IBM Q;  4OX9 Q;  4K6D A;  4A3F H;  3LGJ A;  4RGO S;  2VB3 X;  1MSH A;  2I0Q A;  1BBX C;  2L4N A;  1WTP A;  5C3E B;  3BDO A;  1F9Q A;  3OMG A;  1N32 Q;  2HUG A;  3I4M B;  2ZM6 Q;  1WCM B;  4BY7 B;  1Q90 A;  4JI4 Q;  4IUT A;  4DV4 Q;  2SNM A;  3H3V H;  2IW3 A;  2RA4 A;  4Y52 H;  1SSO A;  4N9P A;  4V19 0;  1K83 H;  1PTO D;  3BVM A;  3S1N B;  3J80 i;  3RLN A;  1ILQ A;  1PH6 A;  5EPL A;  2JA9 A;  4HIO A;  1YHB A;  4XTC S;  2UXB Q;  1KNE A;  2B2W C;  2K28 A;  3BDC A;  4PMB A;  3S15 H;  2JSO A;  2HQE A;  4XYQ A;  1BVS A;  2XGT A;  2JEB I;  2YTV A;  1I6H H;  1L0W A;  1A2T A;  4F88 A;  1F2Z A;  2L9H A;  3OW7 A;  1A63 A;  2F4V L;  3CRL C;  4Y7N B;  3ITP A;  3VR5 A;  5BR8 Q;  1HQR D;  4A3D H;  1GUN A;  2Q2I A;  1EZ6 A;  1IZ6 A;  1R9T H;  2VUM B;  2WII B;  1Y1V G;  2D9U A;  3CCR A;  1EEI D;  1B9N A;  4EVO A;  4IFD J;  1SND A;  4JBW A;  3JAM i;  3NTH A;  1J5E L;  3HOW H;  5CV7 A;  3S16 B;  2OTJ A;  1S5F D;  2Z1C A;  2D2C C;  4GKJ L;  2N55 A;  4OXP A;  3PF5 A;  1D1I A;  1UUP A;  2F0F A;  3NUC A;  4JV5 L;  3A7L A;  4QB4 A;  4ZK9 B;  4DV1 Q;  2K5H A;  1TVX A;  1ZXT A;  4BXX H;  4KD3 A;  3GD7 A;  2EYM A;  1YHA A;  3CCV A;  1EU4 A;  2ATW A;  1A15 A;  4MHE A;  4UP7 A;  2PZU A;  4GNX B;  2FHT A;  1C48 A;  1A8V A;  1TWF H;  3C46 A;  1XWE A;  3BVG A;  4C3H H;  1JB3 A;  4F8M A;  1XTD A;  3J7A F;  4A3B G;  3AQQ A;  3K5M A;  3NQT A;  2XSC A;  3MXP A;  3PO3 H;  1CFM A;  4X62 Q;  3SK5 A;  1QUQ A;  1SE2 A;  4FF1 A;  1VQI A;  5LMU L;  2AKW B;  2A69 C;  3TZD A;  1EQT A;  4I7A A;  1SNM A;  1KTK A;  2G5D A;  1C7Y A;  1IW7 D;  4YWK A;  1PYW D;  3GTL H;  3R93 A;  3HOX B;  3PUV A;  4QIW B;  2XWJ B;  4A3E B;  1N33 Q;  1JQY D;  1FNW A;  2KHJ A;  5C3X A;  2F0J A;  4BS9 A;  4BWG B;  1X9N A;  2I07 B;  4JI2 L;  2LFN A;  3J81 c;  4DAY B;  3H91 A;  1I94 L;  1ILP A;  4P75 A;  1NE3 A;  1T9H A;  2Q2T A;  5KEE A;  1Q1E A;  3NE5 B;  1EWC A;  4J15 A;  1JWS D;  1EQQ A;  1U4R A;  3HOV G;  5C44 G;  3SHL A;  3PO2 H;  4DR6 L;  4QIW E;  3QOJ A;  1HR0 W;  2ASB A;  2NN6 G;  3K7A B;  4DK0 A;  4A3G B;  3MAQ A;  2UUA Q;  3V2T A;  1CA5 A;  4K0K Q;  3TN2 A;  4GZY C;  3W3A A;  1EYA A;  3ND9 A;  4OON A;  4H02 A;  5EAY A;  1NAP A;  1WTX A;  3J80 c;  1B9M A;  2RSO A;  3FKI G;  4DR5 Q;  3TZU A;  3BYY B;  2DNE A;  2ZXO A;  3TP5 A;  3K0Y A;  4WJW A;  2OXP A;  3T13 A;  3VDY A;  3NEL A;  4ZLT F;  3OWF A;  4KHP Q;  4FVM A;  1VQ6 A;  1XMQ Q;  3ERS X;  1LT4 D;  4O2D A;  3CD6 A;  1SMX A;  4A93 G;  2F0N A;  2E2I H;  4HR7 B;  2LXK A;  2PW5 A;  4ZCK A;  1W6K A;  2A6H D;  2RDG A;  3M7G A;  4LF5 L;  1S5E D;  2ZTE A;  3NBI A;  1BCP F;  3GQB A;  5DLQ E;  5LMN W;  2KEC A;  5M3M G;  1LTB D;  3EBE A;  4L5R C;  1Q8I A;  3KK7 A;  5M5X B;  3CHB D;  2Z8L A;  1CKN B;  5KNB A;  2F0O A;  3KF6 A;  5EBD A;  4WFN 3;  3G71 A;  3H0G B;  2HD3 A;  5LL6 X;  1KAW A;  2RKS A;  1G6P A;  3DEO A;  5ELD A;  2QDL A;  1PXU A;  4X65 Q;  1YNN D;  3OTO Q;  1J6Q A;  1Z7T A;  4JVZ A;  4IPC A;  4GOP A;  1XNR L;  1VDZ A;  4XT3 B;  2L15 A;  1PRT C;  1NSN S;  4QJF A;  2NTT A;  4O1N A;  4LF6 L;  4A3I G;  3TRZ A;  4HIK A;  1JMC A;  2K32 A;  3HOY G;  3M7N A;  1SJE D;  1BNZ A;  2KCN A;  3MXG A;  2R92 B;  2YU9 H;  4C56 C;  2K75 A;  2PQE A;  2QDB A;  4DK3 C;  3CW2 C;  1MJC A;  1KD1 C;  3CME A;  4IQZ A;  2UU9 L;  3FMC A;  2R7Z G;  3LWU A;  1N36 L;  3LX0 A;  2QIL A;  3PUX A;  3W1G A;  5C4X B;  4DV0 L;  4CGY B;  1PH3 A;  4AYB B;  1A3T A;  2ENB A;  2N88 A;  4R8I A;  1H9J A;  3TRE A;  1ONL A;  3CU7 A;  2K50 A;  3KF6 B;  1U4M A;  3OOC A;  4WJ4 A;  3CC2 A;  4NXM L;  1XPR A;  5EGT A;  4A3J G;  4FF3 A;  2RDH A;  2KUM A;  4OWW B;  2CWP A;  1Q46 A;  1V1O A;  1FJG Q;  4DGZ A;  1LT6 D;  1R4Q B;  1EFI D;  3KLR A;  4AYB E; 
#chains in the Genus database with same CATH homology
 1TWG B;  1M8A A;  5E4W C;  1Q1B A;  1ENC A;  3KF8 A;  4BY1 B;  5IGB A;  3PIO 3;  1I3Q B;  2IWH A;  2I46 A;  4EGV A;  5C0X G;  1I50 B;  1WD1 A;  4K5X A;  4XXE A;  4V0B A;  4KKU A;  3DUZ A;  3SXH A;  1I4G A;  1OXU A;  3TDQ A;  1CZW A;  1TQO A;  3IL8 A;  5CV9 A;  4JK1 C;  2BCO A;  1STB A;  1E2Z A;  2IX1 A;  2B8G A;  4IAL A;  3VR2 A;  2HCC A;  2MPM A;  2EY6 A;  1EWH A;  4FO2 A;  3GV3 A;  4CKC A;  3S1M B;  3MEH A;  5IT9 E;  4EQN A;  4OGQ C;  5JOB A;  4A3F B;  2LS0 1;  5CV8 A;  4C3H G;  1WVL A;  3NWT A;  4CJ1 B;  3E6Z X;  1SNQ A;  2DY8 A;  5T1I A;  4IUP A;  5CV5 A;  1HTP A;  1FNU A;  2MP1 A;  3HZX A;  3NSW A;  5FKA C;  1I4R A;  4BA2 I;  2HDL A;  3TME A;  1AFP A;  1D6E C;  1EY6 A;  3I91 A;  1QOH A;  5D65 A;  3DWA A;  2K5W A;  2F0V A;  3A7A B;  2F0M A;  1BF4 A;  3SE0 A;  3S15 B;  3HG9 A;  1I6H B;  3R2I A;  5C0X J;  3SEB A;  2EZV A;  1T5E A;  2KCC A;  4ZYS A;  4A3D B;  2F0E A;  1G29 1;  1HFG A;  3K5L A;  4NW2 A;  1U4P A;  4K6L A;  2E2D C;  4XDX A;  1RDP D;  3E0J A;  3HOW B;  2R61 A;  3HEJ A;  5C4H A;  3GO5 A;  5JPM C;  1CHP D;  3ERQ A;  3C2P A;  2NB0 A;  4DU9 A;  1I4P A;  1QIL A;  1EZ8 A;  1EY0 A;  4G7O C;  4TQU S;  4FNF A;  3V96 A;  2AQ3 B;  3J81 L;  2D5D A;  2ZT9 C;  5JAV A;  2JYO A;  3FPP A;  4CKB A;  2EYJ A;  4NKL A;  5CYU A;  2B2T A;  4HTH A;  5DEH A;  2K5D A;  4KMU C;  4G7Z C;  3VA7 A;  3D4W A;  4IZ8 A;  3NTI A;  3L3O C;  3G7L A;  1FNV A;  3J80 L;  2EJM A;  4C3I G;  1JWM D;  5C3W A;  3A54 A;  2WAC A;  4Q0F A;  2PCF B;  3T56 B;  4PMW A;  1TU2 B;  3Q6S A;  4FF4 A;  1BO0 A;  5NUC A;  3GTL B;  3TP7 A;  1G6Z A;  4H7B A;  1PTO F;  3S1R B;  3OMC A;  2O5J C;  1YNN C;  5EKK A;  3EVQ A;  2QEJ C;  2BDN A;  3MFY A;  4LJZ C;  3VYS A;  2B8F A;  2E75 C;  4FXG C;  3SK6 A;  3PO2 B;  5CBE E;  1SFO B;  4ID6 A;  3VR6 A;  5M9O A;  3BZD B;  3VYR A;  2FMM A;  2VNU D;  3AMU A;  1CTM A;  2Q8I B;  1D2B A;  2F0W A;  3I73 A;  4KKT A;  4X3S A;  2NVQ B;  5A35 A;  4OIJ A;  4P2C B;  2CVR A;  1LTG D;  4HSP A;  2B2W A;  1VMP A;  1JOO A;  2E2I B;  2FMC A;  2B2Y C;  4FYD A;  4XQQ A;  4N9T A;  1AZQ A;  5JEA H;  4ABN A;  3GTG B;  3IFD A;  4ODG A;  1EYD A;  3GV6 A;  1IYU A;  4TKO B;  3H09 A;  3Q0A A;  2L11 A;  4EQP A;  4ZUJ A;  1F2M A;  4ZRZ A;  1QNU A;  2A68 C;  5FK9 C;  4K2L A;  1F2Y A;  2ICI A;  1H9M A;  2F3V A;  3GTP B;  1KNA A;  5IGC A;  2XWB B;  5E1F A;  1BDO A;  2L5T A;  1A6X A;  2IL8 A;  4MIU A;  1SE3 A;  5C5L A;  2RDF A;  2Q8R E;  1CHQ D;  3MZ5 A;  1CQF A;  3K57 A;  3J7A V;  1BCP C;  1MGS A;  1F2L A;  2YU9 B;  4MN3 A;  2JXM B;  5ISR A;  2Q8T A;  1S5C D;  3TP8 A;  2OF1 A;  1SMY C;  5C5M A;  4CBV A;  3KLS A;  1NR4 A;  2EXZ A;  1AEX A;  3D4R A;  5KRU A;  5FO8 B;  2IX3 A;  2CHB D;  1DOM A;  5J1Z A;  1XXG A;  1B4O A;  2A6E C;  2JP1 A;  2RVL A;  1LTR D;  4H0L C;  2SNS A;  4E6I A;  2JA8 B;  4KHZ A;  4HMI A;  2KA7 A;  2G9H D;  1CK1 A;  2QKI C;  5J22 A;  1IKM A;  3BVZ A;  3MFG A;  1CM9 A;  2M2L A;  4K5V A;  1KDA A;  1RF2 D;  1ML0 D;  3K5O A;  3K6O A;  1HA5 A;  2PZT A;  3FEW X;  3VA5 A;  1EEF D;  4R8N A;  3K5N A;  3K58 A;  1TY2 A;  3OPO A;  2L55 A;  3MVV A;  1SEB D;  4FXD A;  4DAY A;  1LTA D;  1QE6 A;  3Q22 A;  4KJO A;  3NHH A;  3D8G A;  1GUS A;  1HHV A;  5KNC A;  1LV9 A;  4ULL A;  3QB3 A;  1ENA A;  2E2J B;  3DEP A;  3S14 B;  2Z4H A;  4RKL A;  5COY A;  5M3F B;  1L0Y B;  1F9P A;  5CBA E;  1MI2 A;  2EJG C;  2LKV A;  4BBS B;  2XNA C;  3NTK A;  1II3 A;  5K5P A;  1SJH D;  1TWA B;  4KD4 A;  2NYZ D;  3FDT A;  1M4V A;  2BA1 A;  3MHB A;  1WTW A;  4RGT A;  4HCE A;  5JJZ A;  4IN3 A;  1H9R A;  5G3L D;  3GTO B;  2F0I A;  1G91 A;  1J9O A;  1IYV A;  3TP6 A;  1QG7 A;  5AFW A;  5M5W B;  5LL6 S;  2NVT B;  2Y0S B;  5C4J B;  4DF7 A;  1IKL A;  4TRD A;  3I70 A;  3WOE A;  2LMC B;  3ZYY X;  1SXT A;  4IUN A;  1X3P A;  3PMF A;  3R2T A;  1J8I A;  3DHQ A;  4KN7 C;  1QJO A;  1Y1W B;  4ZUI A;  5ELC A;  1F77 A;  5F2D A;  2IX0 A;  2J0T D;  1W6J A;  1LTT D;  4KV6 A;  2JEA I;  1HPC A;  1PRT B;  1JOQ A;  2M9V A;  1GXD C;  4O42 A;  4DNR B;  1IHZ A;  2F0T A;  1MBY A;  3EJI A;  5A2Q E;  3DMU A;  4RHS A;  1RCV D;  3OIQ A;  4RGM A;  5JEA G;  1DZ1 A;  2EJF C;  2RSN A;  1DCZ A;  5I6W A;  2BE5 C;  3CQZ B;  2YYZ A;  1X32 A;  3GTQ B;  2KEE A;  1TR5 A;  2WKD A;  2MJ8 A;  4RAU C;  4C1N I;  5KGU A;  4F87 A;  5K36 H;  1VMC A;  3I8Z A;  1K8M A;  1WTV A;  4CKE A;  2WKC A;  2K01 A;  3S1Q B;  1OXS C;  2F4I A;  5CV4 A;  5JPN C;  1YNJ D;  3KBX A;  1B44 D;  5EQ0 A;  2NN6 I;  4IUR A;  2F0D A;  2X6L A;  2VXW A;  1R4P B;  3U9S A;  2CQA A;  2JA7 B;  3HGB A;  1WTO A;  1PTO C;  3RMH A;  5E4X A;  5COR A;  2RQX A;  1EIH A;  1MD2 D;  1E2W A;  2R93 B;  5BN5 A;  2F0U A;  1SYE A;  3QWN A;  5T1G A;  2HDM A;  2JE6 I;  3P75 A;  3SR1 A;  1GHK A;  3VYU A;  3QIA A;  3GTM B;  3EFX D;  1PLF A;  1SYB A;  4TSS A;  2O5I C;  2IPK D;  1TS5 A;  4RHR A;  1XX8 A;  4HMJ A;  2V4D A;  4YIJ A;  2NTS A;  1GHJ A;  3OWE B;  3NPP A;  3HOZ B;  2ZXP A;  1STH A;  3P20 A;  1EIG A;  1GUW A;  3WDN A;  2PO4 A;  4L8J A;  1GUO A;  2OEO A;  2F0L A;  1B3A A;  1DYQ A;  3KBG A;  3NXW A;  2Z4I A;  1LT5 D;  1TWH B;  5HUR A;  1KDB A;  3M4Y A;  2K5Q A;  3D6W A;  1AZP A;  5BN4 A;  1CQV A;  1PFN A;  3J7Y W;  4FP5 D;  2KQ3 A;  3ND8 A;  2VB2 X;  5CC4 A;  1RTN A;  1HRJ A;  1HXY D;  1IW7 C;  4OL7 A;  2BDO A;  5ELF A;  2NVY B;  4KTA A;  3HKZ B;  4J6H A;  3IAY A;  3RUZ A;  5I6Y A;  3MA2 B;  3A55 A;  4DN4 M;  5C0X I;  2NUC A;  4J8Q A;  3BG3 A;  4KY7 A;  3H3V C;  3PIP 3;  4XQJ A;  1SDF A;  3A8I E;  4G7H C;  2B63 B;  2BOS A;  1WTQ A;  1BXT A;  2AWO A;  1Y69 U;  1CT1 D;  1IL8 A;  1S4Z A;  4RFB A;  1O80 A;  1TKW B;  1JOK A;  4CHT B;  2L12 A;  4KN4 C;  1E0B A;  5EBC A;  4C3J B;  4HCS A;  2A6H C;  3PUZ A;  2B2Y A;  2H1E A;  3BS1 A;  2B2V A;  2PPB C;  1PMR A;  4DA2 A;  1ESR A;  2B2U A;  5I9P A;  4OO1 I;  2A69 D;  1DJR D;  1XTC D;  1BR9 A;  1DM0 B;  4S3S A;  2EE1 A;  3EA6 A;  1EOT A;  3JAM L;  4RWS C;  1PTO H;  2DNC A;  5D3D A;  1O7L A;  1ZYR D;  4FXK C;  1PZJ D;  3MXN A;  1STN A;  1ROD A;  5LHY 1;  1SNP A;  4PQX A;  2DN8 A;  1Z47 A;  1FYC A;  1GOZ A;  4RGN A;  4B9X A;  4X3U A;  4L6T B;  1KAB A;  1CA6 A;  4XYO A;  1V1P A;  3N6R A;  2KOL A;  1AW7 A;  1RKN A;  3KLS X;  3AU7 A;  2L0C A;  1F9S A;  3T53 B;  3IKJ A;  2CW0 D;  4PNY A;  2C5C A;  3R3O A;  1PZK D;  1U9R A;  1U4L A;  3S2D B;  1Q12 A;  5IOC A;  1X3Q A;  1I4H A;  3FPU B;  1TS3 A;  3D4D A;  4RKB A;  3X3M A;  3X3N A;  2ID0 A;  2WB1 B;  3CRK C;  4XQN A;  3I72 A;  5D3I B;  3QOL A;  1EY8 A;  5FLX L;  1FR3 A;  1BCP B;  2B39 A;  4QF4 A;  3H94 A;  1V1P B;  3UI2 A;  3D31 A;  4A3M B;  1NCV A;  2XVS A;  2X6G A;  2E76 C;  1DOL A;  3HS0 C;  3V05 A;  2RBM A;  4NMZ A;  4OHJ A;  1PRT D;  2JA5 B;  3HRZ C;  5M5Y B;  5JVH 3;  3C1E A;  3M4O B;  1B1Z A;  1ZEQ X;  1C4Q A;  3CKI B;  2KJX A;  1UNS A;  3S2H B;  1EY9 A;  5ELE A;  1JC7 A;  2KHS A;  1WTR A;  3HOU B;  4RCO A;  5G3L F;  4OIK A;  4M1U B;  4K8I A;  2K05 A;  4HAE A;  5ELB A;  2F0S A;  2SEB D;  1DON A;  2OT2 A;  4ZQ3 A;  1HUM A;  1QNK A;  2KED A;  4K8J A;  3RLF A;  3H6M A;  3AB9 A;  5BN3 A;  4K2K A;  4HN7 A;  1G2S A;  5KYL A;  2K6A A;  4LK1 C;  2WIN B;  2EYF A;  3VR3 A;  1EU3 A;  2PW7 A;  3QJY A;  2QCP X;  2F3W A;  4F7X A;  3C1F A;  5C0X H;  4X3T A;  4X3K A;  4IFD I;  5DNF A;  1VF7 A;  4BA1 I;  3SDZ A;  1DD2 A;  2F0H A;  5IIF A;  4DXG A;  1BOS A;  3NK9 A;  4DK1 A;  5IGF A;  3C3L A;  4J1M A;  5I4D A;  1NR2 A;  5EKL A;  4C1N K;  1OXX K;  4ZKC B;  1DOK A;  5EJW A;  4QCL A;  1SYF A;  1TII D;  1EY7 A;  1JWU D;  2M00 A;  3RZD B;  4XIG S;  4ILW A;  4WOR A;  4OO1 H;  5I2Y A;  2FJ2 A;  4QMG A;  1L0X B;  3ONA B;  3GP7 A;  1JE4 A;  1SNC A;  1STE A;  2WV6 D;  3WOF A;  4K14 A;  2PYK A;  5IGD A;  2K03 A;  1PFM A;  2MUY A;  1ICW A;  4Z9C B;  1I4Q A;  1EL0 A;  2XIW A;  3R8B A;  1H9S A;  3DM1 A;  1BUV T;  1SBB B;  1Y1V B;  1G2T A;  3OIP A;  3DWQ A;  3A8J E;  1ZYR C;  2XN9 C;  2A73 B;  3T16 A;  3A8K E;  3L9A X;  1I6V C;  3LWE A;  4KY5 A;  2EYP A;  1DXM A;  4EQO A;  1A3V A;  1S5B D;  3GTJ B;  3D3R A;  3I90 A;  1EQV A;  1B50 A;  2J4X A;  5FOB B;  2A74 C;  5EKI A;  2PZW A;  2LY7 A;  4K5W A;  1VCI A;  3O13 A;  1B2T A;  2AUK A;  2F0G A;  1S5D D;  5CMD A;  2CW0 C;  2EVB A;  1GUG A;  3NBH A;  5CR3 A;  4NDX A;  1H9S B;  1QB5 D;  5KND A;  4QUF A;  4I65 A;  1HQM C;  2J7Z A;  4KKS A;  5A2Q L;  4A3B B;  2C9O A;  1TWC B;  2K04 A;  4I7Z C;  4KK7 A;  1KDC A;  1HA6 A;  1FD7 D;  4ME5 A;  4PMC A;  1JCK B;  3OSO A;  1EYC A;  5KIX A;  1V43 A;  1HTL D;  1O7Z A;  4IUQ A;  5DM6 3;  2SOB A;  2AQ1 B;  1LO5 D;  1PTO B;  1ZKO A;  4ZKB B;  3NWS A;  4ZAI A;  1D5X C;  1SYG A;  1UEA B;  5EPJ A;  4DAV A;  4RA8 A;  4KI0 A;  3RZO B;  3P7J A;  2PMZ B;  3E5S A;  1D5Z C;  4CJ0 B;  3HOV B;  5C44 B;  2AQ2 B;  4LAA A;  2R6G A;  4QUC A;  2AWN A;  3URY A;  4KJN A;  3FKI B;  2MGS A;  5JEA J;  1CI3 M;  5JVG 3;  5CGK A;  4NP5 A;  2NVX B;  1O78 A;  2D62 A;  4KY6 A;  4A93 B;  2FIN B;  4UAI A;  3FRP B;  1LLR D;  4CJ2 C;  1PFB A;  2QF7 A;  1WD0 A;  1OXT A;  2G9D A;  5M3M B;  2E74 C;  2E2H B;  1PDQ A;  4IFD H;  2PNR C;  4L63 B;  3MWY W;  2O2L D;  2A68 D;  5DAU A;  2EPB A;  1NUC A;  1B53 A;  2XRS D;  4FF2 A;  2EOT A;  3NQI A;  3I4L A;  4LMQ D;  3HP3 A;  3U9O A;  1F9R A;  5FO7 B;  2R3Z A;  4IUU A;  5IT9 L;  4A3I B;  4DXF A;  4Q5V A;  1EY4 A;  4B9W A;  3HOY B;  3F2U A;  1BCP D;  5IGG A;  1GUT A;  2F0Q A;  3P1H A;  4C3J G;  3K59 A;  4WRD A;  3DWP A;  2TMP A;  2NZ1 D;  1QCB D;  3VR4 A;  3A56 A;  2R7Z B;  2AUJ D;  1JIC A;  1JOR A;  1SMY D;  5FO9 B;  3G6J B;  3OHX C;  1HFN A;  2F0K A;  1RTO A;  1RD9 D;  4OO1 G;  2GA4 B;  2EDG A;  3TSS A;  3N52 A;  4A3J B;  2ICE C;  1K83 B;  2A6E D;  4RH6 A;  4PV1 C;  5HGT A;  4U67 3;  1G8Z D;  3VYT A;  1KLU D;  2K33 A;  1K8O A;  3S9W A;  3MC0 B;  5C6A A;  2EY5 A;  2JA6 B;  2A5H A;  2EYH A;  2EYL A;  3IFT A;  1BQQ T;  3PV0 A;  5D14 A;  2O4X A;  1PZI D;  5KYI A;  2K1B A;  1C8C A;  1R9T B;  1ENF A;  3RD4 A;  1SAP A;  3Q23 A;  2EYO A;  3T4A C;  4DNT B;  1AP0 A;  2KVM A;  3FVQ A;  5I2X A;  1STY A;  1XYI A;  1RJT A;  5IOD A;  3J81 E;  5DM7 3;  2F1M A;  1PRT F;  2L1B A;  1Z6H A;  3NP8 A;  1EY5 A;  4UDU C;  3MXU A;  2BA0 A;  1TWF B;  1HUN A;  4C3H B;  1I4X A;  4U68 A;  1VF5 C;  1SNO A;  3J80 E;  1LTS D;  1Y8P B;  2ZXR A;  3PO3 B;  2K7V A;  3SK8 A;  3SVM A;  4A3K B;  5J39 A;  2TSS A;  3QO2 A;  5EPK A;  1TS4 A;  2F0P A;  3L7Z C;  4H44 C;  4HED A;  2MHV A;  3QG1 A;  1TS2 A;  4R9W A;  4B08 A;  2WAQ B;  1LTI D;  4H13 C;  4DFA A;  2FFK B;  1Q3L A;  1GJX A;  2EY2 A;  1O7Y A;  1LT3 D;  3JAM E;  5K36 G;  1ESF A;  3M3Y B;  3S17 B;  3D6C A;  2NN6 H;  1KAA A;  1YNJ C;  3PUW A;  1E2V A;  1UAP A;  1T5X D;  4HSV A;  1Y8N B;  1STA A;  1D1K A;  1ET6 A;  1FGB D;  1MSG A;  4BBR B;  5IGE A;  3I4N B;  2NBF A;  5C4Z A;  4M8A A;  2IJ0 A;  2DY7 A;  1D5M C;  2B2T C;  4KHV A;  5E3F A;  3SK4 A;  3TBI B;  1STG A;  5CV6 A;  3BDL A;  4XT1 B;  1OO9 B;  2NWG A;  3EQL C;  3M85 A;  3GTK B;  1KLG D;  4DAP A;  1Y8O B;  1JR0 D;  3I3C A;  4IUV A;  2XRQ D;  3DXJ C;  1V8Q A;  1AN8 A;  2F03 A;  2EY1 A;  2X69 A;  2B2V C;  5FLX E;  2WP8 J;  5I9O A;  3W2D A;  2BE5 D;  2SDF A;  2B2U C;  3ERO A;  2HCI A;  4C3I B;  3Q24 A;  3BYT B;  1CZG A;  4IFD G;  1SYD A;  1OXV A;  3T51 B;  2IT1 A;  3LNN A;  4RCN A;  4C2M B;  3KUP A;  1QWY A;  5TSS A;  1ET9 A;  4G4K A;  1HCZ A;  1TY0 A;  1SYC A;  1TT2 A;  1SE4 A;  2H4O A;  1H9K A;  4G57 A;  1LAB A;  3MTS A;  1A3U A;  3PUY A;  1LAC A;  1A2U A;  1RHP A;  4K6D A;  4RGO S;  2VB3 X;  1MSH A;  1BBX C;  2L4N A;  1WTP A;  5C3E B;  3BDO A;  1F9Q A;  3OMG A;  2HUG A;  3I4M B;  1WCM B;  4BY7 B;  1Q90 A;  4IUT A;  2SNM A;  2IW3 A;  2RA4 A;  1SSO A;  4N9P A;  4V19 0;  1PTO D;  3BVM A;  3S1N B;  1ILQ A;  5EPL A;  4XTC S;  1KNE A;  2B2W C;  2K28 A;  3BDC A;  4PMB A;  2JSO A;  2HQE A;  4XYQ A;  2JEB I;  4F88 A;  1A2T A;  1F2Z A;  2L9H A;  3OW7 A;  3CRL C;  4Y7N B;  3ITP A;  3VR5 A;  1HQR D;  1GUN A;  1EZ6 A;  2VUM B;  2WII B;  2D9U A;  1EEI D;  1B9N A;  4EVO A;  4IFD J;  1SND A;  4JBW A;  3NTH A;  5CV7 A;  3S16 B;  1S5F D;  2Z1C A;  2D2C C;  2N55 A;  1D1I A;  1UUP A;  2F0F A;  3NUC A;  3A7L A;  4QB4 A;  4ZK9 B;  1TVX A;  1ZXT A;  4KD3 A;  3GD7 A;  2EYM A;  1EU4 A;  1A15 A;  4MHE A;  2PZU A;  2FHT A;  1C48 A;  3C46 A;  1XWE A;  3BVG A;  1JB3 A;  4F8M A;  3J7A F;  3K5M A;  3NQT A;  2XSC A;  3MXP A;  1CFM A;  3SK5 A;  1SE2 A;  4FF1 A;  2A69 C;  3TZD A;  1EQT A;  1SNM A;  1KTK A;  1IW7 D;  1PYW D;  3R93 A;  3HOX B;  3PUV A;  4QIW B;  2XWJ B;  4A3E B;  1JQY D;  1FNW A;  5C3X A;  2F0J A;  4BS9 A;  4BWG B;  2I07 B;  2LFN A;  3H91 A;  1ILP A;  5KEE A;  1Q1E A;  3NE5 B;  1EWC A;  1JWS D;  1U4R A;  3SHL A;  3QOJ A;  2NN6 G;  3K7A B;  4DK0 A;  4A3G B;  3MAQ A;  3V2T A;  1CA5 A;  3TN2 A;  4GZY C;  3W3A A;  1EYA A;  3ND9 A;  1NAP A;  1WTX A;  1B9M A;  2RSO A;  3TZU A;  3BYY B;  2DNE A;  2ZXO A;  3TP5 A;  3K0Y A;  4WJW A;  2OXP A;  3T13 A;  4ZLT F;  3OWF A;  4FVM A;  1LT4 D;  2F0N A;  4HR7 B;  2PW5 A;  1W6K A;  2A6H D;  2RDG A;  3M7G A;  1S5E D;  3NBI A;  1BCP F;  3GQB A;  2KEC A;  1LTB D;  1Q8I A;  3KK7 A;  5M5X B;  3CHB D;  2Z8L A;  5KNB A;  2F0O A;  5EBD A;  4WFN 3;  3H0G B;  5LL6 X;  2RKS A;  3DEO A;  5ELD A;  1PXU A;  1YNN D;  1Z7T A;  1VDZ A;  4XT3 B;  1PRT C;  1NSN S;  2NTT A;  4O1N A;  2K32 A;  3M7N A;  1SJE D;  1BNZ A;  2KCN A;  3MXG A;  2R92 B;  4C56 C;  2PQE A;  2QDB A;  4IQZ A;  3FMC A;  3LWU A;  3LX0 A;  2QIL A;  3PUX A;  5C4X B;  4CGY B;  4AYB B;  1A3T A;  2ENB A;  2N88 A;  4R8I A;  1H9J A;  1ONL A;  3CU7 A;  1U4M A;  3OOC A;  5EGT A;  4FF3 A;  2RDH A;  2KUM A;  1V1O A;  4DGZ A;  1LT6 D;  1R4Q B;  1EFI D;  3KLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...