3SK5A

Crystal structure of staphylococcal nuclease variant delta+phs v39d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLDDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V39D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sk5A00
3R3OA 1EZ8A 1KDAA 4KTAA 2F0VA 2F0DA 2SNMA 5IIFA 1IHZA 3OSOA 1SYFA 2F0IA 5IGBA 1NSNS 4K5WA 2LKVA 1II3A 4S3SA 5C3XA 3T16A 5J22A 5ISRA 3VA5A 2EY1A 2F0PA 2F0GA 3HEJA 1SNPA 5CC4A 3P75A 1A2TA 3OMCA 4ODGA 5KGUA 1EY5A 4NKLA 2PW5A 3MEHA 4ME5A 4PNYA 3SK6A 2ENBA 2EY6A 2F0QA 4F7XA 5I6YA 4IUNA 2NUCA 3ERQA 5IGFA 4J6HA 1A3TA 3QOLA 4R8NA 2F3WA 5J39A 1EY4A 4ZQ3A 1EY7A 4ZUIA 1EYDA 3RUZA 4KY6A 3DHQA 3SHLA 3MXPA 3TP5A 4DFAA 1ENAA 5CV8A 4PMCA 4EQPA 5CGKA 4IALA 2F0OA 5K5PA 1SNQA 4IZ8A 3SK4A 3U9OA 4B9XA 4TRDA 5I6WA 1KDBA 5CV6A 3EROA 4KHVA 5IGDA 4DGZA 1SYCA 4KD4A 4KY5A 5E3FA 5CR3A 3S9WA 5JAVA 4K14A 4KV6A 1SNDA 2PZUA 1RKNA 2EYFA 2KHSA 5C4HA 1JORA 3C1FA 4KJOA 2EYOA 3QB3A 5IGEA 4RKLA 4N9TA 5EGTA 4ID6A 3SXHA 3E5SA 2F0FA 1EZ6A 2F0HA 2KQ3A 2RDFA 4K2KA 5E1FA 5IGCA 4N9PA 2F0WA 2PW7A 2QDBA 5KYLA 3D8GA 2SOBA 2F0TA 1EQVA 2OXPA 3NUCA 5IOCA 2F0MA 4OL7A 2OF1A 4ZUJA 3EVQA 5EKLA 4K8JA 4EVOA 5DAUA 1SYBA 5KIXA 2F0EA 3HZXA 4HMIA 1STHA 3SR1A 5DEHA 5NUCA 3OMGA 3NP8A 3MVVA 4K6DA 3T13A 1KDCA 1JOQA 3EJIA 2EYPA 1STAA 1STBA 2RKSA 5IGGA 4NP5A 3SK5A 4KY7A 2EYMA 1NUCA 1KAAA 1SNMA 4H7BA 4PMBA 1KABA 3NQTA 4WRDA 5CV7A 3TP6A 3D6CA 5C4ZA 5EKKA 1EY9A 1SYGA 4MIUA 3QOJA 5HURA 2RBMA 2EXZA 2PQEA 3BDCA 2F0KA 4KJNA 3NXWA 4F8MA 1EYCA 5C6AA 4G57A 4LAAA 2EY5A 2PYKA 1A3UA 4K2LA 4KD3A 2F0NA 2F3VA 5KYIA 4DF7A 1EY0A 5F2DA 4QMGA 3H6MA 5I9OA 1F2ZA 4HTHA 2HQEA 4B9WA 2M00A 5CV9A 4EQNA 4E6IA 3D4WA 2O4XA 4RKBA 3ITPA 3TMEA 5C3WA 1ENCA 5HGTA 2F0UA 3OWFA 3MZ5A 2EYJA 2OEOA 3PMFA 1U9RA 1EY6A 3V2TA 5M9OA 1SNCA 4NDXA 1AEXA 4DU9A 4K8IA 4K5XA 5JOBA 5J1ZA 4EQOA 1STNA 4I65A 1SNOA 4NMZA 3TP7A 5KRUA 3NHHA 3BDLA 1JOOA 3NK9A 1STYA 1F2MA 4J1MA 2SNSA 3TP8A 1A3VA 3LX0A 4QF4A 1A2UA 5CV4A 5KEEA 4HMJA 3C1EA 1EY8A 2EY2A 1TQOA 2EYLA 3DMUA 3P1HA 4WORA 4YIJA 1F2YA 1JOKA 2F0LA 2WACA 5CV5A 3SK8A 3D4DA 1TR5A 1EYAA 1SYEA 1STGA 1SYDA 1TT2A 2PZTA 2EYHA 4K5VA 5C5MA 5I9PA 5IODA 3MHBA 5C5LA 2F0JA 2PZWA 2F0SA 4QB4A
chains in the Genus database with same CATH superfamily
1PDQA 1XPRA 3UE1A 5LL6X 4UP7A 4A3EH 3CHBD 1T5EA 1RHPA 1TIID 3M4PA 2IHFA 4XT3B 1SYFA 3J7AF 3RLOA 3I55A 3S1MH 1BVSA 1OXXK 5G3LD 5T1IA 1Q12A 4X64Q 2IW3A 1E3PA 5LL6S 3GTMB 5A2QE 3K6OA 3KBXA 1M8AA 1TY2A 2A6HC 2ICEC 2D0OA 5J39A 3EN2A 1BF4A 4ZUIA 4KY6A 4NXNQ 4DK6C 3VYUA 1X3FA 1H9SA 2IX0A 3D3RA 4JI7Q 3D6WA 3T53B 1CKOA 4C3JB 2E74C 3FKIG 4KN7C 1WOCA 5EAYA 3TDQA 5IGDA 4JBWA 3P20A 3W1BA 3W2DA 5CR3A 5IP9H 1BO0A 1MKHA 2DNCA 2LY7A 4CDCC 2QEXA 1RKNA 4DNTB 1PH1A 2I0QA 1UUPA 3N52A 4JI0Q 1VCIA 1L2FA 3K7AB 1G51A 2K75A 3TREA 2HD3A 4EX5A 3HOWB 3GTLH 1V1PA 3I90A 3BU2A 2OT2A 5C0XH 2Q8TA 1VQGA 4IOAA 1HHVA 2F0MA 2MHVA 2KCNA 1B8AA 1EEFD 2ASBA 1VQAA 4JBMA 4QUFA 4DV4Q 4RCNA 2VL6A 4R4IA 1KAAA 4UDUC 1KABA 1MI2A 3TP6A 2D62A 2QCPX 4FNFA 1Y1WH 2XRQD 3QOJA 3KOJA 2K5NA 1TWHB 4AQYQ 1SR3A 2WB1B 1NR2A 1NNXA 1OO9B 2PO4A 3BYYB 2R7ZH 5DLQE 3CCRA 3AFPA 3L3OC 4IUPA 5KYIA 4A3CH 4ZYSA 3TN2A 3TZDA 5A2QL 2HQEA 2MQHA 2M00A 4EQNA 1HNXQ 2GVBA 4DAMA 2B2YC 2Q8RE 1HFNA 4HIMA 3SGIA 1WJJA 5ELOA 4RHRA 2K05A 1YHBA 4EQ5A 3CCVA 3TP7A 4HSPA 3H09A 1PZKD 3JAML 1D5XC 1A2UA 3HS0C 5KEEA 3BZCA 5GADC 3KBGA 4DR1L 4LF4L 3QO2A 4JPBW 3S9WA 4LFAL 5C5MA 3A8KE 5TSSA 1YEZA 2O5JC 3UDGA 2F03A 1W2BA 4C3HH 4IUUA 3OHXC 1II3A 1PTOH 1I4HA 4QIWE 4S3SA 4JBJA 3WDNA 1KQSA 5GQOA 3HOVG 3W5OA 2E76C 5HY6A 4J15A 2LSSA 5C3EB 2QA4A 4IUNA 3MA2B 2I46A 2RCNA 1XXGA 2JE6I 4LF6L 2EQSA 1GUTA 2EPBA 1XWEA 4PMCA 1RF2D 5AJ3Q 1EUJA 5K5PA 1G8ZD 3EA6A 2IX3A 2Z9HA 2JA6G 4RGTA 1LABA 3PF5A 3S2HH 4N8X1 1EQRA 2SEBD 3VR4A 2Z6KC 4Y7NB 3EFXD 2NVYH 1FNVA 2KHSA 2MO1A 3BVZA 2ZT9C 2CWPA 1LT6D 3F2DA 4L8JA 4LF5L 2WIIB 1YBYA 4NXML 3HOZG 4ZUJA 4A76A 1J5EQ 1FR3A 3M4YA 1STHA 3GTJH 3OOCA 1G91A 3HOYH 3WOFA 2B2WC 3S1QB 1YIJA 3OPOA 4L5QA 2XWJB 1QOHA 3K58A 2B2TC 4A3KB 1KXLA 4BXXG 3GTOB 4A3FB 4FXGC 3VYRA 1JQYD 1EYCA 1BOSA 2NWGA 2UUBL 2R92H 4B3TL 4JI4L 3I8ZA 4OO1I 2L15A 4YHHL 1T9HA 1U0LA 2X69A 4OIJA 2EVBA 3FDTA 2LXKA 1Q46A 4PQXA 3RMHA 4X3TA 4YY3Q 1HFGA 1I4GA 3FRPB 3GTPH 4DV6Q 4A3EB 3S1NH 1KRSA 4X66L 3NTIA 3S1MB 1CK1A 2MFIA 1CHQD 3CQZH 3DXJC 1AZPA 3P1HA 1EY8A 5FOBB 4JV5L 1D7QA 2ZTCA 3NBIA 1TT2A 3HP3A 3CC7A 3CCUA 1CKNB 3X3MA 4DN4M 2F0SA 1N33Q 2V4DA 3O13A 5C4JB 1E2ZA 2F0DA 2Y0SG 4Z9CB 3T1YQ 2B63B 2PPBC 1GOZA 2LKVA 2NN6G 2CW0C 3T16A 1BBWA 2KUMA 3CCJA 4BBRH 3SK6A 5ELEA 3HKZG 2BH2A 3CCLA 1X56A 1EY7A 1GUWA 1CA6A 4G7HC 3GTLB 1QNUA 3TP5A 2VS1A 4JI1Q 3RN5A 1Y69U 3CP0A 1TU2B 4AYBB 4X65L 1AE3A 1LO5D 4C1NK 5D14A 1E1TA 3OTOQ 4B3SQ 4PG3A 2EYFA 4DV1L 1ILQA 1IL8A 1Y1WB 1KLGD 4GNXA 1XNRQ 2RDFA 5ELCA 1SSOA 2CH4W 3NUCA 4O2DA 1GVPA 1M1KC 3F2CA 2R7ZB 3J7A5 1D2BA 4QQBX 4P74A 1JOQA 1J8IA 3BZKA 3J7AV 1S5FD 1V9PA 5CV7A 3CCMA 5IT9E 1PZID 2BE5C 2Z4HA 4JVZA 1YJWA 2EXZA 3G6EA 4XQJA 2VQFL 1F2LA 1HTPA 3OW2A 3M85A 4XQQA 4BA1I 4DR2L 2A6EC 1K8MA 3X3NA 3FKIH 3ND8A 3CXCA 3M4OH 1FL0A 5HGTA 1VQLA 1LTRD 1LTSD 3DEOA 4NDXA 5FLXE 1VQHA 3I70A 3J81j 3RNUA 1LT3D 1HNWL 4C3HB 4I65A 1BQQT 1SXTA 3G48A 3J80E 1PTOB 1JOOA 1STYA 2K7VA 4JBKA 2AMCB 3I4OA 1VF5C 1EIYB 2B2VC 3S14H 3CAMA 2UXBQ 2BDOA 1HA6A 3U4ZA 4NW2A 5JEAJ 2BH8A 4A3DG 4IFDJ 1CFMA 4KTAA 2F0VA 3OSOA 5BR8Q 3KF6B 2C5CA 2RF4A 2EY1A 3S2HB 2JP1A 3VA7A 1VQPA 4U673 2K5QA 3QWNA 1HNZQ 1EEID 2Z8LA 5KNBA 1EY5A 1TWCH 2P5ZX 5IT9L 3S2DB 2SDFA 4HJ5A 4WJ4A 3DLLA 1QILA 3MAQA 4ZRZA 4LUOA 3A5UA 3Q23A 3MXPA 4JI8L 1HUNA 5LMUL 1H9MA 3D4RA 1G2TA 4IZ8A 2J4XA 1ZXTA 4LFBQ 1KDBA 4JYAQ 3EROA 3GTJB 3J81E 3BJUA 2I5MX 4QL5A 1VQOA 3WWVA 1SNDA 1EOTA 3C1FA 4KJOA 2Z6BA 2MJ8A 5FLXL 1MSHA 3V05A 3DWQA 1S40A 3J80L 3KK7A 2A1AA 3E6ZX 2SOBA 2R92B 4RWSC 1QUQA 1DONA 4KK7A 4XIGS 4JC0A 4MN3A 3BG3A 2E75C 3HOVH 2EYMA 3U50C 1N36Q 1YNNC 4PMBA 1SAPA 3NQTA 3H3VC 1WFQA 1B4OA 2F4VL 1XNQQ 3J80i 3RR5A 4XYQA 5GAEC 2F0KA 3S1NB 1OTCA 3PUWA 5C6AA 1KNEA 3ER0A 2F0NA 3CQZB 3RZDH 4KLKA 1WTPA 4UP8A 2ZTDA 3T51B 2JA6H 1JJGA 2TMPA 3K0YA 2OQKA 3TZUA 3E3XA 2IY5B 2ZJRA 4JI2Q 1VQCA 2MPMA 5BN5A 1I50H 4DR5Q 3IAYA 1V43A 1PXUA 3GTQH 4KI0A 4NMZA 4IPDA 3R2IA 1ZKOA 1CTMA 1A0IA 3A5ZB 3J81L 1VQ9A 5M3FB 3HOZH 3U9SA 1B70B 2K32A 2C9OA 4BBRB 2HHHQ 2NB0A 4C3IG 4K5VA 1D5MC 5C5LA 4QGUA 1GJXA 5IYCG 4DV2Q 2F3IA 5J3BA 3S15H 1P16A 1V1PB 1TKWB 3J81i 3PUXA 4BXXH 1E24A 3K0XA 3PUZA 2F0PA 5JJIA 3ULJA 3C2PA 3GTGH 5IWAQ 2XRSD 2D0PA 2X6GA 1FJGL 3HOUB 1M4VA 1DM0B 4DV5L 3PO3G 2F0QA 1S5ED 3LGJA 4H13C 3L7ZC 5FO7B 1Q8KA 4YWMA 4R4QA 4DXGA 4HCEA 3ONAB 1MJEA 1CT1D 2EE1A 4DUYQ 1SFOB 4LNQA 5C4XG 3KYHC 5EJWA 4FP5D 3V96A 1XTDA 2IPKD 4DR4L 3PIPA 1N32Q 1JT8A 3RD4A 5M5XH 1LT4D 2PQAA 4RA8A 1GUOA 1DOLA 4BY1G 1ONLA 1IBMQ 3S16B 2GN5A 5C44G 2F0TA 2NTTA 2UXCQ 1N9WA 2NVTB 4LF9L 2F0EA 4CDDC 4QUCA 5NUCA 4JK1C 2NN6H 1KDCA 1QJOA 2G9HD 3K80C 3FKIB 1Y1VG 2JSOA 5JEAG 2E5LL 3M4OB 4KY7A 1YJ9A 4IFDG 4I7AA 4ILWA 5BN4A 5HURA 2H5XA 3PV0A 3A8IE 1Q1EA 4O42A 4IURA 2ICIA 1J9OA 1IBKQ 1B3QA 1P8LA 3KF6A 1E22A 2VQEQ 4V190 3TS2A 1I4PA 4E6IA 1PLFA 3OWFA 1X3GA 3GDEA 1AEXA 4BBSG 2PMZB 1IBLL 3EIVA 1W3SA 1Q82C 4KHPL 4WORA 4UHVA 1PRTF 1U4MA 1SYEA 1DJRD 4EGVA 2CKZB 1CA5A 4FF3A 2Q8IB 4ALPA 5D3IB 2RDGA 5LMNL 4OO1G 4GLXA 2SNMA 2EIFA 2OQ0A 4HEDA 1T5XD 3K5OA 4O1NA 4RH6A 4IPCA 4BY7G 3M4QA 3ND9A 3I2ZA 4CJ1B 4MHEA 1C9OA 1A2TA 2HQLA 4ME5A 4KKTA 5FLMG 1A62A 1Y8OB 2KENA 1R4PB 2L5TA 1EYDA 1D6EC 3LNNA 3M3YH 2KBNA 5IYBH 2RHSB 2L0CA 3ULLA 5CMDA 2VZAA 1WVLA 4A3BG 3IKJA 1I4XA 1RCVD 3HOVB 4OEMB 2PNRC 3VR3A 4Q5VA 1G291 1JJ2A 3R93A 5C0XI 1PZJD 2FMCA 4A3DH 1D8LA 1L0XB 1BCPF 4N9PA 2F0WA 2XIWA 2JEAI 1L0YB 3EVQA 1QVFA 3RZDB 3KLSA 3VR2A 3EJIA 3AB9A 2YTVA 2JA6B 4M1UB 1HPCA 4WFN3 1IW7D 5I2YA 4WRDA 2L4NA 5EKKA 1I50B 3HFZB 2RBMA 4KJNA 2MGSA 3GTQB 1NY4A 3Q24A 1MJCA 1X3PA 4KHZA 4PZ8A 4XXEA 3IFDA 2UXDL 4GN4B 3FVQA 4QMGA 5JJLA 3HOZB 1X3EA 3AEVA 5JVH3 4DR1Q 4LF4Q 1S72A 1B53A 4APVA 4LFAQ 3HKSA 3OIQA 1WCMG 5JJKA 3T56B 2JA7G 2HUGA 2KCCA 1A63A 3S15B 4DU9A 5J1ZA 1HTLD 1S5DD 1DGSA 4F87A 1RIPA 1A3VA 2UUAL 2A68D 3GTGB 4FXKC 4DUZL 5KIXA 2PI2A 3A55A 4L5RC 2AQ1B 3E0JA 1LACA 3GTKH 4POFA 4LF6Q 1JC7A 4GNXB 4GOPB 4LF7L 5EPKA 3VDYA 3TRZA 1OXVA 1NTGA 3GP7A 4DR6L 3I56A 1HA5A 4OGQC 1B9NA 2WAQE 2XNAC 4HIOA 2CHBD 1QWYA 3OMCA 3OWEB 4DR3L 1O80A 4G4KA 2O5IC 1EFWA 3ICEA 4YCUA 1K0RA 5M5XB 3QOLA 2NVQH 1HRJA 4GKKL 1FD7D 4GN5A 4ZQ3A 1AFPA 2E2JH 4TKOB 4LF5Q 1U4RA 3P7JA 1PH5A 1BXTA 1Q90A 2RVLA 3MFGA 4LFCQ 1WTVA 4NXMQ 2Y0SB 5IYDG 1WTHA 1EU4A 2KA7A 4MZ9A 4ZLTF 1XPUA 3TQYA 1SYCA 4GNXC 1QZGA 2Z1CA 4GOPC 5M5WB 4PZ7A 1HCZA 1YHQA 3S1RB 1PFBA 3Q0AA 1KL9A 1X3QA 1XMQL 1CHPD 4C3IH 2L9HA 3AFQA 5D65A 3H3VI 1F9SA 5IGCA 2F0FA 2E2HH 4GS3A 5E1FA 2AUJD 4DK3C 2UUBQ 5IYCH 4B3TQ 1AW7A 2OXPA 3I73A 4JI4Q 4OL7A 3H91A 4YHHQ 3LWEA 1C48A 1X9NA 1B9MA 3OMGA 2NZHA 4WJ3M 4UP9A 1F9PA 2QW7A 3K57A 1HZBA 1Z47A 3JAMc 3JC66 3PO3H 2QEJC 5CBAE 2PQEA 4X66Q 2DY7A 4G57A 2WP8J 4A3JG 4A3MB 1O7LA 3I4MG 2C35B 1EY0A 5F2DA 4MTKA 3BDOA 1FGUA 4JV5Q 5C4XH 1TVXA 2O2LD 2O4XA 3D4WA 2AWNA 5FJ8G 1EU3A 1SRUA 5ELNA 2F4IA 1ICFB 5I4DA 3ZJYC 4OXPA 5JOBA 4ULLA 2LXJA 5KRUA 2AHOB 4BY1H 3K5LA 1YNXA 1GM5A 1CSQA 1I6VC 1X6OA 2FXQA 2I5LX 2JEBI 2SNSA 2VB2X 5C44H 2EY2A 1QCBD 1UNSA 3CCQA 1JOKA 2F0LA 3SK8A 1K73C 4DR7L 1TR5A 2K5DA 2H4OA 1SYDA 1VQ5A 2EJMA 1Y8NB 4P73A 1Y1VH 1ZEQX 5JEAH 4TSSA 4CDEC 2A19A 2KOLA 3M3YB 4IFDH 4LUZA 4KMUC 1VF7A 5C3XA 5DNFA 4X62L 1QUQB 3EBEA 4R9WA 2BA0A 4X65Q 2PW5A 3MEHA 1E1OA 4DV1Q 4J6HA 1AZQA 2G9DA 4RGOS 4DV3L 3NELA 2F1MA 2Q2IA 4G7ZC 4A3DB 3SHLA 5IE8A 2L55A 2N49A 5LHY1 1SBBB 1PRTD 1UAPA 3BYTB 4IALA 2F0OA 4FVMA 1E0BA 4A3IG 1RD9D 1ESFA 1PH6A 4BBSH 1FYCA 2ES2A 1A15A 5DM63 5E3FA 5ELFA 4WJWA 1KD1C 3CC4A 1O7YA 5FO8B 2JQOA 3AYHB 3AU7A 3CW2C 3D8GA 2AQ2B 1NMFA 4HJ7A 4OO1H 4DAYA 2VQFQ 2OF1A 4DK1A 2YU9H 4EVOA 1SYBA 1CQVA 3CC2A 2J0TD 1STAA 1TWGH 2RKSA 1EYGA 4BY7H 4NP5A 5E4XA 1H9RA 4F88A 2NYZD 5FLMH 3MEFA 2M9VA 2QGQA 2MO0A 4IOCA 1HNWQ 5C3EG 1XMOL 4H0LC 3K8AA 4GOPA 4IPHA 2BOSA 1YNJC 4OHJA 1BCPD 1B1ZA 2QF7A 4A3BH 3NENA 3STBC 3CRLC 3GTKB 1EY6A 1QNKA 2WFWA 1JR0D 1H95A 1PFNA 2K50A 3NTHA 4IQZA 3LX0A 2B3GA 4QF4A 2ZM6L 1R9TH 1TQOA 3H0GG 1F2YA 1YVCA 4HIDA 1SMYD 3QR8A 3QJYA 3CD6A 3CKIB 2NVQB 1FGBD 2E2JB 2PQAB 1EZ8A 1ZYRD 1GO3E 1MIUA 4JI8Q 5LMUQ 1TXYA 3KLRA 2KECA 5IYBG 5E7NA 1KAWA 3MC0B 4A3FG 5EBCA 2FHTA 3FHWA 3FEWX 1D5ZC 4ODGA 1TS5A 5H1SE 5IGFA 4R8NA 2F3WA 1UE6A 4C3IB 2K1BA 1HZAA 1WCMH 2JA5G 2E2HB 2UUCQ 1TY0A 2JA7H 1PYWD 2L1BA 2WKDA 3U9OA 4B9XA 1WYDA 3S17H 5CV6A 1VQ8A 4JI6L 4JI3L 1DYQA 4CKEA 3IFTA 4DKAC 1K3BC 3CPWA 1BNZA 1EIGA 2EYOA 2F4VQ 3PO3B 1MGSA 3PIOA 4QCLA 3H15A 1K83H 2NVYB 3NBHA 1PTOC 2K5VA 1D1IA 5IOCA 2WB1E 2R7FA 1BKBA 1Y8PB 2N3SA 2K4KA 2ATWA 3UDIA 3NP8A 4LMQD 4GZYC 1TS3A 2R7DA 5C4XB 1TWFH 3KJOA 3K81C 4H7BA 3HOYB 3PO2G 1AE2A 2KEEA 1NMGA 1HR0L 3CPFA 4BY1B 1K0SA 3L0OA 1SJED 4K2LA 4KD3A 2NZ1D 4A4IA 3VR5A 4HCSA 4ZKCB 1GUSA 5C44B 2I07B 4O0AA 1I94L 1F2ZA 4RCOA 2Q2UA 4OX9Q 5IYDH 3A56A 2DY8A 4FF2A 1K28A 4MNOA 4Q0FA 1LTID 1E7ZA 2MP1A 3GV6A 1Y1VB 1BR9A 3FMCA 3PMFA 3UDXA 2Q2TA 1PA6A 5KNCA 1JWUD 3PIO3 1NE3A 3GTPB 3MTSA 1NR4A 4LUVA 5IT9c 1HZ9A 3VYTA 1I6HH 4HMJA 1MD2D 4LK1C 2WINB 4YIJA 4IUVA 4X3UA 1FJGQ 4DV5Q 1STGA 4RGNA 1TS4A 3CMAA 3NQIA 3C46A 1V1QA 3MHBA 2F0JA 4G7OC 2ZXOA 2QKIC 4V0BA 1N34L 1IZ6A 5IGBA 2HCCA 2A69D 1FNWA 4X6AH 3EQLC 3A74A 5BN3A 3VA5A 1HH2P 1LYLA 5K36G 5FLXc 4A3JH 5IY0A 4DR4Q 3I4MH 1WD1A 5I6YA 3J80c 5GAGC 1C4QA 2K33A 1A3TA 1SROA 3BS1A 1YJNA 1O78A 5M5YH 5FJ8H 3Q6SA 3ZYYX 1PH4A 3R2TA 2EDGA 1QVGA 4QIWB 1IKMA 2PNHA 1GHKA 4LF9Q 2YU9B 2NZOA 2JYOA 5E4WC 5I6WA 3KJPA 1MHWC 3K7AH 4BY7B 1EQTA 5T1GA 4ZK9B 2RDHA 4KV6A 4L63B 4CJ0B 2E5LQ 4ABNA 2R3ZA 1UE1A 1IW7C 3K5NA 4IJHA 4RKLA 4ID6A 1YITA 1AN8A 2IHEA 1F9RA 3J7ZC 4XT1B 1M90C 2QDBA 2K03A 5JPNC 2MNAA 2D5DA 2R93G 2JK8A 1IYVA 1I4QA 2FFKB 5M3MG 5L37A 3PQIA 4HMIA 3T13A 3PCOB 3SR1A 1LTLA 2E2DC 4RFBA 3HOXG 4A3BB 4B3RL 3IL8A 2B2UA 4KKSA 1LUZA 3CCSA 1SYGA 4MIUA 3J81c 4A93G 1LTTD 1HJPA 3NWTA 1JMCA 5A35A 1SEBD 3B6YA 2LS01 1LTAD 1DOKA 1W6JA 2NBFA 1Z6HA 1IBLQ 1S3OA 1R9TB 4KHPQ 4A3IH 2A68C 3OIPA 4RKBA 4HR7B 2DJGC 1SN8A 4JOIA 5LMNQ 3T1HQ 2Z4IA 2UU9L 1D1KA 4ME3A 2JXMB 3H94A 3PUYA 2CVRA 3I3CA 3SDZA 4TQUS 3PSIA 4BA2I 3J7YW 2VUMG 2M2LA 2EOTA 2EYHA 1JE4A 2PZWA 3S14B 3R3OA 1NCVA 4DV7L 1WCMB 3PGZA 1IHZA 2JA7B 2F0IA 3E0EA 2WAQG 3PIP3 3TEHB 2K6AA 3D0FA 3A7LA 1IXRA 3W3AA 1S5BD 5ISRA 1WI5A 3S17B 5C3EH 1WTWA 1SNPA 5KGUA 1C7YA 4GKJL 4AYBE 3KF8A 2R6GA 5IP7G 2CQAA 1KC8C 1VQ4A 1EFID 1PYSB 1TWCB 3M7NA 3SE0A 1ENAA 5CV8A 1VQJA 2QDLA 1L0WA 2JA9A 2B29A 4OWTB 1JJCB 2BDNA 1VQMA 4KD4A 4ZCKA 1IL2A 5JAVA 2RSNA 1TWFB 3DUZA 1LV9A 4JI5L 3H0GH 2AQ3B 5M3FG 5IGEA 1G2SA 5CORA 4DV0L 1XPOA 3TBIB 5KYLA 3CU7A 1B2TA 5GROA 1I3QH 2A5HA 3F2UA 1IYJB 1O7ZA 1UE7A 4K8JA 2Z0SA 2HIVA 5DEHA 4FDBA 1SE4A 3G7LA 4B3ML 3GTOH 4A3FH 2QILA 4ZKBB 3D6CA 4K0KL 4DAPA 1JCKB 3HOUG 1ENFA 2EY5A 1XJVA 2JA5H 1I6HB 2B39A 2E2IH 3H6MA 3QIAA 4HTHA 2IWHA 4B9WA 4DUZQ 2XN9C 1PRTB 3TMEA 3ITPA 3ULPA 2OEOA 3A0JA 1U9RA 2RCFA 1Q7YC 3V2TA 3HG9A 2ALYB 3CF5A 4LF7Q 4QY7A 1EWHA 1SNOA 2KVMA 4XQNA 3T4AC 2VY3A 4JW0A 1STEA 3NK9A 3K5MA 4DR6Q 3OYYA 2NTSA 3C1EA 4A3JB 3I4MB 4DR3Q 3HGBA 4X3SA 5C4JH 1U5KA 5IODA 5EQ0A 2B63H 4GKKQ 3L2PA 4UPAA 1SE3A 5M5YB 1IYUA 2K14A 4OWXB 5IIFA 3JAME 1K9MC 1NSNS 3PO2H 4K5WA 1JB3A 2ZTEA 1PRTC 1Q8IA 1ICWA 4DAYB 1LT5D 1OXTA 3N6RA 3HEJA 4NPSA 5CC4A 1K8OA 4LF8L 5DM73 1WTXA 3K59A 1JB7A 4L6TB 2N55A 1XMQQ 1B50A 1JE5A 3RUZA 3RZOH 4RHSA 4DFAA 3KDFB 3U58A 1SE2A 1ET6A 2JJQA 1L1OA 1VQIA 1BCPB 1B44D 3SK4A 3F2BA 3G71A 4OWWB 3KFUA 3S24A 1S5CD 1FNUA 2CQOA 1KTKA 3PUVA 3BVMA 4X64L 4KY5A 3G4SA 4AH6A 1H9KA 2PZUA 3HRZC 3E9IA 3MXGA 1WD0A 4NXNL 5EGTA 2JA8G 2RA4A 2KQ3A 4K2KA 5JVG3 2PW7A 4IO9A 2VB3X 2ZJPA 4JI7L 4HIKA 3HZXA 4YWLA 4CHTB 2K04A 2PCFB 5ELBA 4A3IB 2EXDA 1STBA 5K36H 4A3GG 3RN2A 1GUNA 1BCPC 4JI0L 5COYA 1W6KA 3I4NG 1LTGD 4L5TA 3MXNA 2XTIA 4P75A 3KLSX 4LAAA 2RSOA 3HKZB 2F3VA 1PV4A 3A54A 1Z9FA 1RJTA 2ZXRA 4DR7Q 4DV4L 1JICA 1K8GA 3NE5B 2ZXPA 3JAMi 1UEBA 2EYJA 3IRBA 1SMYC 4GLVB 1SNCA 1TWAH 1Q86C 1A8VA 1ASYA 1ZYRC 1ESRA 4AQYL 4X62Q 4J1MA 2R93H 2KCMA 1SLJA 1PHJA 1EWIA 3I7FA 3DMUA 5M3MH 1GXDC 3D4DA 3FPPA 1EYAA 1UE5A 1HNXL 4IFDI 2HDMA 2L11A 4DV3Q 4JCVE 4KHVA 3UI2A 1QG7A 3HOXH 4IUQA 5LMNW 4C3JG 3NBHB 4A93H 4C56C 2IX1A 1DCZA 2HT1A 5J22A 2WKCA 4HJAA 3S2DH 2DN8A 2XVSA 1VQBA 2PI2E 3HOWG 3H0GB 4QJFA 4LFCL 4R4TA 1EY4A 2JN4A 2X6LA 3H3VH 1Q3LA 4EQPA 2KJXA 1I3QB 2L12A 2DNEA 1SNQA 3UE0A 4C2MH 2HIXA 5AFWA 2VNUD 2A6HD 1WTQA 4LW1A 2VUMH 2DUDA 2WB1G 5C0XJ 2A74C 4N9TA 3E5SA 1EZ6A 2F0HA 4K6LA 4XYOA 1XMOQ 5AJ3L 1RTNA 1EQVA 4PMWA 1UEAB 2JA5B 1HQMC 3DM3A 2E2IB 3BZDB 3MVVA 1CI3M 3NWSA 4L5SA 1E2VA 4ZAIA 3F1ZA 2OWOA 3L9AX 3DWPA 3NPPA 5C4ZA 5IP7H 1PMRA 3MXUA 2XGTA 1Q1BA 3NXWA 4FF1A 1DD2A 2N88A 1VQ6A 1A3UA 5JJZA 1J5EL 2NVXH 3A8JE 4CBVA 5I9OA 2ZM6Q 3AMUA 1G6ZA 2PMZE 4IJLA 3NEMA 5C3WA 2EJGC 2AKWB 4DR2Q 1PH2A 4FYDA 1EL0A 1PVOA 1SMXA 4FXDA 3PO2B 5M3FH 2HDLA 3BDLA 2AWOA 2A69C 1B7YB 3KDFA 1F2MA 2B2YA 1QB5D 3E9HA 4R1JA 5CV4A 3SEBA 1ASZA 3FP9A 3D31A 1KRTA 1X55A 2VXWA 1NAPA 1PYBA 4U68A 4DNRB 4QB4A 4YY3L 2GVAA 3RZOB 1KHIA 4DV6L 1CQFA 1PTOF 1VQNA 4CGYB 4R8IA 1F77A 3HOUH 4JI6Q 4JI3Q 3GD7A 4HN7A 3VR6A 4P71A 4HJ9A 3VYSA 4F7XA 2ENBA 5EPLA 4A3MG 1KLUD 2V1CC 1N33L 4IPGA 1SFOH 3GO5A 4HAEA 3T1YL 1VS0A 4MTNA 1NJIC 4DK0A 2CWAA 1NBWA 3URYA 5GAHC 5EPJA 3NTKA 2EJFC 4TRDA 4DGZA 1KIXA 2EZVA 1DZ1A 1X32A 4GN3B 3Q8DA 5KNDA 2CCZA 4A3KG 4Y52H 3S16H 1XYIA 2NVTH 4YWKA 4A3LG 3MFYA 2Z6KA 1HR0Q 1SDFA 1VDZA 4I7ZC 4B08A 4CJ2C 4R4OA 3M7GA 4JI1L 2XWBB 1LTBD 1J6QA 5EKLA 1CZWA 1TS2A 1Z7TA 3I91A 1E2WA 4K6DA 1I94Q 4C1NI 2B2UC 4LJZC 3G6JB 2YTYA 3OTOL 4B3SL 4A3EG 1U4PA 2K5HA 1GD7A 1CZGA 1GKHA 2R61A 4IUTA 2B2WA 4LWCA 1TWAB 2WV6D 3BDCA 4XTCS 3GQBA 1XNRL 1ET9A 4HJ8A 1YZ6A 1R4QB 4NB3A 1C0AA 2PYKA 5FKAC 2B2TA 1HUMA 1SE8A 2R93B 3W1GA 4PZ6A 5M3MB 4JOIC 3M9BA 2VW9A 1GHJA 2H1EA 3NSWA 1BBXC 1LM0A 3KF8B 2HCIA 3MZ5A 5G3LF 1PFMA 2B63G 4X3KA 3RLNA 2D9UA 3HOXB 1N34Q 4K5XA 4DNIA 4EQOA 1HZCA 4A93B 3CMEA 3FPUB 1EIHA 4GLAC 1PFSA 2JA8H 4JG2A 5IP9G 1X54A 3TP8A 1UWVA 5FK9C 2GA4B 1VQEA 4XDXA 2I5HA 1BDOA 2PZTA 2BA1A 2B8FA 5C0XG 4A3GH 4YCWA 2FJ2A 2ID0A 2RHQB 4KN4C 2B8GA 1PH9A 3I4NH 5HGQA 4AYBG 1RTOA 1EOVA 2Y0SE 4C2MB 4IN3A 3SVMA 2F0GA 2YV5A 4POGA 2F52A 3CRKC 3PF4A 2CFMA 4PNYA 1WTRA 2UXBL 4A75A 1Y1WG 1AH9A 3MWYW 3ERQA 1VQDA 2VUMB 2UUCL 3DEPA 3ERSX 1VQKA 2Q2HA 2R7ZG 2K52A 3HKZE 2CW0D 5BR8L 5CGKA 4A3CG 2FINB 1PH8A 1MSGA 1XX8A 4DXFA 2K01A 5ELDA 2WAQB 1DXMA 4OELB 3F8TA 1V8QA 1CSPA 1QZHA 1HNZL 3DWAA 3GTMH 4K14A 1I5FA 4KKUA 3UDFA 4B3RQ 1CKNA 1PH3A 4BBSB 1F9QA 1SJHD 2A8VA 3I4LA 1YI2A 4CKBA 1OXSC 4CDFC 1JWSD 4C3JH 2NVXB 1IKLA 4LFBL 4JYAL 2IL8A 3DM1A 1B3AA 1PH7A 2D2CC 2OTJA 1NUCA 3RLFA 1H9SB 1HQRD 1EY9A 1TWGB 4C3HG 5CBEE 1WTOA 2UU9Q 3HOWH 1N8RC 1YNJD 1ML0D 1YHAA 2IT1A 4OX9L 3STBD 4DF7A 2AUKA 1CUKA 3KLWA 2ZJQA 2KCTA 2NN6I 1Q81C 5CV9A 1U4LA 4RG1A 2K5WA 2F0UA 2BE5D 1N36L 5I2XA 1CKMA 2KHIA 4FO2A 4H44C 3BVGA 5M9OA 2XSCA 3CCEA 4DV7Q 1XNQL 4R4CA 1V1OA 1TWHH 5CYUA 1STNA 1Y14B 3LWUA 2A73B 1K3RA 3NHHA 1S4ZA 2G5DA 2KEDA 1L1OB 1VQ7A 1JWMD 2LFNA 3U4VA 4N8FA 2A6ED 2DGYA 2E8GA 2EYLA 4BS9A 4GKJQ 4H02A 5JPMC 1O7IA 2WACA 3OW7A 4FF4A 5I9PA 4JI2L 3KUPA 5D3DA 1BUVT 2B2VA 4DR5L 1ILPA 1KDAA 1DOMA 1QE6A 1QVCA 1G6PA 4TVAB 3AQQA 3A7AB 3HOYG 3Q22A 1KNAA 1C8CA 4RMFA 2YTXA 3P75A 2K28A 4NKLA 2DJFC 2HHHL 3C3LA 2EY6A 4JI5Q 2NUCA 4DA2A 1L1OC 3TSSA 2YYZA 3K7UC 2R92G 4DV0Q 4DV2L 3DHQA 2N78A 3TS0A 3MXNB 1VMPA 1EWCA 5M5WH 4HSVA 2KHJA 1GUGA 5IWAL 3S1RH 2OTLA 1PTOD 4B3MQ 2BCOA 5C4HA 1JORA 4BWGB 2N8NA 4K0KQ 1LLRD 3QB3A 3QG1A 3R8BA 3SXHA 1BBUA 2CH4A 2MUYA 1VMCA 1K83B 5DAUA 4DUYL 4P72A 1VQFA 1XTCD 2TSSA 2EYPA 1N32L 5IGGA 3SK5A 4Y7NH 1OXUA 1SNMA 1I4RA 2RQXA 5FO9B 4DPGA 4UAIA 4A3MH 4AIMA 1HR0W 4PV1C 4F8MA 3GV3A 4M8AA 4RGMA 5EBDA 1IBML 1RL2A 4DAVA 1EQQA 4J8QA 1X65A 2UXCL 1RDPD 2JA8B 4BBRG 1A6XA 5EKIA 4OONA 1RODA 2J7ZA 1CM9A 3S1QH 3T1HL 2UXDQ 1YNND 4CKCA 1EIFA 1HXYD 1ENCA 4RAUC 4A3GB 1MBYA 2OCEA 4A3KH 4YCVA 3WOEA 2IJ0A 4K8IA 4P2CB 4UY8C 1H9JA 3I4NB 4A3LH 1IBKL 4OIKA 1AP0A 2VQEL 4LF8Q 2FMMA 3I72A 2LMCB 2UUAQ 1K8AC 5CV5A 1FVIA
chains in the Genus database with same CATH topology
1PDQA 5LL6X 3CHBD 1T5EA 1RHPA 1TIID 4XT3B 1SYFA 3J7AF 1OXXK 5G3LD 5T1IA 1Q12A 2IW3A 5LL6S 3GTMB 5A2QE 3K6OA 3KBXA 1M8AA 1TY2A 2A6HC 2ICEC 5J39A 1BF4A 4ZUIA 4KY6A 3VYUA 1H9SA 2IX0A 3D3RA 3D6WA 3T53B 4C3JB 2E74C 4KN7C 3TDQA 5IGDA 4JBWA 3P20A 3W2DA 5CR3A 1BO0A 2DNCA 2LY7A 1RKNA 4DNTB 1UUPA 3N52A 1VCIA 3K7AB 3HOWB 1V1PA 3I90A 2OT2A 5C0XH 2Q8TA 1HHVA 2F0MA 2MHVA 2KCNA 1EEFD 4QUFA 4RCNA 1KAAA 4UDUC 1KABA 1MI2A 3TP6A 2D62A 2QCPX 4FNFA 2XRQD 3QOJA 1TWHB 2WB1B 1NR2A 1OO9B 2PO4A 3BYYB 4IUPA 3L3OC 5KYIA 4ZYSA 3TN2A 3TZDA 5A2QL 2HQEA 2M00A 4EQNA 2B2YC 2Q8RE 1HFNA 4RHRA 2K05A 3TP7A 4HSPA 3H09A 1PZKD 3JAML 1D5XC 1A2UA 3HS0C 5KEEA 3KBGA 3QO2A 3S9WA 5C5MA 3A8KE 5TSSA 2O5JC 2F03A 4IUUA 3OHXC 1II3A 1PTOH 1I4HA 4S3SA 3WDNA 2E76C 5C3EB 4IUNA 3MA2B 2I46A 1XXGA 2JE6I 1GUTA 2EPBA 1XWEA 4PMCA 1RF2D 5K5PA 1G8ZD 3EA6A 2IX3A 4RGTA 1LABA 2SEBD 3VR4A 4Y7NB 3EFXD 1FNVA 2KHSA 3BVZA 2ZT9C 1LT6D 4L8JA 2WIIB 4ZUJA 1FR3A 3M4YA 1STHA 3OOCA 1G91A 3WOFA 2B2WC 3S1QB 3OPOA 2XWJB 1QOHA 3K58A 2B2TC 4A3KB 3GTOB 4A3FB 4FXGC 3VYRA 1JQYD 1EYCA 1BOSA 2NWGA 3I8ZA 4OO1I 2X69A 4OIJA 2EVBA 3FDTA 4PQXA 3RMHA 4X3TA 1HFGA 1I4GA 3FRPB 4A3EB 3NTIA 3S1MB 1CK1A 1CHQD 3DXJC 1AZPA 3P1HA 1EY8A 5FOBB 3NBIA 1TT2A 3HP3A 3X3MA 4DN4M 2F0SA 2V4DA 3O13A 5C4JB 1E2ZA 2F0DA 4Z9CB 2B63B 2PPBC 1GOZA 2LKVA 2NN6G 2CW0C 3T16A 2KUMA 3SK6A 5ELEA 1EY7A 1GUWA 1CA6A 4G7HC 3GTLB 1QNUA 3TP5A 1Y69U 1TU2B 4AYBB 1LO5D 4C1NK 5D14A 2EYFA 1ILQA 1IL8A 1Y1WB 1KLGD 2RDFA 5ELCA 1SSOA 3NUCA 2R7ZB 1D2BA 1JOQA 3J7AV 1S5FD 5CV7A 5IT9E 1PZID 2BE5C 2Z4HA 2EXZA 4XQJA 1F2LA 1HTPA 3M85A 4XQQA 4BA1I 2A6EC 1K8MA 3X3NA 3ND8A 5HGTA 1LTRD 1LTSD 3DEOA 4NDXA 5FLXE 3I70A 1LT3D 4C3HB 4I65A 1SXTA 1BQQT 3J80E 1PTOB 1JOOA 1STYA 2K7VA 1VF5C 2B2VC 2BDOA 1HA6A 4NW2A 5JEAJ 4IFDJ 1CFMA 4KTAA 2F0VA 3OSOA 2C5CA 2EY1A 3S2HB 2JP1A 3VA7A 4U673 2K5QA 3QWNA 1EEID 2Z8LA 5KNBA 1EY5A 5IT9L 3S2DB 2SDFA 1QILA 3MAQA 4ZRZA 3Q23A 3MXPA 1HUNA 1H9MA 3D4RA 1G2TA 4IZ8A 2J4XA 1ZXTA 1KDBA 3EROA 3GTJB 3J81E 1SNDA 1EOTA 3C1FA 4KJOA 2MJ8A 5FLXL 1MSHA 3V05A 3DWQA 3J80L 3KK7A 3E6ZX 2SOBA 2R92B 4RWSC 1DONA 4KK7A 4XIGS 4MN3A 3BG3A 2E75C 2EYMA 1YNNC 4PMBA 1SAPA 3NQTA 3H3VC 1B4OA 4XYQA 2F0KA 3S1NB 3PUWA 5C6AA 1KNEA 2F0NA 3CQZB 1WTPA 3T51B 2TMPA 3K0YA 3TZUA 2MPMA 5BN5A 3IAYA 1V43A 1PXUA 4KI0A 4NMZA 3R2IA 1ZKOA 1CTMA 3J81L 5M3FB 3U9SA 2K32A 2C9OA 4BBRB 2NB0A 4C3IG 4K5VA 1D5MC 5C5LA 1GJXA 1V1PB 1TKWB 3PUXA 3PUZA 2F0PA 3C2PA 2XRSD 2X6GA 3HOUB 1M4VA 1DM0B 2F0QA 1S5ED 4H13C 3L7ZC 5FO7B 4DXGA 4HCEA 3ONAB 1CT1D 2EE1A 1SFOB 5EJWA 3V96A 4FP5D 2IPKD 3RD4A 1LT4D 4RA8A 1GUOA 1DOLA 1ONLA 3S16B 2F0TA 2NTTA 2NVTB 2F0EA 4QUCA 5NUCA 4JK1C 2NN6H 1KDCA 1QJOA 2G9HD 3FKIB 2JSOA 5JEAG 3M4OB 4KY7A 4IFDG 4ILWA 5BN4A 5HURA 3PV0A 3A8IE 1Q1EA 4O42A 4IURA 2ICIA 1J9OA 4V190 1I4PA 4E6IA 1PLFA 3OWFA 1AEXA 2PMZB 4WORA 1PRTF 1U4MA 1SYEA 1DJRD 4EGVA 1CA5A 4FF3A 2Q8IB 5D3IB 2RDGA 4OO1G 2SNMA 4HEDA 1T5XD 3K5OA 4O1NA 4RH6A 3ND9A 4CJ1B 4MHEA 1A2TA 4ME5A 4KKTA 1Y8OB 1R4PB 2L5TA 1EYDA 1D6EC 3LNNA 2L0CA 5CMDA 1WVLA 3IKJA 1I4XA 1RCVD 3HOVB 2PNRC 3VR3A 4Q5VA 1G291 3R93A 5C0XI 1PZJD 2FMCA 1L0XB 1BCPF 4N9PA 2F0WA 2XIWA 2JEAI 1L0YB 3EVQA 3RZDB 3KLSA 3VR2A 3EJIA 3AB9A 2JA6B 4M1UB 1HPCA 4WFN3 1IW7D 5I2YA 4WRDA 2L4NA 5EKKA 1I50B 2RBMA 4KJNA 2MGSA 3GTQB 3Q24A 1X3PA 4KHZA 4XXEA 3IFDA 3FVQA 4QMGA 3HOZB 5JVH3 1B53A 3OIQA 3T56B 2HUGA 2KCCA 3S15B 4DU9A 5J1ZA 1HTLD 1S5DD 4F87A 1A3VA 2A68D 3GTGB 4FXKC 5KIXA 3A55A 2AQ1B 3E0JA 1LACA 1JC7A 5EPKA 1OXVA 3GP7A 1HA5A 4OGQC 1B9NA 2XNAC 2CHBD 1QWYA 3OMCA 3OWEB 1O80A 4G4KA 2O5IC 5M5XB 3QOLA 1HRJA 1FD7D 4ZQ3A 1AFPA 4TKOB 1U4RA 3P7JA 1BXTA 1Q90A 2RVLA 3MFGA 1WTVA 2Y0SB 1EU4A 2KA7A 4ZLTF 1SYCA 2Z1CA 5M5WB 1HCZA 3S1RB 1PFBA 3Q0AA 1X3QA 1CHPD 2L9HA 5D65A 1F9SA 5IGCA 2F0FA 5E1FA 2AUJD 1AW7A 2OXPA 3I73A 4OL7A 3H91A 3LWEA 1C48A 1B9MA 3OMGA 1F9PA 3K57A 1Z47A 2QEJC 5CBAE 2PQEA 2DY7A 4G57A 2WP8J 4A3MB 1O7LA 1EY0A 5F2DA 3BDOA 1TVXA 2O2LD 2O4XA 3D4WA 2AWNA 1EU3A 2F4IA 5I4DA 5JOBA 4ULLA 5KRUA 3K5LA 1I6VC 2JEBI 2SNSA 2VB2X 2EY2A 1QCBD 1UNSA 1JOKA 2F0LA 3SK8A 1TR5A 2K5DA 2H4OA 1SYDA 2EJMA 1Y8NB 1ZEQX 5JEAH 4TSSA 2KOLA 3M3YB 4IFDH 4KMUC 1VF7A 5C3XA 5DNFA 4R9WA 2BA0A 2PW5A 3MEHA 4J6HA 1AZQA 2G9DA 4RGOS 2F1MA 4G7ZC 4A3DB 3SHLA 2L55A 5LHY1 1SBBB 1PRTD 1UAPA 3BYTB 4IALA 2F0OA 4FVMA 1E0BA 1RD9D 1ESFA 1FYCA 1A15A 5DM63 5E3FA 5ELFA 4WJWA 1O7YA 5FO8B 3AU7A 3D8GA 2AQ2B 4OO1H 4DAYA 2OF1A 4DK1A 4EVOA 1SYBA 1CQVA 2J0TD 1STAA 2RKSA 4NP5A 5E4XA 1H9RA 4F88A 2NYZD 2M9VA 4H0LC 2BOSA 1YNJC 4OHJA 1BCPD 1B1ZA 2QF7A 3CRLC 3GTKB 1EY6A 1QNKA 1JR0D 1PFNA 3NTHA 4IQZA 3LX0A 4QF4A 1TQOA 1F2YA 1SMYD 3QJYA 3CKIB 2NVQB 1FGBD 2E2JB 1EZ8A 1ZYRD 3KLRA 2KECA 3MC0B 5EBCA 2FHTA 3FEWX 1D5ZC 4ODGA 1TS5A 5IGFA 4R8NA 2F3WA 4C3IB 2K1BA 2E2HB 1TY0A 1PYWD 2L1BA 2WKDA 3U9OA 4B9XA 5CV6A 1DYQA 4CKEA 3IFTA 1BNZA 1EIGA 2EYOA 3PO3B 1MGSA 4QCLA 2NVYB 3NBHA 1PTOC 1D1IA 5IOCA 1Y8PB 3NP8A 4LMQD 4GZYC 1TS3A 5C4XB 4H7BA 3HOYB 2KEEA 4BY1B 1SJED 4K2LA 4KD3A 2NZ1D 3VR5A 4HCSA 4ZKCB 1GUSA 5C44B 2I07B 1F2ZA 4RCOA 3A56A 2DY8A 4FF2A 4Q0FA 1LTID 2MP1A 3GV6A 1Y1VB 1BR9A 3FMCA 3PMFA 5KNCA 1JWUD 3PIO3 3GTPB 3MTSA 1NR4A 3VYTA 4HMJA 1MD2D 4LK1C 2WINB 4YIJA 4IUVA 4X3UA 1STGA 4RGNA 1TS4A 3C46A 3NQIA 3MHBA 2F0JA 4G7OC 2ZXOA 2QKIC 4V0BA 5IGBA 2HCCA 2A69D 1FNWA 3EQLC 5BN3A 3VA5A 5K36G 1WD1A 5I6YA 1C4QA 2K33A 1A3TA 3BS1A 1O78A 3Q6SA 3ZYYX 3R2TA 2EDGA 4QIWB 1IKMA 1GHKA 2YU9B 2JYOA 5E4WC 5I6WA 4BY7B 1EQTA 5T1GA 4ZK9B 2RDHA 4KV6A 4L63B 4CJ0B 4ABNA 2R3ZA 1IW7C 3K5NA 4RKLA 4ID6A 1AN8A 1F9RA 4XT1B 1J8IA 2QDBA 2K03A 5JPNC 2D5DA 1IYVA 1I4QA 2FFKB 4HMIA 3T13A 3SR1A 2E2DC 4RFBA 4A3BB 3IL8A 2B2UA 4KKSA 1SYGA 4MIUA 1LTTD 3NWTA 5A35A 1SEBD 2LS01 1LTAD 1DOKA 1W6JA 2NBFA 1Z6HA 1R9TB 2A68C 3OIPA 4RKBA 4HR7B 2Z4IA 1D1KA 2JXMB 3H94A 3PUYA 2CVRA 3I3CA 3SDZA 4TQUS 4BA2I 3J7YW 2M2LA 2EOTA 2EYHA 1JE4A 2PZWA 3S14B 3R3OA 1NCVA 1WCMB 1IHZA 2JA7B 2F0IA 3PIP3 2K6AA 3A7LA 3W3AA 1S5BD 5ISRA 3S17B 1WTWA 1SNPA 5KGUA 3KF8A 2R6GA 2CQAA 1EFID 1TWCB 3M7NA 3SE0A 1ENAA 5CV8A 2BDNA 4KD4A 5JAVA 2RSNA 1TWFB 3DUZA 1LV9A 2AQ3B 5IGEA 1G2SA 5CORA 3TBIB 5KYLA 3CU7A 1B2TA 2A5HA 3F2UA 1O7ZA 4K8JA 5DEHA 1SE4A 3G7LA 2QILA 4ZKBB 3D6CA 4DAPA 1JCKB 1ENFA 2EY5A 1I6HB 2B39A 3H6MA 3QIAA 4HTHA 2IWHA 4B9WA 2XN9C 1PRTB 3TMEA 3ITPA 2OEOA 1U9RA 3V2TA 3HG9A 1EWHA 1SNOA 2KVMA 4XQNA 3T4AC 1STEA 3NK9A 3K5MA 2NTSA 3C1EA 4A3JB 3I4MB 3HGBA 4X3SA 5IODA 5EQ0A 1SE3A 5M5YB 1IYUA 5IIFA 3JAME 1NSNS 4K5WA 1JB3A 1PRTC 1Q8IA 1ICWA 1LT5D 1OXTA 3N6RA 3HEJA 5CC4A 1K8OA 5DM73 1WTXA 3K59A 4L6TB 2N55A 1B50A 3RUZA 4RHSA 4DFAA 1SE2A 1ET6A 1BCPB 1B44D 3SK4A 1S5CD 1FNUA 1KTKA 3PUVA 3BVMA 4KY5A 1H9KA 2PZUA 3HRZC 3MXGA 1WD0A 5EGTA 2RA4A 2KQ3A 4K2KA 5JVG3 2PW7A 2VB3X 3HZXA 4CHTB 2K04A 2PCFB 5ELBA 4A3IB 1STBA 5K36H 1GUNA 1BCPC 5COYA 1W6KA 1LTGD 3MXNA 3KLSX 4LAAA 2RSOA 3HKZB 2F3VA 3A54A 1RJTA 2ZXRA 1JICA 3NE5B 2ZXPA 2EYJA 1SMYC 1SNCA 1ZYRC 1ESRA 4J1MA 3DMUA 1GXDC 3D4DA 3FPPA 1EYAA 4IFDI 2HDMA 2L11A 4KHVA 3UI2A 1QG7A 4IUQA 4C3JG 4C56C 2IX1A 1DCZA 5J22A 2WKCA 2DN8A 2XVSA 3H0GB 1EY4A 2X6LA 1Q3LA 4EQPA 2KJXA 1I3QB 2L12A 2DNEA 1SNQA 5AFWA 2VNUD 2A6HD 1WTQA 5C0XJ 2A74C 4N9TA 3E5SA 1EZ6A 2F0HA 4K6LA 4XYOA 1RTNA 1EQVA 4PMWA 1UEAB 2JA5B 1HQMC 2E2IB 3BZDB 3MVVA 1CI3M 3NWSA 1E2VA 4ZAIA 3L9AX 3DWPA 3NPPA 5C4ZA 1PMRA 3MXUA 1Q1BA 3NXWA 4FF1A 1DD2A 2N88A 1A3UA 5JJZA 3A8JE 4CBVA 5I9OA 3AMUA 1G6ZA 5C3WA 2EJGC 4FYDA 1EL0A 4FXDA 3PO2B 2HDLA 3BDLA 2AWOA 2A69C 1F2MA 2B2YA 1QB5D 5CV4A 3SEBA 3D31A 2VXWA 1NAPA 4U68A 4DNRB 4QB4A 3RZOB 1CQFA 1PTOF 4CGYB 4R8IA 1F77A 3GD7A 4HN7A 3VR6A 3VYSA 4F7XA 2ENBA 5EPLA 1KLUD 3GO5A 4HAEA 4DK0A 3URYA 5EPJA 3NTKA 2EJFC 4TRDA 4DGZA 2EZVA 1DZ1A 1X32A 5KNDA 1XYIA 3MFYA 1SDFA 1VDZA 4I7ZC 4B08A 4CJ2C 3M7GA 2XWBB 1LTBD 5EKLA 1CZWA 1TS2A 1Z7TA 3I91A 1E2WA 4K6DA 4C1NI 2B2UC 4LJZC 3G6JB 1U4PA 1CZGA 2R61A 4IUTA 2B2WA 1TWAB 2WV6D 3BDCA 4XTCS 3GQBA 1ET9A 1R4QB 2PYKA 5FKAC 2B2TA 1HUMA 2R93B 5M3MB 1GHJA 2H1EA 3NSWA 1BBXC 2HCIA 3MZ5A 5G3LF 1PFMA 4X3KA 2D9UA 3HOXB 4K5XA 4EQOA 4A93B 1EIHA 3FPUB 3TP8A 5FK9C 2GA4B 4XDXA 1BDOA 2PZTA 2BA1A 2B8FA 5C0XG 2FJ2A 2ID0A 4KN4C 2B8GA 1RTOA 4C2MB 4IN3A 3SVMA 2F0GA 3CRKC 4PNYA 1WTRA 3MWYW 3ERQA 2VUMB 3DEPA 2CW0D 5CGKA 2FINB 1MSGA 1XX8A 4DXFA 2K01A 5ELDA 2WAQB 1DXMA 1V8QA 3DWAA 4K14A 4KKUA 4BBSB 1F9QA 1SJHD 3I4LA 4CKBA 1OXSC 1JWSD 2NVXB 1IKLA 2IL8A 3DM1A 1B3AA 2D2CC 1NUCA 3RLFA 1H9SB 1HQRD 1EY9A 1TWGB 4C3HG 5CBEE 1WTOA 1YNJD 1ML0D 2IT1A 4DF7A 2AUKA 2NN6I 5CV9A 1U4LA 2K5WA 2F0UA 2BE5D 5I2XA 4FO2A 4H44C 3BVGA 5M9OA 2XSCA 1V1OA 5CYUA 1STNA 2A73B 3LWUA 1S4ZA 3NHHA 2KEDA 1JWMD 2LFNA 2A6ED 2EYLA 4BS9A 5JPMC 2WACA 3OW7A 4FF4A 5I9PA 3KUPA 5D3DA 1BUVT 2B2VA 1ILPA 1KDAA 1DOMA 1QE6A 3A7AB 3Q22A 1KNAA 1C8CA 3P75A 2K28A 4NKLA 3C3LA 2EY6A 2NUCA 4DA2A 3TSSA 2YYZA 3DHQA 1VMPA 1EWCA 4HSVA 1GUGA 1PTOD 2BCOA 5C4HA 1JORA 4BWGB 1LLRD 3QB3A 3QG1A 3R8BA 3SXHA 2MUYA 1VMCA 1K83B 5DAUA 1XTCD 2TSSA 2EYPA 5IGGA 3SK5A 1OXUA 1SNMA 1I4RA 2RQXA 5FO9B 4UAIA 4PV1C 4F8MA 3GV3A 4M8AA 4RGMA 5EBDA 4DAVA 4J8QA 1RDPD 2JA8B 1A6XA 5EKIA 1RODA 2J7ZA 1CM9A 1YNND 4CKCA 1HXYD 1ENCA 4RAUC 4A3GB 1MBYA 3WOEA 2IJ0A 4K8IA 4P2CB 1H9JA 3I4NB 4OIKA 1AP0A 2FMMA 3I72A 2LMCB 5CV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R3O A;  1EZ8 A;  1KDA A;  4KTA A;  2F0V A;  2F0D A;  2SNM A;  5IIF A;  1IHZ A;  3OSO A;  1SYF A;  2F0I A;  5IGB A;  1NSN S;  4K5W A;  2LKV A;  1II3 A;  4S3S A;  5C3X A;  3T16 A;  5J22 A;  5ISR A;  3VA5 A;  2EY1 A;  2F0P A;  2F0G A;  3HEJ A;  1SNP A;  5CC4 A;  3P75 A;  1A2T A;  3OMC A;  4ODG A;  5KGU A;  1EY5 A;  4NKL A;  2PW5 A;  3MEH A;  4ME5 A;  4PNY A;  3SK6 A;  2ENB A;  2EY6 A;  2F0Q A;  4F7X A;  5I6Y A;  4IUN A;  2NUC A;  3ERQ A;  5IGF A;  4J6H A;  1A3T A;  3QOL A;  4R8N A;  2F3W A;  5J39 A;  1EY4 A;  4ZQ3 A;  1EY7 A;  4ZUI A;  1EYD A;  3RUZ A;  4KY6 A;  3DHQ A;  3SHL A;  3MXP A;  3TP5 A;  4DFA A;  1ENA A;  5CV8 A;  4PMC A;  4EQP A;  5CGK A;  4IAL A;  2F0O A;  5K5P A;  1SNQ A;  4IZ8 A;  3SK4 A;  3U9O A;  4B9X A;  4TRD A;  5I6W A;  1KDB A;  5CV6 A;  3ERO A;  4KHV A;  5IGD A;  4DGZ A;  1SYC A;  4KD4 A;  4KY5 A;  5E3F A;  5CR3 A;  3S9W A;  5JAV A;  4K14 A;  4KV6 A;  1SND A;  2PZU A;  1RKN A;  2EYF A;  2KHS A;  5C4H A;  1JOR A;  3C1F A;  4KJO A;  2EYO A;  3QB3 A;  5IGE A;  4RKL A;  4N9T A;  5EGT A;  4ID6 A;  3SXH A;  3E5S A;  2F0F A;  1EZ6 A;  2F0H A;  2KQ3 A;  2RDF A;  4K2K A;  5E1F A;  5IGC A;  4N9P A;  2F0W A;  2PW7 A;  2QDB A;  5KYL A;  3D8G A;  2SOB A;  2F0T A;  1EQV A;  2OXP A;  3NUC A;  5IOC A;  2F0M A;  4OL7 A;  2OF1 A;  4ZUJ A;  3EVQ A;  5EKL A;  4K8J A;  4EVO A;  5DAU A;  1SYB A;  5KIX A;  2F0E A;  3HZX A;  4HMI A;  1STH A;  3SR1 A;  5DEH A;  5NUC A;  3OMG A;  3NP8 A;  3MVV A;  4K6D A;  3T13 A;  1KDC A;  1JOQ A;  3EJI A;  2EYP A;  1STA A;  1STB A;  2RKS A;  5IGG A;  4NP5 A;  3SK5 A;  4KY7 A;  2EYM A;  1NUC A;  1KAA A;  1SNM A;  4H7B A;  4PMB A;  1KAB A;  3NQT A;  4WRD A;  5CV7 A;  3TP6 A;  3D6C A;  5C4Z A;  5EKK A;  1EY9 A;  1SYG A;  4MIU A;  3QOJ A;  5HUR A;  2RBM A;  2EXZ A;  2PQE A;  3BDC A;  2F0K A;  4KJN A;  3NXW A;  4F8M A;  1EYC A;  5C6A A;  4G57 A;  4LAA A;  2EY5 A;  2PYK A;  1A3U A;  4K2L A;  4KD3 A;  2F0N A;  2F3V A;  5KYI A;  4DF7 A;  1EY0 A;  5F2D A;  4QMG A;  3H6M A;  5I9O A;  1F2Z A;  4HTH A;  2HQE A;  4B9W A;  2M00 A;  5CV9 A;  4EQN A;  4E6I A;  3D4W A;  2O4X A;  4RKB A;  3ITP A;  3TME A;  5C3W A;  1ENC A;  5HGT A;  2F0U A;  3OWF A;  3MZ5 A;  2EYJ A;  2OEO A;  3PMF A;  1U9R A;  1EY6 A;  3V2T A;  5M9O A;  1SNC A;  4NDX A;  1AEX A;  4DU9 A;  4K8I A;  4K5X A;  5JOB A;  5J1Z A;  4EQO A;  1STN A;  4I65 A;  1SNO A;  4NMZ A;  3TP7 A;  5KRU A;  3NHH A;  3BDL A;  1JOO A;  3NK9 A;  1STY A;  1F2M A;  4J1M A;  2SNS A;  3TP8 A;  1A3V A;  3LX0 A;  4QF4 A;  1A2U A;  5CV4 A;  5KEE A;  4HMJ A;  3C1E A;  1EY8 A;  2EY2 A;  1TQO A;  2EYL A;  3DMU A;  3P1H A;  4WOR A;  4YIJ A;  1F2Y A;  1JOK A;  2F0L A;  2WAC A;  5CV5 A;  3SK8 A;  3D4D A;  1TR5 A;  1EYA A;  1SYE A;  1STG A;  1SYD A;  1TT2 A;  2PZT A;  2EYH A;  4K5V A;  5C5M A;  5I9P A;  5IOD A;  3MHB A;  5C5L A;  2F0J A;  2PZW A;  2F0S A;  4QB4 A; 
#chains in the Genus database with same CATH topology
 1PDQ A;  1XPR A;  3UE1 A;  5LL6 X;  4UP7 A;  4A3E H;  3CHB D;  1T5E A;  1RHP A;  1TII D;  3M4P A;  2IHF A;  4XT3 B;  1SYF A;  3J7A F;  3RLO A;  3I55 A;  3S1M H;  1BVS A;  1OXX K;  5G3L D;  5T1I A;  1Q12 A;  4X64 Q;  2IW3 A;  1E3P A;  5LL6 S;  3GTM B;  5A2Q E;  3K6O A;  3KBX A;  1M8A A;  1TY2 A;  2A6H C;  2ICE C;  2D0O A;  5J39 A;  3EN2 A;  1BF4 A;  4ZUI A;  4KY6 A;  4NXN Q;  4DK6 C;  3VYU A;  1X3F A;  1H9S A;  2IX0 A;  3D3R A;  4JI7 Q;  3D6W A;  3T53 B;  1CKO A;  4C3J B;  2E74 C;  3FKI G;  4KN7 C;  1WOC A;  5EAY A;  3TDQ A;  5IGD A;  4JBW A;  3P20 A;  3W1B A;  3W2D A;  5CR3 A;  5IP9 H;  1BO0 A;  1MKH A;  2DNC A;  2LY7 A;  4CDC C;  2QEX A;  1RKN A;  4DNT B;  1PH1 A;  2I0Q A;  1UUP A;  3N52 A;  4JI0 Q;  1VCI A;  1L2F A;  3K7A B;  1G51 A;  2K75 A;  3TRE A;  2HD3 A;  4EX5 A;  3HOW B;  3GTL H;  1V1P A;  3I90 A;  3BU2 A;  2OT2 A;  5C0X H;  2Q8T A;  1VQG A;  4IOA A;  1HHV A;  2F0M A;  2MHV A;  2KCN A;  1B8A A;  1EEF D;  2ASB A;  1VQA A;  4JBM A;  4QUF A;  4DV4 Q;  4RCN A;  2VL6 A;  4R4I A;  1KAA A;  4UDU C;  1KAB A;  1MI2 A;  3TP6 A;  2D62 A;  2QCP X;  4FNF A;  1Y1W H;  2XRQ D;  3QOJ A;  3KOJ A;  2K5N A;  1TWH B;  4AQY Q;  1SR3 A;  2WB1 B;  1NR2 A;  1NNX A;  1OO9 B;  2PO4 A;  3BYY B;  2R7Z H;  5DLQ E;  3CCR A;  3AFP A;  3L3O C;  4IUP A;  5KYI A;  4A3C H;  4ZYS A;  3TN2 A;  3TZD A;  5A2Q L;  2HQE A;  2MQH A;  2M00 A;  4EQN A;  1HNX Q;  2GVB A;  4DAM A;  2B2Y C;  2Q8R E;  1HFN A;  4HIM A;  3SGI A;  1WJJ A;  5ELO A;  4RHR A;  2K05 A;  1YHB A;  4EQ5 A;  3CCV A;  3TP7 A;  4HSP A;  3H09 A;  1PZK D;  3JAM L;  1D5X C;  1A2U A;  3HS0 C;  5KEE A;  3BZC A;  5GAD C;  3KBG A;  4DR1 L;  4LF4 L;  3QO2 A;  4JPB W;  3S9W A;  4LFA L;  5C5M A;  3A8K E;  5TSS A;  1YEZ A;  2O5J C;  3UDG A;  2F03 A;  1W2B A;  4C3H H;  4IUU A;  3OHX C;  1II3 A;  1PTO H;  1I4H A;  4QIW E;  4S3S A;  4JBJ A;  3WDN A;  1KQS A;  5GQO A;  3HOV G;  3W5O A;  2E76 C;  5HY6 A;  4J15 A;  2LSS A;  5C3E B;  2QA4 A;  4IUN A;  3MA2 B;  2I46 A;  2RCN A;  1XXG A;  2JE6 I;  4LF6 L;  2EQS A;  1GUT A;  2EPB A;  1XWE A;  4PMC A;  1RF2 D;  5AJ3 Q;  1EUJ A;  5K5P A;  1G8Z D;  3EA6 A;  2IX3 A;  2Z9H A;  2JA6 G;  4RGT A;  1LAB A;  3PF5 A;  3S2H H;  4N8X 1;  1EQR A;  2SEB D;  3VR4 A;  2Z6K C;  4Y7N B;  3EFX D;  2NVY H;  1FNV A;  2KHS A;  2MO1 A;  3BVZ A;  2ZT9 C;  2CWP A;  1LT6 D;  3F2D A;  4L8J A;  4LF5 L;  2WII B;  1YBY A;  4NXM L;  3HOZ G;  4ZUJ A;  4A76 A;  1J5E Q;  1FR3 A;  3M4Y A;  1STH A;  3GTJ H;  3OOC A;  1G91 A;  3HOY H;  3WOF A;  2B2W C;  3S1Q B;  1YIJ A;  3OPO A;  4L5Q A;  2XWJ B;  1QOH A;  3K58 A;  2B2T C;  4A3K B;  1KXL A;  4BXX G;  3GTO B;  4A3F B;  4FXG C;  3VYR A;  1JQY D;  1EYC A;  1BOS A;  2NWG A;  2UUB L;  2R92 H;  4B3T L;  4JI4 L;  3I8Z A;  4OO1 I;  2L15 A;  4YHH L;  1T9H A;  1U0L A;  2X69 A;  4OIJ A;  2EVB A;  3FDT A;  2LXK A;  1Q46 A;  4PQX A;  3RMH A;  4X3T A;  4YY3 Q;  1HFG A;  1I4G A;  3FRP B;  3GTP H;  4DV6 Q;  4A3E B;  3S1N H;  1KRS A;  4X66 L;  3NTI A;  3S1M B;  1CK1 A;  2MFI A;  1CHQ D;  3CQZ H;  3DXJ C;  1AZP A;  3P1H A;  1EY8 A;  5FOB B;  4JV5 L;  1D7Q A;  2ZTC A;  3NBI A;  1TT2 A;  3HP3 A;  3CC7 A;  3CCU A;  1CKN B;  3X3M A;  4DN4 M;  2F0S A;  1N33 Q;  2V4D A;  3O13 A;  5C4J B;  1E2Z A;  2F0D A;  2Y0S G;  4Z9C B;  3T1Y Q;  2B63 B;  2PPB C;  1GOZ A;  2LKV A;  2NN6 G;  2CW0 C;  3T16 A;  1BBW A;  2KUM A;  3CCJ A;  4BBR H;  3SK6 A;  5ELE A;  3HKZ G;  2BH2 A;  3CCL A;  1X56 A;  1EY7 A;  1GUW A;  1CA6 A;  4G7H C;  3GTL B;  1QNU A;  3TP5 A;  2VS1 A;  4JI1 Q;  3RN5 A;  1Y69 U;  3CP0 A;  1TU2 B;  4AYB B;  4X65 L;  1AE3 A;  1LO5 D;  4C1N K;  5D14 A;  1E1T A;  3OTO Q;  4B3S Q;  4PG3 A;  2EYF A;  4DV1 L;  1ILQ A;  1IL8 A;  1Y1W B;  1KLG D;  4GNX A;  1XNR Q;  2RDF A;  5ELC A;  1SSO A;  2CH4 W;  3NUC A;  4O2D A;  1GVP A;  1M1K C;  3F2C A;  2R7Z B;  3J7A 5;  1D2B A;  4QQB X;  4P74 A;  1JOQ A;  1J8I A;  3BZK A;  3J7A V;  1S5F D;  1V9P A;  5CV7 A;  3CCM A;  5IT9 E;  1PZI D;  2BE5 C;  2Z4H A;  4JVZ A;  1YJW A;  2EXZ A;  3G6E A;  4XQJ A;  2VQF L;  1F2L A;  1HTP A;  3OW2 A;  3M85 A;  4XQQ A;  4BA1 I;  4DR2 L;  2A6E C;  1K8M A;  3X3N A;  3FKI H;  3ND8 A;  3CXC A;  3M4O H;  1FL0 A;  5HGT A;  1VQL A;  1LTR D;  1LTS D;  3DEO A;  4NDX A;  5FLX E;  1VQH A;  3I70 A;  3J81 j;  3RNU A;  1LT3 D;  1HNW L;  4C3H B;  4I65 A;  1BQQ T;  1SXT A;  3G48 A;  3J80 E;  1PTO B;  1JOO A;  1STY A;  2K7V A;  4JBK A;  2AMC B;  3I4O A;  1VF5 C;  1EIY B;  2B2V C;  3S14 H;  3CAM A;  2UXB Q;  2BDO A;  1HA6 A;  3U4Z A;  4NW2 A;  5JEA J;  2BH8 A;  4A3D G;  4IFD J;  1CFM A;  4KTA A;  2F0V A;  3OSO A;  5BR8 Q;  3KF6 B;  2C5C A;  2RF4 A;  2EY1 A;  3S2H B;  2JP1 A;  3VA7 A;  1VQP A;  4U67 3;  2K5Q A;  3QWN A;  1HNZ Q;  1EEI D;  2Z8L A;  5KNB A;  1EY5 A;  1TWC H;  2P5Z X;  5IT9 L;  3S2D B;  2SDF A;  4HJ5 A;  4WJ4 A;  3DLL A;  1QIL A;  3MAQ A;  4ZRZ A;  4LUO A;  3A5U A;  3Q23 A;  3MXP A;  4JI8 L;  1HUN A;  5LMU L;  1H9M A;  3D4R A;  1G2T A;  4IZ8 A;  2J4X A;  1ZXT A;  4LFB Q;  1KDB A;  4JYA Q;  3ERO A;  3GTJ B;  3J81 E;  3BJU A;  2I5M X;  4QL5 A;  1VQO A;  3WWV A;  1SND A;  1EOT A;  3C1F A;  4KJO A;  2Z6B A;  2MJ8 A;  5FLX L;  1MSH A;  3V05 A;  3DWQ A;  1S40 A;  3J80 L;  3KK7 A;  2A1A A;  3E6Z X;  2SOB A;  2R92 B;  4RWS C;  1QUQ A;  1DON A;  4KK7 A;  4XIG S;  4JC0 A;  4MN3 A;  3BG3 A;  2E75 C;  3HOV H;  2EYM A;  3U50 C;  1N36 Q;  1YNN C;  4PMB A;  1SAP A;  3NQT A;  3H3V C;  1WFQ A;  1B4O A;  2F4V L;  1XNQ Q;  3J80 i;  3RR5 A;  4XYQ A;  5GAE C;  2F0K A;  3S1N B;  1OTC A;  3PUW A;  5C6A A;  1KNE A;  3ER0 A;  2F0N A;  3CQZ B;  3RZD H;  4KLK A;  1WTP A;  4UP8 A;  2ZTD A;  3T51 B;  2JA6 H;  1JJG A;  2TMP A;  3K0Y A;  2OQK A;  3TZU A;  3E3X A;  2IY5 B;  2ZJR A;  4JI2 Q;  1VQC A;  2MPM A;  5BN5 A;  1I50 H;  4DR5 Q;  3IAY A;  1V43 A;  1PXU A;  3GTQ H;  4KI0 A;  4NMZ A;  4IPD A;  3R2I A;  1ZKO A;  1CTM A;  1A0I A;  3A5Z B;  3J81 L;  1VQ9 A;  5M3F B;  3HOZ H;  3U9S A;  1B70 B;  2K32 A;  2C9O A;  4BBR B;  2HHH Q;  2NB0 A;  4C3I G;  4K5V A;  1D5M C;  5C5L A;  4QGU A;  1GJX A;  5IYC G;  4DV2 Q;  2F3I A;  5J3B A;  3S15 H;  1P16 A;  1V1P B;  1TKW B;  3J81 i;  3PUX A;  4BXX H;  1E24 A;  3K0X A;  3PUZ A;  2F0P A;  5JJI A;  3ULJ A;  3C2P A;  3GTG H;  5IWA Q;  2XRS D;  2D0P A;  2X6G A;  1FJG L;  3HOU B;  1M4V A;  1DM0 B;  4DV5 L;  3PO3 G;  2F0Q A;  1S5E D;  3LGJ A;  4H13 C;  3L7Z C;  5FO7 B;  1Q8K A;  4YWM A;  4R4Q A;  4DXG A;  4HCE A;  3ONA B;  1MJE A;  1CT1 D;  2EE1 A;  4DUY Q;  1SFO B;  4LNQ A;  5C4X G;  3KYH C;  5EJW A;  4FP5 D;  3V96 A;  1XTD A;  2IPK D;  4DR4 L;  3PIP A;  1N32 Q;  1JT8 A;  3RD4 A;  5M5X H;  1LT4 D;  2PQA A;  4RA8 A;  1GUO A;  1DOL A;  4BY1 G;  1ONL A;  1IBM Q;  3S16 B;  2GN5 A;  5C44 G;  2F0T A;  2NTT A;  2UXC Q;  1N9W A;  2NVT B;  4LF9 L;  2F0E A;  4CDD C;  4QUC A;  5NUC A;  4JK1 C;  2NN6 H;  1KDC A;  1QJO A;  2G9H D;  3K80 C;  3FKI B;  1Y1V G;  2JSO A;  5JEA G;  2E5L L;  3M4O B;  4KY7 A;  1YJ9 A;  4IFD G;  4I7A A;  4ILW A;  5BN4 A;  5HUR A;  2H5X A;  3PV0 A;  3A8I E;  1Q1E A;  4O42 A;  4IUR A;  2ICI A;  1J9O A;  1IBK Q;  1B3Q A;  1P8L A;  3KF6 A;  1E22 A;  2VQE Q;  4V19 0;  3TS2 A;  1I4P A;  4E6I A;  1PLF A;  3OWF A;  1X3G A;  3GDE A;  1AEX A;  4BBS G;  2PMZ B;  1IBL L;  3EIV A;  1W3S A;  1Q82 C;  4KHP L;  4WOR A;  4UHV A;  1PRT F;  1U4M A;  1SYE A;  1DJR D;  4EGV A;  2CKZ B;  1CA5 A;  4FF3 A;  2Q8I B;  4ALP A;  5D3I B;  2RDG A;  5LMN L;  4OO1 G;  4GLX A;  2SNM A;  2EIF A;  2OQ0 A;  4HED A;  1T5X D;  3K5O A;  4O1N A;  4RH6 A;  4IPC A;  4BY7 G;  3M4Q A;  3ND9 A;  3I2Z A;  4CJ1 B;  4MHE A;  1C9O A;  1A2T A;  2HQL A;  4ME5 A;  4KKT A;  5FLM G;  1A62 A;  1Y8O B;  2KEN A;  1R4P B;  2L5T A;  1EYD A;  1D6E C;  3LNN A;  3M3Y H;  2KBN A;  5IYB H;  2RHS B;  2L0C A;  3ULL A;  5CMD A;  2VZA A;  1WVL A;  4A3B G;  3IKJ A;  1I4X A;  1RCV D;  3HOV B;  4OEM B;  2PNR C;  3VR3 A;  4Q5V A;  1G29 1;  1JJ2 A;  3R93 A;  5C0X I;  1PZJ D;  2FMC A;  4A3D H;  1D8L A;  1L0X B;  1BCP F;  4N9P A;  2F0W A;  2XIW A;  2JEA I;  1L0Y B;  3EVQ A;  1QVF A;  3RZD B;  3KLS A;  3VR2 A;  3EJI A;  3AB9 A;  2YTV A;  2JA6 B;  4M1U B;  1HPC A;  4WFN 3;  1IW7 D;  5I2Y A;  4WRD A;  2L4N A;  5EKK A;  1I50 B;  3HFZ B;  2RBM A;  4KJN A;  2MGS A;  3GTQ B;  1NY4 A;  3Q24 A;  1MJC A;  1X3P A;  4KHZ A;  4PZ8 A;  4XXE A;  3IFD A;  2UXD L;  4GN4 B;  3FVQ A;  4QMG A;  5JJL A;  3HOZ B;  1X3E A;  3AEV A;  5JVH 3;  4DR1 Q;  4LF4 Q;  1S72 A;  1B53 A;  4APV A;  4LFA Q;  3HKS A;  3OIQ A;  1WCM G;  5JJK A;  3T56 B;  2JA7 G;  2HUG A;  2KCC A;  1A63 A;  3S15 B;  4DU9 A;  5J1Z A;  1HTL D;  1S5D D;  1DGS A;  4F87 A;  1RIP A;  1A3V A;  2UUA L;  2A68 D;  3GTG B;  4FXK C;  4DUZ L;  5KIX A;  2PI2 A;  3A55 A;  4L5R C;  2AQ1 B;  3E0J A;  1LAC A;  3GTK H;  4POF A;  4LF6 Q;  1JC7 A;  4GNX B;  4GOP B;  4LF7 L;  5EPK A;  3VDY A;  3TRZ A;  1OXV A;  1NTG A;  3GP7 A;  4DR6 L;  3I56 A;  1HA5 A;  4OGQ C;  1B9N A;  2WAQ E;  2XNA C;  4HIO A;  2CHB D;  1QWY A;  3OMC A;  3OWE B;  4DR3 L;  1O80 A;  4G4K A;  2O5I C;  1EFW A;  3ICE A;  4YCU A;  1K0R A;  5M5X B;  3QOL A;  2NVQ H;  1HRJ A;  4GKK L;  1FD7 D;  4GN5 A;  4ZQ3 A;  1AFP A;  2E2J H;  4TKO B;  4LF5 Q;  1U4R A;  3P7J A;  1PH5 A;  1BXT A;  1Q90 A;  2RVL A;  3MFG A;  4LFC Q;  1WTV A;  4NXM Q;  2Y0S B;  5IYD G;  1WTH A;  1EU4 A;  2KA7 A;  4MZ9 A;  4ZLT F;  1XPU A;  3TQY A;  1SYC A;  4GNX C;  1QZG A;  2Z1C A;  4GOP C;  5M5W B;  4PZ7 A;  1HCZ A;  1YHQ A;  3S1R B;  1PFB A;  3Q0A A;  1KL9 A;  1X3Q A;  1XMQ L;  1CHP D;  4C3I H;  2L9H A;  3AFQ A;  5D65 A;  3H3V I;  1F9S A;  5IGC A;  2F0F A;  2E2H H;  4GS3 A;  5E1F A;  2AUJ D;  4DK3 C;  2UUB Q;  5IYC H;  4B3T Q;  1AW7 A;  2OXP A;  3I73 A;  4JI4 Q;  4OL7 A;  3H91 A;  4YHH Q;  3LWE A;  1C48 A;  1X9N A;  1B9M A;  3OMG A;  2NZH A;  4WJ3 M;  4UP9 A;  1F9P A;  2QW7 A;  3K57 A;  1HZB A;  1Z47 A;  3JAM c;  3JC6 6;  3PO3 H;  2QEJ C;  5CBA E;  2PQE A;  4X66 Q;  2DY7 A;  4G57 A;  2WP8 J;  4A3J G;  4A3M B;  1O7L A;  3I4M G;  2C35 B;  1EY0 A;  5F2D A;  4MTK A;  3BDO A;  1FGU A;  4JV5 Q;  5C4X H;  1TVX A;  2O2L D;  2O4X A;  3D4W A;  2AWN A;  5FJ8 G;  1EU3 A;  1SRU A;  5ELN A;  2F4I A;  1ICF B;  5I4D A;  3ZJY C;  4OXP A;  5JOB A;  4ULL A;  2LXJ A;  5KRU A;  2AHO B;  4BY1 H;  3K5L A;  1YNX A;  1GM5 A;  1CSQ A;  1I6V C;  1X6O A;  2FXQ A;  2I5L X;  2JEB I;  2SNS A;  2VB2 X;  5C44 H;  2EY2 A;  1QCB D;  1UNS A;  3CCQ A;  1JOK A;  2F0L A;  3SK8 A;  1K73 C;  4DR7 L;  1TR5 A;  2K5D A;  2H4O A;  1SYD A;  1VQ5 A;  2EJM A;  1Y8N B;  4P73 A;  1Y1V H;  1ZEQ X;  5JEA H;  4TSS A;  4CDE C;  2A19 A;  2KOL A;  3M3Y B;  4IFD H;  4LUZ A;  4KMU C;  1VF7 A;  5C3X A;  5DNF A;  4X62 L;  1QUQ B;  3EBE A;  4R9W A;  2BA0 A;  4X65 Q;  2PW5 A;  3MEH A;  1E1O A;  4DV1 Q;  4J6H A;  1AZQ A;  2G9D A;  4RGO S;  4DV3 L;  3NEL A;  2F1M A;  2Q2I A;  4G7Z C;  4A3D B;  3SHL A;  5IE8 A;  2L55 A;  2N49 A;  5LHY 1;  1SBB B;  1PRT D;  1UAP A;  3BYT B;  4IAL A;  2F0O A;  4FVM A;  1E0B A;  4A3I G;  1RD9 D;  1ESF A;  1PH6 A;  4BBS H;  1FYC A;  2ES2 A;  1A15 A;  5DM6 3;  5E3F A;  5ELF A;  4WJW A;  1KD1 C;  3CC4 A;  1O7Y A;  5FO8 B;  2JQO A;  3AYH B;  3AU7 A;  3CW2 C;  3D8G A;  2AQ2 B;  1NMF A;  4HJ7 A;  4OO1 H;  4DAY A;  2VQF Q;  2OF1 A;  4DK1 A;  2YU9 H;  4EVO A;  1SYB A;  1CQV A;  3CC2 A;  2J0T D;  1STA A;  1TWG H;  2RKS A;  1EYG A;  4BY7 H;  4NP5 A;  5E4X A;  1H9R A;  4F88 A;  2NYZ D;  5FLM H;  3MEF A;  2M9V A;  2QGQ A;  2MO0 A;  4IOC A;  1HNW Q;  5C3E G;  1XMO L;  4H0L C;  3K8A A;  4GOP A;  4IPH A;  2BOS A;  1YNJ C;  4OHJ A;  1BCP D;  1B1Z A;  2QF7 A;  4A3B H;  3NEN A;  3STB C;  3CRL C;  3GTK B;  1EY6 A;  1QNK A;  2WFW A;  1JR0 D;  1H95 A;  1PFN A;  2K50 A;  3NTH A;  4IQZ A;  3LX0 A;  2B3G A;  4QF4 A;  2ZM6 L;  1R9T H;  1TQO A;  3H0G G;  1F2Y A;  1YVC A;  4HID A;  1SMY D;  3QR8 A;  3QJY A;  3CD6 A;  3CKI B;  2NVQ B;  1FGB D;  2E2J B;  2PQA B;  1EZ8 A;  1ZYR D;  1GO3 E;  1MIU A;  4JI8 Q;  5LMU Q;  1TXY A;  3KLR A;  2KEC A;  5IYB G;  5E7N A;  1KAW A;  3MC0 B;  4A3F G;  5EBC A;  2FHT A;  3FHW A;  3FEW X;  1D5Z C;  4ODG A;  1TS5 A;  5H1S E;  5IGF A;  4R8N A;  2F3W A;  1UE6 A;  4C3I B;  2K1B A;  1HZA A;  1WCM H;  2JA5 G;  2E2H B;  2UUC Q;  1TY0 A;  2JA7 H;  1PYW D;  2L1B A;  2WKD A;  3U9O A;  4B9X A;  1WYD A;  3S17 H;  5CV6 A;  1VQ8 A;  4JI6 L;  4JI3 L;  1DYQ A;  4CKE A;  3IFT A;  4DKA C;  1K3B C;  3CPW A;  1BNZ A;  1EIG A;  2EYO A;  2F4V Q;  3PO3 B;  1MGS A;  3PIO A;  4QCL A;  3H15 A;  1K83 H;  2NVY B;  3NBH A;  1PTO C;  2K5V A;  1D1I A;  5IOC A;  2WB1 E;  2R7F A;  1BKB A;  1Y8P B;  2N3S A;  2K4K A;  2ATW A;  3UDI A;  3NP8 A;  4LMQ D;  4GZY C;  1TS3 A;  2R7D A;  5C4X B;  1TWF H;  3KJO A;  3K81 C;  4H7B A;  3HOY B;  3PO2 G;  1AE2 A;  2KEE A;  1NMG A;  1HR0 L;  3CPF A;  4BY1 B;  1K0S A;  3L0O A;  1SJE D;  4K2L A;  4KD3 A;  2NZ1 D;  4A4I A;  3VR5 A;  4HCS A;  4ZKC B;  1GUS A;  5C44 B;  2I07 B;  4O0A A;  1I94 L;  1F2Z A;  4RCO A;  2Q2U A;  4OX9 Q;  5IYD H;  3A56 A;  2DY8 A;  4FF2 A;  1K28 A;  4MNO A;  4Q0F A;  1LTI D;  1E7Z A;  2MP1 A;  3GV6 A;  1Y1V B;  1BR9 A;  3FMC A;  3PMF A;  3UDX A;  2Q2T A;  1PA6 A;  5KNC A;  1JWU D;  3PIO 3;  1NE3 A;  3GTP B;  3MTS A;  1NR4 A;  4LUV A;  5IT9 c;  1HZ9 A;  3VYT A;  1I6H H;  4HMJ A;  1MD2 D;  4LK1 C;  2WIN B;  4YIJ A;  4IUV A;  4X3U A;  1FJG Q;  4DV5 Q;  1STG A;  4RGN A;  1TS4 A;  3CMA A;  3NQI A;  3C46 A;  1V1Q A;  3MHB A;  2F0J A;  4G7O C;  2ZXO A;  2QKI C;  4V0B A;  1N34 L;  1IZ6 A;  5IGB A;  2HCC A;  2A69 D;  1FNW A;  4X6A H;  3EQL C;  3A74 A;  5BN3 A;  3VA5 A;  1HH2 P;  1LYL A;  5K36 G;  5FLX c;  4A3J H;  5IY0 A;  4DR4 Q;  3I4M H;  1WD1 A;  5I6Y A;  3J80 c;  5GAG C;  1C4Q A;  2K33 A;  1A3T A;  1SRO A;  3BS1 A;  1YJN A;  1O78 A;  5M5Y H;  5FJ8 H;  3Q6S A;  3ZYY X;  1PH4 A;  3R2T A;  2EDG A;  1QVG A;  4QIW B;  1IKM A;  2PNH A;  1GHK A;  4LF9 Q;  2YU9 B;  2NZO A;  2JYO A;  5E4W C;  5I6W A;  3KJP A;  1MHW C;  3K7A H;  4BY7 B;  1EQT A;  5T1G A;  4ZK9 B;  2RDH A;  4KV6 A;  4L63 B;  4CJ0 B;  2E5L Q;  4ABN A;  2R3Z A;  1UE1 A;  1IW7 C;  3K5N A;  4IJH A;  4RKL A;  4ID6 A;  1YIT A;  1AN8 A;  2IHE A;  1F9R A;  3J7Z C;  4XT1 B;  1M90 C;  2QDB A;  2K03 A;  5JPN C;  2MNA A;  2D5D A;  2R93 G;  2JK8 A;  1IYV A;  1I4Q A;  2FFK B;  5M3M G;  5L37 A;  3PQI A;  4HMI A;  3T13 A;  3PCO B;  3SR1 A;  1LTL A;  2E2D C;  4RFB A;  3HOX G;  4A3B B;  4B3R L;  3IL8 A;  2B2U A;  4KKS A;  1LUZ A;  3CCS A;  1SYG A;  4MIU A;  3J81 c;  4A93 G;  1LTT D;  1HJP A;  3NWT A;  1JMC A;  5A35 A;  1SEB D;  3B6Y A;  2LS0 1;  1LTA D;  1DOK A;  1W6J A;  2NBF A;  1Z6H A;  1IBL Q;  1S3O A;  1R9T B;  4KHP Q;  4A3I H;  2A68 C;  3OIP A;  4RKB A;  4HR7 B;  2DJG C;  1SN8 A;  4JOI A;  5LMN Q;  3T1H Q;  2Z4I A;  2UU9 L;  1D1K A;  4ME3 A;  2JXM B;  3H94 A;  3PUY A;  2CVR A;  3I3C A;  3SDZ A;  4TQU S;  3PSI A;  4BA2 I;  3J7Y W;  2VUM G;  2M2L A;  2EOT A;  2EYH A;  1JE4 A;  2PZW A;  3S14 B;  3R3O A;  1NCV A;  4DV7 L;  1WCM B;  3PGZ A;  1IHZ A;  2JA7 B;  2F0I A;  3E0E A;  2WAQ G;  3PIP 3;  3TEH B;  2K6A A;  3D0F A;  3A7L A;  1IXR A;  3W3A A;  1S5B D;  5ISR A;  1WI5 A;  3S17 B;  5C3E H;  1WTW A;  1SNP A;  5KGU A;  1C7Y A;  4GKJ L;  4AYB E;  3KF8 A;  2R6G A;  5IP7 G;  2CQA A;  1KC8 C;  1VQ4 A;  1EFI D;  1PYS B;  1TWC B;  3M7N A;  3SE0 A;  1ENA A;  5CV8 A;  1VQJ A;  2QDL A;  1L0W A;  2JA9 A;  2B29 A;  4OWT B;  1JJC B;  2BDN A;  1VQM A;  4KD4 A;  4ZCK A;  1IL2 A;  5JAV A;  2RSN A;  1TWF B;  3DUZ A;  1LV9 A;  4JI5 L;  3H0G H;  2AQ3 B;  5M3F G;  5IGE A;  1G2S A;  5COR A;  4DV0 L;  1XPO A;  3TBI B;  5KYL A;  3CU7 A;  1B2T A;  5GRO A;  1I3Q H;  2A5H A;  3F2U A;  1IYJ B;  1O7Z A;  1UE7 A;  4K8J A;  2Z0S A;  2HIV A;  5DEH A;  4FDB A;  1SE4 A;  3G7L A;  4B3M L;  3GTO H;  4A3F H;  2QIL A;  4ZKB B;  3D6C A;  4K0K L;  4DAP A;  1JCK B;  3HOU G;  1ENF A;  2EY5 A;  1XJV A;  2JA5 H;  1I6H B;  2B39 A;  2E2I H;  3H6M A;  3QIA A;  4HTH A;  2IWH A;  4B9W A;  4DUZ Q;  2XN9 C;  1PRT B;  3TME A;  3ITP A;  3ULP A;  2OEO A;  3A0J A;  1U9R A;  2RCF A;  1Q7Y C;  3V2T A;  3HG9 A;  2ALY B;  3CF5 A;  4LF7 Q;  4QY7 A;  1EWH A;  1SNO A;  2KVM A;  4XQN A;  3T4A C;  2VY3 A;  4JW0 A;  1STE A;  3NK9 A;  3K5M A;  4DR6 Q;  3OYY A;  2NTS A;  3C1E A;  4A3J B;  3I4M B;  4DR3 Q;  3HGB A;  4X3S A;  5C4J H;  1U5K A;  5IOD A;  5EQ0 A;  2B63 H;  4GKK Q;  3L2P A;  4UPA A;  1SE3 A;  5M5Y B;  1IYU A;  2K14 A;  4OWX B;  5IIF A;  3JAM E;  1K9M C;  1NSN S;  3PO2 H;  4K5W A;  1JB3 A;  2ZTE A;  1PRT C;  1Q8I A;  1ICW A;  4DAY B;  1LT5 D;  1OXT A;  3N6R A;  3HEJ A;  4NPS A;  5CC4 A;  1K8O A;  4LF8 L;  5DM7 3;  1WTX A;  3K59 A;  1JB7 A;  4L6T B;  2N55 A;  1XMQ Q;  1B50 A;  1JE5 A;  3RUZ A;  3RZO H;  4RHS A;  4DFA A;  3KDF B;  3U58 A;  1SE2 A;  1ET6 A;  2JJQ A;  1L1O A;  1VQI A;  1BCP B;  1B44 D;  3SK4 A;  3F2B A;  3G71 A;  4OWW B;  3KFU A;  3S24 A;  1S5C D;  1FNU A;  2CQO A;  1KTK A;  3PUV A;  3BVM A;  4X64 L;  4KY5 A;  3G4S A;  4AH6 A;  1H9K A;  2PZU A;  3HRZ C;  3E9I A;  3MXG A;  1WD0 A;  4NXN L;  5EGT A;  2JA8 G;  2RA4 A;  2KQ3 A;  4K2K A;  5JVG 3;  2PW7 A;  4IO9 A;  2VB3 X;  2ZJP A;  4JI7 L;  4HIK A;  3HZX A;  4YWL A;  4CHT B;  2K04 A;  2PCF B;  5ELB A;  4A3I B;  2EXD A;  1STB A;  5K36 H;  4A3G G;  3RN2 A;  1GUN A;  1BCP C;  4JI0 L;  5COY A;  1W6K A;  3I4N G;  1LTG D;  4L5T A;  3MXN A;  2XTI A;  4P75 A;  3KLS X;  4LAA A;  2RSO A;  3HKZ B;  2F3V A;  1PV4 A;  3A54 A;  1Z9F A;  1RJT A;  2ZXR A;  4DR7 Q;  4DV4 L;  1JIC A;  1K8G A;  3NE5 B;  2ZXP A;  3JAM i;  1UEB A;  2EYJ A;  3IRB A;  1SMY C;  4GLV B;  1SNC A;  1TWA H;  1Q86 C;  1A8V A;  1ASY A;  1ZYR C;  1ESR A;  4AQY L;  4X62 Q;  4J1M A;  2R93 H;  2KCM A;  1SLJ A;  1PHJ A;  1EWI A;  3I7F A;  3DMU A;  5M3M H;  1GXD C;  3D4D A;  3FPP A;  1EYA A;  1UE5 A;  1HNX L;  4IFD I;  2HDM A;  2L11 A;  4DV3 Q;  4JCV E;  4KHV A;  3UI2 A;  1QG7 A;  3HOX H;  4IUQ A;  5LMN W;  4C3J G;  3NBH B;  4A93 H;  4C56 C;  2IX1 A;  1DCZ A;  2HT1 A;  5J22 A;  2WKC A;  4HJA A;  3S2D H;  2DN8 A;  2XVS A;  1VQB A;  2PI2 E;  3HOW G;  3H0G B;  4QJF A;  4LFC L;  4R4T A;  1EY4 A;  2JN4 A;  2X6L A;  3H3V H;  1Q3L A;  4EQP A;  2KJX A;  1I3Q B;  2L12 A;  2DNE A;  1SNQ A;  3UE0 A;  4C2M H;  2HIX A;  5AFW A;  2VNU D;  2A6H D;  1WTQ A;  4LW1 A;  2VUM H;  2DUD A;  2WB1 G;  5C0X J;  2A74 C;  4N9T A;  3E5S A;  1EZ6 A;  2F0H A;  4K6L A;  4XYO A;  1XMO Q;  5AJ3 L;  1RTN A;  1EQV A;  4PMW A;  1UEA B;  2JA5 B;  1HQM C;  3DM3 A;  2E2I B;  3BZD B;  3MVV A;  1CI3 M;  3NWS A;  4L5S A;  1E2V A;  4ZAI A;  3F1Z A;  2OWO A;  3L9A X;  3DWP A;  3NPP A;  5C4Z A;  5IP7 H;  1PMR A;  3MXU A;  2XGT A;  1Q1B A;  3NXW A;  4FF1 A;  1DD2 A;  2N88 A;  1VQ6 A;  1A3U A;  5JJZ A;  1J5E L;  2NVX H;  3A8J E;  4CBV A;  5I9O A;  2ZM6 Q;  3AMU A;  1G6Z A;  2PMZ E;  4IJL A;  3NEM A;  5C3W A;  2EJG C;  2AKW B;  4DR2 Q;  1PH2 A;  4FYD A;  1EL0 A;  1PVO A;  1SMX A;  4FXD A;  3PO2 B;  5M3F H;  2HDL A;  3BDL A;  2AWO A;  2A69 C;  1B7Y B;  3KDF A;  1F2M A;  2B2Y A;  1QB5 D;  3E9H A;  4R1J A;  5CV4 A;  3SEB A;  1ASZ A;  3FP9 A;  3D31 A;  1KRT A;  1X55 A;  2VXW A;  1NAP A;  1PYB A;  4U68 A;  4DNR B;  4QB4 A;  4YY3 L;  2GVA A;  3RZO B;  1KHI A;  4DV6 L;  1CQF A;  1PTO F;  1VQN A;  4CGY B;  4R8I A;  1F77 A;  3HOU H;  4JI6 Q;  4JI3 Q;  3GD7 A;  4HN7 A;  3VR6 A;  4P71 A;  4HJ9 A;  3VYS A;  4F7X A;  2ENB A;  5EPL A;  4A3M G;  1KLU D;  2V1C C;  1N33 L;  4IPG A;  1SFO H;  3GO5 A;  4HAE A;  3T1Y L;  1VS0 A;  4MTN A;  1NJI C;  4DK0 A;  2CWA A;  1NBW A;  3URY A;  5GAH C;  5EPJ A;  3NTK A;  2EJF C;  4TRD A;  4DGZ A;  1KIX A;  2EZV A;  1DZ1 A;  1X32 A;  4GN3 B;  3Q8D A;  5KND A;  2CCZ A;  4A3K G;  4Y52 H;  3S16 H;  1XYI A;  2NVT H;  4YWK A;  4A3L G;  3MFY A;  2Z6K A;  1HR0 Q;  1SDF A;  1VDZ A;  4I7Z C;  4B08 A;  4CJ2 C;  4R4O A;  3M7G A;  4JI1 L;  2XWB B;  1LTB D;  1J6Q A;  5EKL A;  1CZW A;  1TS2 A;  1Z7T A;  3I91 A;  1E2W A;  4K6D A;  1I94 Q;  4C1N I;  2B2U C;  4LJZ C;  3G6J B;  2YTY A;  3OTO L;  4B3S L;  4A3E G;  1U4P A;  2K5H A;  1GD7 A;  1CZG A;  1GKH A;  2R61 A;  4IUT A;  2B2W A;  4LWC A;  1TWA B;  2WV6 D;  3BDC A;  4XTC S;  3GQB A;  1XNR L;  1ET9 A;  4HJ8 A;  1YZ6 A;  1R4Q B;  4NB3 A;  1C0A A;  2PYK A;  5FKA C;  2B2T A;  1HUM A;  1SE8 A;  2R93 B;  3W1G A;  4PZ6 A;  5M3M B;  4JOI C;  3M9B A;  2VW9 A;  1GHJ A;  2H1E A;  3NSW A;  1BBX C;  1LM0 A;  3KF8 B;  2HCI A;  3MZ5 A;  5G3L F;  1PFM A;  2B63 G;  4X3K A;  3RLN A;  2D9U A;  3HOX B;  1N34 Q;  4K5X A;  4DNI A;  4EQO A;  1HZC A;  4A93 B;  3CME A;  3FPU B;  1EIH A;  4GLA C;  1PFS A;  2JA8 H;  4JG2 A;  5IP9 G;  1X54 A;  3TP8 A;  1UWV A;  5FK9 C;  2GA4 B;  1VQE A;  4XDX A;  2I5H A;  1BDO A;  2PZT A;  2BA1 A;  2B8F A;  5C0X G;  4A3G H;  4YCW A;  2FJ2 A;  2ID0 A;  2RHQ B;  4KN4 C;  2B8G A;  1PH9 A;  3I4N H;  5HGQ A;  4AYB G;  1RTO A;  1EOV A;  2Y0S E;  4C2M B;  4IN3 A;  3SVM A;  2F0G A;  2YV5 A;  4POG A;  2F52 A;  3CRK C;  3PF4 A;  2CFM A;  4PNY A;  1WTR A;  2UXB L;  4A75 A;  1Y1W G;  1AH9 A;  3MWY W;  3ERQ A;  1VQD A;  2VUM B;  2UUC L;  3DEP A;  3ERS X;  1VQK A;  2Q2H A;  2R7Z G;  2K52 A;  3HKZ E;  2CW0 D;  5BR8 L;  5CGK A;  4A3C G;  2FIN B;  1PH8 A;  1MSG A;  1XX8 A;  4DXF A;  2K01 A;  5ELD A;  2WAQ B;  1DXM A;  4OEL B;  3F8T A;  1V8Q A;  1CSP A;  1QZH A;  1HNZ L;  3DWA A;  3GTM H;  4K14 A;  1I5F A;  4KKU A;  3UDF A;  4B3R Q;  1CKN A;  1PH3 A;  4BBS B;  1F9Q A;  1SJH D;  2A8V A;  3I4L A;  1YI2 A;  4CKB A;  1OXS C;  4CDF C;  1JWS D;  4C3J H;  2NVX B;  1IKL A;  4LFB L;  4JYA L;  2IL8 A;  3DM1 A;  1B3A A;  1PH7 A;  2D2C C;  2OTJ A;  1NUC A;  3RLF A;  1H9S B;  1HQR D;  1EY9 A;  1TWG B;  4C3H G;  5CBE E;  1WTO A;  2UU9 Q;  3HOW H;  1N8R C;  1YNJ D;  1ML0 D;  1YHA A;  2IT1 A;  4OX9 L;  3STB D;  4DF7 A;  2AUK A;  1CUK A;  3KLW A;  2ZJQ A;  2KCT A;  2NN6 I;  1Q81 C;  5CV9 A;  1U4L A;  4RG1 A;  2K5W A;  2F0U A;  2BE5 D;  1N36 L;  5I2X A;  1CKM A;  2KHI A;  4FO2 A;  4H44 C;  3BVG A;  5M9O A;  2XSC A;  3CCE A;  4DV7 Q;  1XNQ L;  4R4C A;  1V1O A;  1TWH H;  5CYU A;  1STN A;  1Y14 B;  3LWU A;  2A73 B;  1K3R A;  3NHH A;  1S4Z A;  2G5D A;  2KED A;  1L1O B;  1VQ7 A;  1JWM D;  2LFN A;  3U4V A;  4N8F A;  2A6E D;  2DGY A;  2E8G A;  2EYL A;  4BS9 A;  4GKJ Q;  4H02 A;  5JPM C;  1O7I A;  2WAC A;  3OW7 A;  4FF4 A;  5I9P A;  4JI2 L;  3KUP A;  5D3D A;  1BUV T;  2B2V A;  4DR5 L;  1ILP A;  1KDA A;  1DOM A;  1QE6 A;  1QVC A;  1G6P A;  4TVA B;  3AQQ A;  3A7A B;  3HOY G;  3Q22 A;  1KNA A;  1C8C A;  4RMF A;  2YTX A;  3P75 A;  2K28 A;  4NKL A;  2DJF C;  2HHH L;  3C3L A;  2EY6 A;  4JI5 Q;  2NUC A;  4DA2 A;  1L1O C;  3TSS A;  2YYZ A;  3K7U C;  2R92 G;  4DV0 Q;  4DV2 L;  3DHQ A;  2N78 A;  3TS0 A;  3MXN B;  1VMP A;  1EWC A;  5M5W H;  4HSV A;  2KHJ A;  1GUG A;  5IWA L;  3S1R H;  2OTL A;  1PTO D;  4B3M Q;  2BCO A;  5C4H A;  1JOR A;  4BWG B;  2N8N A;  4K0K Q;  1LLR D;  3QB3 A;  3QG1 A;  3R8B A;  3SXH A;  1BBU A;  2CH4 A;  2MUY A;  1VMC A;  1K83 B;  5DAU A;  4DUY L;  4P72 A;  1VQF A;  1XTC D;  2TSS A;  2EYP A;  1N32 L;  5IGG A;  3SK5 A;  4Y7N H;  1OXU A;  1SNM A;  1I4R A;  2RQX A;  5FO9 B;  4DPG A;  4UAI A;  4A3M H;  4AIM A;  1HR0 W;  4PV1 C;  4F8M A;  3GV3 A;  4M8A A;  4RGM A;  5EBD A;  1IBM L;  1RL2 A;  4DAV A;  1EQQ A;  4J8Q A;  1X65 A;  2UXC L;  1RDP D;  2JA8 B;  4BBR G;  1A6X A;  5EKI A;  4OON A;  1ROD A;  2J7Z A;  1CM9 A;  3S1Q H;  3T1H L;  2UXD Q;  1YNN D;  4CKC A;  1EIF A;  1HXY D;  1ENC A;  4RAU C;  4A3G B;  1MBY A;  2OCE A;  4A3K H;  4YCV A;  3WOE A;  2IJ0 A;  4K8I A;  4P2C B;  4UY8 C;  1H9J A;  3I4N B;  4A3L H;  1IBK L;  4OIK A;  1AP0 A;  2VQE L;  4LF8 Q;  2FMM A;  3I72 A;  2LMC B;  2UUA Q;  1K8A C;  5CV5 A;  1FVI A; 
#chains in the Genus database with same CATH homology
 1PDQ A;  5LL6 X;  3CHB D;  1T5E A;  1RHP A;  1TII D;  4XT3 B;  1SYF A;  3J7A F;  1OXX K;  5G3L D;  5T1I A;  1Q12 A;  2IW3 A;  5LL6 S;  3GTM B;  5A2Q E;  3K6O A;  3KBX A;  1M8A A;  1TY2 A;  2A6H C;  2ICE C;  5J39 A;  1BF4 A;  4ZUI A;  4KY6 A;  3VYU A;  1H9S A;  2IX0 A;  3D3R A;  3D6W A;  3T53 B;  4C3J B;  2E74 C;  4KN7 C;  3TDQ A;  5IGD A;  4JBW A;  3P20 A;  3W2D A;  5CR3 A;  1BO0 A;  2DNC A;  2LY7 A;  1RKN A;  4DNT B;  1UUP A;  3N52 A;  1VCI A;  3K7A B;  3HOW B;  1V1P A;  3I90 A;  2OT2 A;  5C0X H;  2Q8T A;  1HHV A;  2F0M A;  2MHV A;  2KCN A;  1EEF D;  4QUF A;  4RCN A;  1KAA A;  4UDU C;  1KAB A;  1MI2 A;  3TP6 A;  2D62 A;  2QCP X;  4FNF A;  2XRQ D;  3QOJ A;  1TWH B;  2WB1 B;  1NR2 A;  1OO9 B;  2PO4 A;  3BYY B;  4IUP A;  3L3O C;  5KYI A;  4ZYS A;  3TN2 A;  3TZD A;  5A2Q L;  2HQE A;  2M00 A;  4EQN A;  2B2Y C;  2Q8R E;  1HFN A;  4RHR A;  2K05 A;  3TP7 A;  4HSP A;  3H09 A;  1PZK D;  3JAM L;  1D5X C;  1A2U A;  3HS0 C;  5KEE A;  3KBG A;  3QO2 A;  3S9W A;  5C5M A;  3A8K E;  5TSS A;  2O5J C;  2F03 A;  4IUU A;  3OHX C;  1II3 A;  1PTO H;  1I4H A;  4S3S A;  3WDN A;  2E76 C;  5C3E B;  4IUN A;  3MA2 B;  2I46 A;  1XXG A;  2JE6 I;  1GUT A;  2EPB A;  1XWE A;  4PMC A;  1RF2 D;  5K5P A;  1G8Z D;  3EA6 A;  2IX3 A;  4RGT A;  1LAB A;  2SEB D;  3VR4 A;  4Y7N B;  3EFX D;  1FNV A;  2KHS A;  3BVZ A;  2ZT9 C;  1LT6 D;  4L8J A;  2WII B;  4ZUJ A;  1FR3 A;  3M4Y A;  1STH A;  3OOC A;  1G91 A;  3WOF A;  2B2W C;  3S1Q B;  3OPO A;  2XWJ B;  1QOH A;  3K58 A;  2B2T C;  4A3K B;  3GTO B;  4A3F B;  4FXG C;  3VYR A;  1JQY D;  1EYC A;  1BOS A;  2NWG A;  3I8Z A;  4OO1 I;  2X69 A;  4OIJ A;  2EVB A;  3FDT A;  4PQX A;  3RMH A;  4X3T A;  1HFG A;  1I4G A;  3FRP B;  4A3E B;  3NTI A;  3S1M B;  1CK1 A;  1CHQ D;  3DXJ C;  1AZP A;  3P1H A;  1EY8 A;  5FOB B;  3NBI A;  1TT2 A;  3HP3 A;  3X3M A;  4DN4 M;  2F0S A;  2V4D A;  3O13 A;  5C4J B;  1E2Z A;  2F0D A;  4Z9C B;  2B63 B;  2PPB C;  1GOZ A;  2LKV A;  2NN6 G;  2CW0 C;  3T16 A;  2KUM A;  3SK6 A;  5ELE A;  1EY7 A;  1GUW A;  1CA6 A;  4G7H C;  3GTL B;  1QNU A;  3TP5 A;  1Y69 U;  1TU2 B;  4AYB B;  1LO5 D;  4C1N K;  5D14 A;  2EYF A;  1ILQ A;  1IL8 A;  1Y1W B;  1KLG D;  2RDF A;  5ELC A;  1SSO A;  3NUC A;  2R7Z B;  1D2B A;  1JOQ A;  3J7A V;  1S5F D;  5CV7 A;  5IT9 E;  1PZI D;  2BE5 C;  2Z4H A;  2EXZ A;  4XQJ A;  1F2L A;  1HTP A;  3M85 A;  4XQQ A;  4BA1 I;  2A6E C;  1K8M A;  3X3N A;  3ND8 A;  5HGT A;  1LTR D;  1LTS D;  3DEO A;  4NDX A;  5FLX E;  3I70 A;  1LT3 D;  4C3H B;  4I65 A;  1SXT A;  1BQQ T;  3J80 E;  1PTO B;  1JOO A;  1STY A;  2K7V A;  1VF5 C;  2B2V C;  2BDO A;  1HA6 A;  4NW2 A;  5JEA J;  4IFD J;  1CFM A;  4KTA A;  2F0V A;  3OSO A;  2C5C A;  2EY1 A;  3S2H B;  2JP1 A;  3VA7 A;  4U67 3;  2K5Q A;  3QWN A;  1EEI D;  2Z8L A;  5KNB A;  1EY5 A;  5IT9 L;  3S2D B;  2SDF A;  1QIL A;  3MAQ A;  4ZRZ A;  3Q23 A;  3MXP A;  1HUN A;  1H9M A;  3D4R A;  1G2T A;  4IZ8 A;  2J4X A;  1ZXT A;  1KDB A;  3ERO A;  3GTJ B;  3J81 E;  1SND A;  1EOT A;  3C1F A;  4KJO A;  2MJ8 A;  5FLX L;  1MSH A;  3V05 A;  3DWQ A;  3J80 L;  3KK7 A;  3E6Z X;  2SOB A;  2R92 B;  4RWS C;  1DON A;  4KK7 A;  4XIG S;  4MN3 A;  3BG3 A;  2E75 C;  2EYM A;  1YNN C;  4PMB A;  1SAP A;  3NQT A;  3H3V C;  1B4O A;  4XYQ A;  2F0K A;  3S1N B;  3PUW A;  5C6A A;  1KNE A;  2F0N A;  3CQZ B;  1WTP A;  3T51 B;  2TMP A;  3K0Y A;  3TZU A;  2MPM A;  5BN5 A;  3IAY A;  1V43 A;  1PXU A;  4KI0 A;  4NMZ A;  3R2I A;  1ZKO A;  1CTM A;  3J81 L;  5M3F B;  3U9S A;  2K32 A;  2C9O A;  4BBR B;  2NB0 A;  4C3I G;  4K5V A;  1D5M C;  5C5L A;  1GJX A;  1V1P B;  1TKW B;  3PUX A;  3PUZ A;  2F0P A;  3C2P A;  2XRS D;  2X6G A;  3HOU B;  1M4V A;  1DM0 B;  2F0Q A;  1S5E D;  4H13 C;  3L7Z C;  5FO7 B;  4DXG A;  4HCE A;  3ONA B;  1CT1 D;  2EE1 A;  1SFO B;  5EJW A;  3V96 A;  4FP5 D;  2IPK D;  3RD4 A;  1LT4 D;  4RA8 A;  1GUO A;  1DOL A;  1ONL A;  3S16 B;  2F0T A;  2NTT A;  2NVT B;  2F0E A;  4QUC A;  5NUC A;  4JK1 C;  2NN6 H;  1KDC A;  1QJO A;  2G9H D;  3FKI B;  2JSO A;  5JEA G;  3M4O B;  4KY7 A;  4IFD G;  4ILW A;  5BN4 A;  5HUR A;  3PV0 A;  3A8I E;  1Q1E A;  4O42 A;  4IUR A;  2ICI A;  1J9O A;  4V19 0;  1I4P A;  4E6I A;  1PLF A;  3OWF A;  1AEX A;  2PMZ B;  4WOR A;  1PRT F;  1U4M A;  1SYE A;  1DJR D;  4EGV A;  1CA5 A;  4FF3 A;  2Q8I B;  5D3I B;  2RDG A;  4OO1 G;  2SNM A;  4HED A;  1T5X D;  3K5O A;  4O1N A;  4RH6 A;  3ND9 A;  4CJ1 B;  4MHE A;  1A2T A;  4ME5 A;  4KKT A;  1Y8O B;  1R4P B;  2L5T A;  1EYD A;  1D6E C;  3LNN A;  2L0C A;  5CMD A;  1WVL A;  3IKJ A;  1I4X A;  1RCV D;  3HOV B;  2PNR C;  3VR3 A;  4Q5V A;  1G29 1;  3R93 A;  5C0X I;  1PZJ D;  2FMC A;  1L0X B;  1BCP F;  4N9P A;  2F0W A;  2XIW A;  2JEA I;  1L0Y B;  3EVQ A;  3RZD B;  3KLS A;  3VR2 A;  3EJI A;  3AB9 A;  2JA6 B;  4M1U B;  1HPC A;  4WFN 3;  1IW7 D;  5I2Y A;  4WRD A;  2L4N A;  5EKK A;  1I50 B;  2RBM A;  4KJN A;  2MGS A;  3GTQ B;  3Q24 A;  1X3P A;  4KHZ A;  4XXE A;  3IFD A;  3FVQ A;  4QMG A;  3HOZ B;  5JVH 3;  1B53 A;  3OIQ A;  3T56 B;  2HUG A;  2KCC A;  3S15 B;  4DU9 A;  5J1Z A;  1HTL D;  1S5D D;  4F87 A;  1A3V A;  2A68 D;  3GTG B;  4FXK C;  5KIX A;  3A55 A;  2AQ1 B;  3E0J A;  1LAC A;  1JC7 A;  5EPK A;  1OXV A;  3GP7 A;  1HA5 A;  4OGQ C;  1B9N A;  2XNA C;  2CHB D;  1QWY A;  3OMC A;  3OWE B;  1O80 A;  4G4K A;  2O5I C;  5M5X B;  3QOL A;  1HRJ A;  1FD7 D;  4ZQ3 A;  1AFP A;  4TKO B;  1U4R A;  3P7J A;  1BXT A;  1Q90 A;  2RVL A;  3MFG A;  1WTV A;  2Y0S B;  1EU4 A;  2KA7 A;  4ZLT F;  1SYC A;  2Z1C A;  5M5W B;  1HCZ A;  3S1R B;  1PFB A;  3Q0A A;  1X3Q A;  1CHP D;  2L9H A;  5D65 A;  1F9S A;  5IGC A;  2F0F A;  5E1F A;  2AUJ D;  1AW7 A;  2OXP A;  3I73 A;  4OL7 A;  3H91 A;  3LWE A;  1C48 A;  1B9M A;  3OMG A;  1F9P A;  3K57 A;  1Z47 A;  2QEJ C;  5CBA E;  2PQE A;  2DY7 A;  4G57 A;  2WP8 J;  4A3M B;  1O7L A;  1EY0 A;  5F2D A;  3BDO A;  1TVX A;  2O2L D;  2O4X A;  3D4W A;  2AWN A;  1EU3 A;  2F4I A;  5I4D A;  5JOB A;  4ULL A;  5KRU A;  3K5L A;  1I6V C;  2JEB I;  2SNS A;  2VB2 X;  2EY2 A;  1QCB D;  1UNS A;  1JOK A;  2F0L A;  3SK8 A;  1TR5 A;  2K5D A;  2H4O A;  1SYD A;  2EJM A;  1Y8N B;  1ZEQ X;  5JEA H;  4TSS A;  2KOL A;  3M3Y B;  4IFD H;  4KMU C;  1VF7 A;  5C3X A;  5DNF A;  4R9W A;  2BA0 A;  2PW5 A;  3MEH A;  4J6H A;  1AZQ A;  2G9D A;  4RGO S;  2F1M A;  4G7Z C;  4A3D B;  3SHL A;  2L55 A;  5LHY 1;  1SBB B;  1PRT D;  1UAP A;  3BYT B;  4IAL A;  2F0O A;  4FVM A;  1E0B A;  1RD9 D;  1ESF A;  1FYC A;  1A15 A;  5DM6 3;  5E3F A;  5ELF A;  4WJW A;  1O7Y A;  5FO8 B;  3AU7 A;  3D8G A;  2AQ2 B;  4OO1 H;  4DAY A;  2OF1 A;  4DK1 A;  4EVO A;  1SYB A;  1CQV A;  2J0T D;  1STA A;  2RKS A;  4NP5 A;  5E4X A;  1H9R A;  4F88 A;  2NYZ D;  2M9V A;  4H0L C;  2BOS A;  1YNJ C;  4OHJ A;  1BCP D;  1B1Z A;  2QF7 A;  3CRL C;  3GTK B;  1EY6 A;  1QNK A;  1JR0 D;  1PFN A;  3NTH A;  4IQZ A;  3LX0 A;  4QF4 A;  1TQO A;  1F2Y A;  1SMY D;  3QJY A;  3CKI B;  2NVQ B;  1FGB D;  2E2J B;  1EZ8 A;  1ZYR D;  3KLR A;  2KEC A;  3MC0 B;  5EBC A;  2FHT A;  3FEW X;  1D5Z C;  4ODG A;  1TS5 A;  5IGF A;  4R8N A;  2F3W A;  4C3I B;  2K1B A;  2E2H B;  1TY0 A;  1PYW D;  2L1B A;  2WKD A;  3U9O A;  4B9X A;  5CV6 A;  1DYQ A;  4CKE A;  3IFT A;  1BNZ A;  1EIG A;  2EYO A;  3PO3 B;  1MGS A;  4QCL A;  2NVY B;  3NBH A;  1PTO C;  1D1I A;  5IOC A;  1Y8P B;  3NP8 A;  4LMQ D;  4GZY C;  1TS3 A;  5C4X B;  4H7B A;  3HOY B;  2KEE A;  4BY1 B;  1SJE D;  4K2L A;  4KD3 A;  2NZ1 D;  3VR5 A;  4HCS A;  4ZKC B;  1GUS A;  5C44 B;  2I07 B;  1F2Z A;  4RCO A;  3A56 A;  2DY8 A;  4FF2 A;  4Q0F A;  1LTI D;  2MP1 A;  3GV6 A;  1Y1V B;  1BR9 A;  3FMC A;  3PMF A;  5KNC A;  1JWU D;  3PIO 3;  3GTP B;  3MTS A;  1NR4 A;  3VYT A;  4HMJ A;  1MD2 D;  4LK1 C;  2WIN B;  4YIJ A;  4IUV A;  4X3U A;  1STG A;  4RGN A;  1TS4 A;  3C46 A;  3NQI A;  3MHB A;  2F0J A;  4G7O C;  2ZXO A;  2QKI C;  4V0B A;  5IGB A;  2HCC A;  2A69 D;  1FNW A;  3EQL C;  5BN3 A;  3VA5 A;  5K36 G;  1WD1 A;  5I6Y A;  1C4Q A;  2K33 A;  1A3T A;  3BS1 A;  1O78 A;  3Q6S A;  3ZYY X;  3R2T A;  2EDG A;  4QIW B;  1IKM A;  1GHK A;  2YU9 B;  2JYO A;  5E4W C;  5I6W A;  4BY7 B;  1EQT A;  5T1G A;  4ZK9 B;  2RDH A;  4KV6 A;  4L63 B;  4CJ0 B;  4ABN A;  2R3Z A;  1IW7 C;  3K5N A;  4RKL A;  4ID6 A;  1AN8 A;  1F9R A;  4XT1 B;  1J8I A;  2QDB A;  2K03 A;  5JPN C;  2D5D A;  1IYV A;  1I4Q A;  2FFK B;  4HMI A;  3T13 A;  3SR1 A;  2E2D C;  4RFB A;  4A3B B;  3IL8 A;  2B2U A;  4KKS A;  1SYG A;  4MIU A;  1LTT D;  3NWT A;  5A35 A;  1SEB D;  2LS0 1;  1LTA D;  1DOK A;  1W6J A;  2NBF A;  1Z6H A;  1R9T B;  2A68 C;  3OIP A;  4RKB A;  4HR7 B;  2Z4I A;  1D1K A;  2JXM B;  3H94 A;  3PUY A;  2CVR A;  3I3C A;  3SDZ A;  4TQU S;  4BA2 I;  3J7Y W;  2M2L A;  2EOT A;  2EYH A;  1JE4 A;  2PZW A;  3S14 B;  3R3O A;  1NCV A;  1WCM B;  1IHZ A;  2JA7 B;  2F0I A;  3PIP 3;  2K6A A;  3A7L A;  3W3A A;  1S5B D;  5ISR A;  3S17 B;  1WTW A;  1SNP A;  5KGU A;  3KF8 A;  2R6G A;  2CQA A;  1EFI D;  1TWC B;  3M7N A;  3SE0 A;  1ENA A;  5CV8 A;  2BDN A;  4KD4 A;  5JAV A;  2RSN A;  1TWF B;  3DUZ A;  1LV9 A;  2AQ3 B;  5IGE A;  1G2S A;  5COR A;  3TBI B;  5KYL A;  3CU7 A;  1B2T A;  2A5H A;  3F2U A;  1O7Z A;  4K8J A;  5DEH A;  1SE4 A;  3G7L A;  2QIL A;  4ZKB B;  3D6C A;  4DAP A;  1JCK B;  1ENF A;  2EY5 A;  1I6H B;  2B39 A;  3H6M A;  3QIA A;  4HTH A;  2IWH A;  4B9W A;  2XN9 C;  1PRT B;  3TME A;  3ITP A;  2OEO A;  1U9R A;  3V2T A;  3HG9 A;  1EWH A;  1SNO A;  2KVM A;  4XQN A;  3T4A C;  1STE A;  3NK9 A;  3K5M A;  2NTS A;  3C1E A;  4A3J B;  3I4M B;  3HGB A;  4X3S A;  5IOD A;  5EQ0 A;  1SE3 A;  5M5Y B;  1IYU A;  5IIF A;  3JAM E;  1NSN S;  4K5W A;  1JB3 A;  1PRT C;  1Q8I A;  1ICW A;  1LT5 D;  1OXT A;  3N6R A;  3HEJ A;  5CC4 A;  1K8O A;  5DM7 3;  1WTX A;  3K59 A;  4L6T B;  2N55 A;  1B50 A;  3RUZ A;  4RHS A;  4DFA A;  1SE2 A;  1ET6 A;  1BCP B;  1B44 D;  3SK4 A;  1S5C D;  1FNU A;  1KTK A;  3PUV A;  3BVM A;  4KY5 A;  1H9K A;  2PZU A;  3HRZ C;  3MXG A;  1WD0 A;  5EGT A;  2RA4 A;  2KQ3 A;  4K2K A;  5JVG 3;  2PW7 A;  2VB3 X;  3HZX A;  4CHT B;  2K04 A;  2PCF B;  5ELB A;  4A3I B;  1STB A;  5K36 H;  1GUN A;  1BCP C;  5COY A;  1W6K A;  1LTG D;  3MXN A;  3KLS X;  4LAA A;  2RSO A;  3HKZ B;  2F3V A;  3A54 A;  1RJT A;  2ZXR A;  1JIC A;  3NE5 B;  2ZXP A;  2EYJ A;  1SMY C;  1SNC A;  1ZYR C;  1ESR A;  4J1M A;  3DMU A;  1GXD C;  3D4D A;  3FPP A;  1EYA A;  4IFD I;  2HDM A;  2L11 A;  4KHV A;  3UI2 A;  1QG7 A;  4IUQ A;  4C3J G;  4C56 C;  2IX1 A;  1DCZ A;  5J22 A;  2WKC A;  2DN8 A;  2XVS A;  3H0G B;  1EY4 A;  2X6L A;  1Q3L A;  4EQP A;  2KJX A;  1I3Q B;  2L12 A;  2DNE A;  1SNQ A;  5AFW A;  2VNU D;  2A6H D;  1WTQ A;  5C0X J;  2A74 C;  4N9T A;  3E5S A;  1EZ6 A;  2F0H A;  4K6L A;  4XYO A;  1RTN A;  1EQV A;  4PMW A;  1UEA B;  2JA5 B;  1HQM C;  2E2I B;  3BZD B;  3MVV A;  1CI3 M;  3NWS A;  1E2V A;  4ZAI A;  3L9A X;  3DWP A;  3NPP A;  5C4Z A;  1PMR A;  3MXU A;  1Q1B A;  3NXW A;  4FF1 A;  1DD2 A;  2N88 A;  1A3U A;  5JJZ A;  3A8J E;  4CBV A;  5I9O A;  3AMU A;  1G6Z A;  5C3W A;  2EJG C;  4FYD A;  1EL0 A;  4FXD A;  3PO2 B;  2HDL A;  3BDL A;  2AWO A;  2A69 C;  1F2M A;  2B2Y A;  1QB5 D;  5CV4 A;  3SEB A;  3D31 A;  2VXW A;  1NAP A;  4U68 A;  4DNR B;  4QB4 A;  3RZO B;  1CQF A;  1PTO F;  4CGY B;  4R8I A;  1F77 A;  3GD7 A;  4HN7 A;  3VR6 A;  3VYS A;  4F7X A;  2ENB A;  5EPL A;  1KLU D;  3GO5 A;  4HAE A;  4DK0 A;  3URY A;  5EPJ A;  3NTK A;  2EJF C;  4TRD A;  4DGZ A;  2EZV A;  1DZ1 A;  1X32 A;  5KND A;  1XYI A;  3MFY A;  1SDF A;  1VDZ A;  4I7Z C;  4B08 A;  4CJ2 C;  3M7G A;  2XWB B;  1LTB D;  5EKL A;  1CZW A;  1TS2 A;  1Z7T A;  3I91 A;  1E2W A;  4K6D A;  4C1N I;  2B2U C;  4LJZ C;  3G6J B;  1U4P A;  1CZG A;  2R61 A;  4IUT A;  2B2W A;  1TWA B;  2WV6 D;  3BDC A;  4XTC S;  3GQB A;  1ET9 A;  1R4Q B;  2PYK A;  5FKA C;  2B2T A;  1HUM A;  2R93 B;  5M3M B;  1GHJ A;  2H1E A;  3NSW A;  1BBX C;  2HCI A;  3MZ5 A;  5G3L F;  1PFM A;  4X3K A;  2D9U A;  3HOX B;  4K5X A;  4EQO A;  4A93 B;  1EIH A;  3FPU B;  3TP8 A;  5FK9 C;  2GA4 B;  4XDX A;  1BDO A;  2PZT A;  2BA1 A;  2B8F A;  5C0X G;  2FJ2 A;  2ID0 A;  4KN4 C;  2B8G A;  1RTO A;  4C2M B;  4IN3 A;  3SVM A;  2F0G A;  3CRK C;  4PNY A;  1WTR A;  3MWY W;  3ERQ A;  2VUM B;  3DEP A;  2CW0 D;  5CGK A;  2FIN B;  1MSG A;  1XX8 A;  4DXF A;  2K01 A;  5ELD A;  2WAQ B;  1DXM A;  1V8Q A;  3DWA A;  4K14 A;  4KKU A;  4BBS B;  1F9Q A;  1SJH D;  3I4L A;  4CKB A;  1OXS C;  1JWS D;  2NVX B;  1IKL A;  2IL8 A;  3DM1 A;  1B3A A;  2D2C C;  1NUC A;  3RLF A;  1H9S B;  1HQR D;  1EY9 A;  1TWG B;  4C3H G;  5CBE E;  1WTO A;  1YNJ D;  1ML0 D;  2IT1 A;  4DF7 A;  2AUK A;  2NN6 I;  5CV9 A;  1U4L A;  2K5W A;  2F0U A;  2BE5 D;  5I2X A;  4FO2 A;  4H44 C;  3BVG A;  5M9O A;  2XSC A;  1V1O A;  5CYU A;  1STN A;  2A73 B;  3LWU A;  1S4Z A;  3NHH A;  2KED A;  1JWM D;  2LFN A;  2A6E D;  2EYL A;  4BS9 A;  5JPM C;  2WAC A;  3OW7 A;  4FF4 A;  5I9P A;  3KUP A;  5D3D A;  1BUV T;  2B2V A;  1ILP A;  1KDA A;  1DOM A;  1QE6 A;  3A7A B;  3Q22 A;  1KNA A;  1C8C A;  3P75 A;  2K28 A;  4NKL A;  3C3L A;  2EY6 A;  2NUC A;  4DA2 A;  3TSS A;  2YYZ A;  3DHQ A;  1VMP A;  1EWC A;  4HSV A;  1GUG A;  1PTO D;  2BCO A;  5C4H A;  1JOR A;  4BWG B;  1LLR D;  3QB3 A;  3QG1 A;  3R8B A;  3SXH A;  2MUY A;  1VMC A;  1K83 B;  5DAU A;  1XTC D;  2TSS A;  2EYP A;  5IGG A;  3SK5 A;  1OXU A;  1SNM A;  1I4R A;  2RQX A;  5FO9 B;  4UAI A;  4PV1 C;  4F8M A;  3GV3 A;  4M8A A;  4RGM A;  5EBD A;  4DAV A;  4J8Q A;  1RDP D;  2JA8 B;  1A6X A;  5EKI A;  1ROD A;  2J7Z A;  1CM9 A;  1YNN D;  4CKC A;  1HXY D;  1ENC A;  4RAU C;  4A3G B;  1MBY A;  3WOE A;  2IJ0 A;  4K8I A;  4P2C B;  1H9J A;  3I4N B;  4OIK A;  1AP0 A;  2FMM A;  3I72 A;  2LMC B;  5CV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...