3SKKA

Crystal structure of human arginase i in complex with the inhibitor fabh, resolution 1.70 a, twinned structure
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
314
structure length
314
Chain Sequence
b'RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Binding of alpha,alpha-Disubstituted Amino Acids to Arginase Suggests New Avenues for Inhibitor Design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 119
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 3skkA00
4IU0A 4MXRA 1WOHA 1ZPEA 5CEVA 4RHJA 2CEVA 5HJ9A 1WOGA 3SJTA 1WVBA 4HZEA 1TBLA 4Q3RA 3GMZA 3THHA 1P8SA 4ITYA 4I06A 4IXUA 3E9BA 2PHOA 4GWDA 3TF3A 1GQ6A 5HJAA 4GSZA 4RHQA 3E6VA 4CEVA 4GWCA 1GQ7A 1HQ5A 2ZAVA 4Q3QA 3MFWA 4IE2A 3LP7A 4Q3PA 1HQHA 1T5FA 4DZ4A 1D3VA 1T4SA 4Q3SA 1CEVA 4IE1A 4Q3UA 4HXQA 1T5GA 3E8ZA 3THEA 1P8PA 3M1RA 3THJA 1TBHA 1ZPGA 2A0MA 4Q42A 3E6KA 4IU1A 2AEBA 1HQFA 1XFKA 4RHKA 4Q3TA 4MYLA 1T4RA 2EIVA 1T4TA 1RLAA 3MMRA 1PQ3A 3NIQA 3MJLA 4FCKA 2PHAA 3MFVA 1P8NA 2EF5A 4Q3RC 5RLAA 1P8OA 3LHLA 4Q3VA 4IE3A 1P8RA 1TBJA 4MYFA 3CEVA 3DJ8A 3F80A 4IU5A 3GN0A 3KV2A 4MYNA 4RHLA 1P8QA 3NIPA 4FCIA 3E8QA 3TH7A 4RLAA 3RLAA 4Q41A 4HWWA 1HQGA 4GSMA 4G3HA 3LP4A 2RLAA 1T4PA 3NIOA 3SL1A 1P8MA 3PZLA 1HQXA 1WVAA 2EF4A 4GSVA 4IU4A 4Q40A 4RHIA 3SL0A 3SKKA 1TA1A 4IXVA 2PLLA 4MYKA 4RHMA 1WOIA 1R1OA
chains in the Genus database with same CATH superfamily
4IU0A 4QA2A 3C0ZA 4MXRA 4QA6A 3F06A 4QA5A 4BZ6A 5EFGA 5THSA 5D1BA 1WOHA 1ZPEA 3C0YA 5G0XA 5BWZA 5EEMA 4RHJA 2CEVA 5CEVA 4QA3A 1VKGA 3MZ4A 5HJ9A 5ICNB 1WOGA 3SJTA 1WVBA 3MZ6A 5DC5A 2VCGA 1TBLA 4HZEA 4Q3RA 5THVA 3GMZA 4ZUPA 5EFBD 3THHA 4BKXB 4ZUOA 4QA1A 1P8SA 1C3SA 4ITYA 4ZUQA 4I06A 3SFFA 5FCWA 4IXUA 3E9BA 2PHOA 4GWDA 3F07A 4BZ9A 5EFHA 5IWGA 3TF3A 1GQ6A 4RN2A 1C3PA 5HJAA 2VQVA 4A69A 1T69A 4GSZA 4RHQA 3E6VA 5G11A 4CEVA 5G0HA 1ZZ1A 3ZNSA 4GWCA 2V5WA 4BZ7A 1GQ7A 1HQ5A 3EWFA 2ZAVA 5THTA 5G17A 2VQQA 1C3RA 3MFWA 4Q3QA 4IE2A 3LP7A 1T67A 5G0IA 4Q3PA 3MAXA 1HQHA 1T5FA 3Q9EA 4CQFA 1D3VA 4DZ4A 1T4SA 5FUEA 3EZTA 4Q3SA 5G0YA 1CEVA 3EW8A 4IE1A 5G0GA 4Q3UA 4HXQA 2GH6A 1T5GA 3E8ZA 4RN1A 5G3WA 1P8PA 3THEA 5G0JA 2VQOA 3M1RA 2VQJA 3THJA 1TBHA 1ZPGA 2A0MA 4Q42A 4QA7A 3E6KA 5EF7A 5G10A 4IU1A 2AEBA 1HQFA 1XFKA 4RHKA 4Q3TA 4MYLA 1T4RA 2VQWG 3Q9CA 2EIVA 4CBTA 1T4TA 1RLAA 3MMRA 1T64A 5EFNA 1PQ3A 4ZUMA 3MENA 3NIQA 5JI5A 3MJLA 3Q9FA 4FCKA 2PHAA 5EEIA 3MFVA 1P8NA 1ZZ3A 4QA4A 5EEKA 2EF5A 4Q3RC 3RQDA 2VQMA 5EENA 4ZURA 5G12A 3SFHA 3EZPA 5RLAA 3Q9BA 5DC7A 1P8OA 4BZ5A 3LHLA 4Q3VA 4IE3A 3F0RA 5G1CA 4LY1A 5LI3A 5EEFA 1P8RA 1TBJA 2V5XA 4MYFA 1ZZ0A 4CBYA 5D1DA 3CEVA 3DJ8A 3F80A 4IU5A 3MZ3A 3GN0A 3KV2A 4MYNA 4RHLA 4RN0A 4BZ8A 1P8QA 3NIPA 4FCIA 3E8QA 3TH7A 4RLAA 3RLAA 4Q41A 4HWWA 1HQGA 4GSMA 4G3HA 3C10A 5DC6A 5EFJD 3LP4A 5IX0A 2RLAA 1T4PA 1W22A 3NIOA 3SL1A 5THUA 1P8MA 5D1CA 3PZLA 4ZUNA 1HQXA 1WVAA 5EF8A 2EF4A 4GSVA 4IU4A 4LXZA 4QA0A 4Q40A 5EFKB 5A2SA 5DC8A 4RHIA 3SL0A 5G1AA 3ZNRA 5G1BA 3MZ7A 5G13A 3SKKA 1TA1A 4IXVA 2PLLA 4MYKA 4RHMA 1WOIA 1R1OA
chains in the Genus database with same CATH topology
4IU0A 4MXRA 1WOHA 1ZPEA 5CEVA 4RHJA 2CEVA 5HJ9A 1WOGA 3SJTA 1WVBA 4HZEA 1TBLA 4Q3RA 3GMZA 3THHA 1P8SA 4ITYA 4I06A 4IXUA 3E9BA 2PHOA 4GWDA 3TF3A 1GQ6A 5HJAA 4GSZA 4RHQA 3E6VA 4CEVA 4GWCA 1GQ7A 1HQ5A 2ZAVA 4Q3QA 3MFWA 4IE2A 3LP7A 4Q3PA 1HQHA 1T5FA 4DZ4A 1D3VA 1T4SA 4Q3SA 1CEVA 4IE1A 4Q3UA 4HXQA 1T5GA 3E8ZA 3THEA 1P8PA 3M1RA 3THJA 1TBHA 1ZPGA 2A0MA 4Q42A 3E6KA 4IU1A 2AEBA 1HQFA 1XFKA 4RHKA 4Q3TA 4MYLA 1T4RA 2EIVA 1T4TA 1RLAA 3MMRA 1PQ3A 3NIQA 3MJLA 4FCKA 2PHAA 3MFVA 1P8NA 2EF5A 4Q3RC 5RLAA 1P8OA 3LHLA 4Q3VA 4IE3A 1P8RA 1TBJA 4MYFA 3CEVA 3DJ8A 3F80A 4IU5A 3GN0A 3KV2A 4MYNA 4RHLA 1P8QA 3NIPA 4FCIA 3E8QA 3TH7A 4RLAA 3RLAA 4Q41A 4HWWA 1HQGA 4GSMA 4G3HA 3LP4A 2RLAA 1T4PA 3NIOA 3SL1A 1P8MA 3PZLA 1HQXA 1WVAA 2EF4A 4GSVA 4IU4A 4Q40A 4RHIA 3SL0A 3SKKA 1TA1A 4IXVA 2PLLA 4MYKA 4RHMA 1WOIA 1R1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IU0 A;  4MXR A;  1WOH A;  1ZPE A;  5CEV A;  4RHJ A;  2CEV A;  5HJ9 A;  1WOG A;  3SJT A;  1WVB A;  4HZE A;  1TBL A;  4Q3R A;  3GMZ A;  3THH A;  1P8S A;  4ITY A;  4I06 A;  4IXU A;  3E9B A;  2PHO A;  4GWD A;  3TF3 A;  1GQ6 A;  5HJA A;  4GSZ A;  4RHQ A;  3E6V A;  4CEV A;  4GWC A;  1GQ7 A;  1HQ5 A;  2ZAV A;  4Q3Q A;  3MFW A;  4IE2 A;  3LP7 A;  4Q3P A;  1HQH A;  1T5F A;  4DZ4 A;  1D3V A;  1T4S A;  4Q3S A;  1CEV A;  4IE1 A;  4Q3U A;  4HXQ A;  1T5G A;  3E8Z A;  3THE A;  1P8P A;  3M1R A;  3THJ A;  1TBH A;  1ZPG A;  2A0M A;  4Q42 A;  3E6K A;  4IU1 A;  2AEB A;  1HQF A;  1XFK A;  4RHK A;  4Q3T A;  4MYL A;  1T4R A;  2EIV A;  1T4T A;  1RLA A;  3MMR A;  1PQ3 A;  3NIQ A;  3MJL A;  4FCK A;  2PHA A;  3MFV A;  1P8N A;  2EF5 A;  4Q3R C;  5RLA A;  1P8O A;  3LHL A;  4Q3V A;  4IE3 A;  1P8R A;  1TBJ A;  4MYF A;  3CEV A;  3DJ8 A;  3F80 A;  4IU5 A;  3GN0 A;  3KV2 A;  4MYN A;  4RHL A;  1P8Q A;  3NIP A;  4FCI A;  3E8Q A;  3TH7 A;  4RLA A;  3RLA A;  4Q41 A;  4HWW A;  1HQG A;  4GSM A;  4G3H A;  3LP4 A;  2RLA A;  1T4P A;  3NIO A;  3SL1 A;  1P8M A;  3PZL A;  1HQX A;  1WVA A;  2EF4 A;  4GSV A;  4IU4 A;  4Q40 A;  4RHI A;  3SL0 A;  3SKK A;  1TA1 A;  4IXV A;  2PLL A;  4MYK A;  4RHM A;  1WOI A;  1R1O A; 
#chains in the Genus database with same CATH topology
 4IU0 A;  4QA2 A;  3C0Z A;  4MXR A;  4QA6 A;  3F06 A;  4QA5 A;  4BZ6 A;  5EFG A;  5THS A;  5D1B A;  1WOH A;  1ZPE A;  3C0Y A;  5G0X A;  5BWZ A;  5EEM A;  4RHJ A;  2CEV A;  5CEV A;  4QA3 A;  1VKG A;  3MZ4 A;  5HJ9 A;  5ICN B;  1WOG A;  3SJT A;  1WVB A;  3MZ6 A;  5DC5 A;  2VCG A;  1TBL A;  4HZE A;  4Q3R A;  5THV A;  3GMZ A;  4ZUP A;  5EFB D;  3THH A;  4BKX B;  4ZUO A;  4QA1 A;  1P8S A;  1C3S A;  4ITY A;  4ZUQ A;  4I06 A;  3SFF A;  5FCW A;  4IXU A;  3E9B A;  2PHO A;  4GWD A;  3F07 A;  4BZ9 A;  5EFH A;  5IWG A;  3TF3 A;  1GQ6 A;  4RN2 A;  1C3P A;  5HJA A;  2VQV A;  4A69 A;  1T69 A;  4GSZ A;  4RHQ A;  3E6V A;  5G11 A;  4CEV A;  5G0H A;  1ZZ1 A;  3ZNS A;  4GWC A;  2V5W A;  4BZ7 A;  1GQ7 A;  1HQ5 A;  3EWF A;  2ZAV A;  5THT A;  5G17 A;  2VQQ A;  1C3R A;  3MFW A;  4Q3Q A;  4IE2 A;  3LP7 A;  1T67 A;  5G0I A;  4Q3P A;  3MAX A;  1HQH A;  1T5F A;  3Q9E A;  4CQF A;  1D3V A;  4DZ4 A;  1T4S A;  5FUE A;  3EZT A;  4Q3S A;  5G0Y A;  1CEV A;  3EW8 A;  4IE1 A;  5G0G A;  4Q3U A;  4HXQ A;  2GH6 A;  1T5G A;  3E8Z A;  4RN1 A;  5G3W A;  1P8P A;  3THE A;  5G0J A;  2VQO A;  3M1R A;  2VQJ A;  3THJ A;  1TBH A;  1ZPG A;  2A0M A;  4Q42 A;  4QA7 A;  3E6K A;  5EF7 A;  5G10 A;  4IU1 A;  2AEB A;  1HQF A;  1XFK A;  4RHK A;  4Q3T A;  4MYL A;  1T4R A;  2VQW G;  3Q9C A;  2EIV A;  4CBT A;  1T4T A;  1RLA A;  3MMR A;  1T64 A;  5EFN A;  1PQ3 A;  4ZUM A;  3MEN A;  3NIQ A;  5JI5 A;  3MJL A;  3Q9F A;  4FCK A;  2PHA A;  5EEI A;  3MFV A;  1P8N A;  1ZZ3 A;  4QA4 A;  5EEK A;  2EF5 A;  4Q3R C;  3RQD A;  2VQM A;  5EEN A;  4ZUR A;  5G12 A;  3SFH A;  3EZP A;  5RLA A;  3Q9B A;  5DC7 A;  1P8O A;  4BZ5 A;  3LHL A;  4Q3V A;  4IE3 A;  3F0R A;  5G1C A;  4LY1 A;  5LI3 A;  5EEF A;  1P8R A;  1TBJ A;  2V5X A;  4MYF A;  1ZZ0 A;  4CBY A;  5D1D A;  3CEV A;  3DJ8 A;  3F80 A;  4IU5 A;  3MZ3 A;  3GN0 A;  3KV2 A;  4MYN A;  4RHL A;  4RN0 A;  4BZ8 A;  1P8Q A;  3NIP A;  4FCI A;  3E8Q A;  3TH7 A;  4RLA A;  3RLA A;  4Q41 A;  4HWW A;  1HQG A;  4GSM A;  4G3H A;  3C10 A;  5DC6 A;  5EFJ D;  3LP4 A;  5IX0 A;  2RLA A;  1T4P A;  1W22 A;  3NIO A;  3SL1 A;  5THU A;  1P8M A;  5D1C A;  3PZL A;  4ZUN A;  1HQX A;  1WVA A;  5EF8 A;  2EF4 A;  4GSV A;  4IU4 A;  4LXZ A;  4QA0 A;  4Q40 A;  5EFK B;  5A2S A;  5DC8 A;  4RHI A;  3SL0 A;  5G1A A;  3ZNR A;  5G1B A;  3MZ7 A;  5G13 A;  3SKK A;  1TA1 A;  4IXV A;  2PLL A;  4MYK A;  4RHM A;  1WOI A;  1R1O A; 
#chains in the Genus database with same CATH homology
 4IU0 A;  4MXR A;  1WOH A;  1ZPE A;  5CEV A;  4RHJ A;  2CEV A;  5HJ9 A;  1WOG A;  3SJT A;  1WVB A;  4HZE A;  1TBL A;  4Q3R A;  3GMZ A;  3THH A;  1P8S A;  4ITY A;  4I06 A;  4IXU A;  3E9B A;  2PHO A;  4GWD A;  3TF3 A;  1GQ6 A;  5HJA A;  4GSZ A;  4RHQ A;  3E6V A;  4CEV A;  4GWC A;  1GQ7 A;  1HQ5 A;  2ZAV A;  4Q3Q A;  3MFW A;  4IE2 A;  3LP7 A;  4Q3P A;  1HQH A;  1T5F A;  4DZ4 A;  1D3V A;  1T4S A;  4Q3S A;  1CEV A;  4IE1 A;  4Q3U A;  4HXQ A;  1T5G A;  3E8Z A;  3THE A;  1P8P A;  3M1R A;  3THJ A;  1TBH A;  1ZPG A;  2A0M A;  4Q42 A;  3E6K A;  4IU1 A;  2AEB A;  1HQF A;  1XFK A;  4RHK A;  4Q3T A;  4MYL A;  1T4R A;  2EIV A;  1T4T A;  1RLA A;  3MMR A;  1PQ3 A;  3NIQ A;  3MJL A;  4FCK A;  2PHA A;  3MFV A;  1P8N A;  2EF5 A;  4Q3R C;  5RLA A;  1P8O A;  3LHL A;  4Q3V A;  4IE3 A;  1P8R A;  1TBJ A;  4MYF A;  3CEV A;  3DJ8 A;  3F80 A;  4IU5 A;  3GN0 A;  3KV2 A;  4MYN A;  4RHL A;  1P8Q A;  3NIP A;  4FCI A;  3E8Q A;  3TH7 A;  4RLA A;  3RLA A;  4Q41 A;  4HWW A;  1HQG A;  4GSM A;  4G3H A;  3LP4 A;  2RLA A;  1T4P A;  3NIO A;  3SL1 A;  1P8M A;  3PZL A;  1HQX A;  1WVA A;  2EF4 A;  4GSV A;  4IU4 A;  4Q40 A;  4RHI A;  3SL0 A;  3SKK A;  1TA1 A;  4IXV A;  2PLL A;  4MYK A;  4RHM A;  1WOI A;  1R1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...