3SL2A

Atp forms a stable complex with the essential histidine kinase walk (yycg) domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
145
Chain Sequence
MWIQIVRFMSLIIDRFEMTKEQEFIRNLPDRDLYVEIDQDKITQVLDNIISNALKYSPEGGHVTFSIDVNEEEELLYISVKDEGIGIPKKDVEKVFDRFYRVDLGGTGLGLAIAKEMVQAHGGDIWADSIEGKGTTITFTLPYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor histidine kinase yycG
publication title ATP forms a stable complex with the essential histidine kinase WalK (YycG) domain.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 38
structure length 145
sequence length 153
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3sl2A00
5IN9A 3K99A 3R4OA 3VHAA 2QG0A 2BT0A 5D7RA 5D7CA 4WUCA 4YKWA 4L90A 2YEEA 2BREA 5CPHA 4EM7A 4CE2A 4YKYA 4BIZA 4R3AA 1OSFA 4GT8A 1I5BA 1EI1A 1ID0A 2BU7A 2BU5A 2XHTA 3HYYA 1TC6A 2YI7A 3TUHA 1MU5A 3D36A 4FCPA 4O09A 5M4PA 3A0TA 3K97A 4XE2A 2Q8HA 1BKNA 1Z5AA 3A0WA 4B6CA 4X9LA 4JASA 2XD6A 1YS3A 3VADA 1H7SA 2FXSA 1MX0A 5M4KA 2WI7A 2YGAA 2VCJA 1U2OA 4H7QA 1YT2A 1UY6A 1YT0A 4CWSA 4MB9A 3Q5KA 4I3HA 3CWVA 2WEQA 4MPCA 4ASFA 2H55A 2K5BA 4XIRA 2BU2A 3SL2A 1YESA 3T1KA 4EGKA 3BM9A 4L94A 3EKRA 3HEKA 5M4MA 3WHAA 3FT8A 4DZYA 1B3QA 1I5CA 3CGZA 4MPEA 2FWYA 4MPNA 2Q8GA 2BRCA 4URMA 2YEAA 2YEHA 4NH9A 3INWA 2XDSA 2VCIA 5M4EA 1UYHA 2BU6A 4XKOA 2YE9A 3H4LA 1THNA 1UYDA 3EHFA 3B24A 4CWNA 1GKXA 4CWFA 1QZRA 4GEEA 4EEHA 3CRLA 1UYEA 3GIGA 3T0ZA 5J6AA 3TZ4A 2CCSA 2IORA 1TH8A 2ZDXA 3B25A 2HKJA 1AJ6A 3G7EA 4KTNA 1UY9A 4Q20A 4LWIA 3OPDA 4XC0A 3G7BA 5GGZA 4FCQA 1S16A 5CTXA 5CF0A 2YJXA 4HXWA 5F3KA 4K4OA 2YK9A 4LWEA 3QDDA 4MOTA 4O04A 1YC1A 2WI3A 2YKCA 2E0AA 2YGEA 4I5SA 4LWFA 5FNFA 4O07A 3O6OA 5L3JA 2WI2A 2YEDA 3GIGB 1ZXNA 3VHDA 4FCRA 3Q5LA 5FNCA 1YSZA 2ZKJA 4XCLA 1Y8OA 3OMUA 2BSMA 1H7UA 4R3MA 4AWQA 3INXA 3IEDA 1YETA 3MNRP 3HHUA 4XD8A 2Q8FA 3QTFA 2IOPA 1TC0A 2WEPA 3A0YA 3R4NA 3H80A 4FPPA 2XJGA 2CG9A 2YE8A 2YECA 2IWUA 2O1WA 4LWGA 4EMVA 1EA6A 2XK2A 2XCMA 4MP7A 1JM6A 4L93A 4BQGA 1PVGA 2AKPA 2YGFA 2YE3A 4HYMA 4LWHA 3LPSA 2H8MA 1GKZA 4HZ5A 4UROA 4YKQA 4AS9A 5FWKA 2QFOA 3D0BA 4MBCA 4CWQA 3R4MA 4CE1A 4BAEA 5BODA 2HG1A 2GFDA 1NHJA 2CH4A 3U2DA 4CWTA 4GQTA 4URNA 5IDJA 1KIJA 4PRXA 5D7DA 1S14A 4ASAA 2WI1A 2Q8IA 4XKKA 3BMYA 4YKXA 1BXDA 4V26A 1I59A 1UYGA 4U7NA 2BYIA 2C2AA 4YKTA 1Y4UA 4PL9A 3ZXOA 4P8OA 5IDMA 2VW5A 2YE6A 2ZDYA 2YE4A 4H81A 3NMQA 2XJJA 4JQLA 1Z59A 3C0EA 4W7TA 3GIFA 2YEIA 4FMTA 4V25A 4O0BA 2O1UA 4XITA 1AH6A 1Z5CA 2YE5A 4B7PA 4XTJA 1YSRA 4E01A 4EGIA 1TILA 4CWOA 1L0OA 2YKBA 5FNDA 3LNUA 2JJCA 3B26A 2BU8A 1UYLA 3OW6A 1ZW9A 2QF6A 2O1VA 3CGYA 2IOQA 4ASGA 3O0IA 1Y8PA 2BTZA 1R62A 3K60A 3TZ5A 4U93A 4DUHA 1UY7A 1UYMA 2IWXA 4XIPA 2XDUA 4QPKA 3T2SA 1NHIA 3FV5A 3R92A 4BQJA 1US7A 2YI5A 2YK2A 4CE3A 2Q2EB 3R91A 2YKEA 4JAVA 3HYZA 1YT1A 3RKZA 2QG2A 4XIQA 4KQVA 5C93A 1YERA 3PEJA 4JAUA 4WUBA 4H85A 1YC3A 2WI5A 4KP4A 1QYEA 1BYQA 2WI4A 3A0RA 2CCTA 2CGFA 2VWCA 1AM1A 4PU9A 2BYHA 1I58A 1AMWA 4PRVA 2XABA 1ZWHA 3GIEA 4XDMA 4ASBA 3ZXQA 3CRKA 3PEHA 4URLA 1UYFA 4HZ0A 2XJXA 1YC4A 4LPBA 3A0XA 3K98A 3B28A 2XDXA 2XDLA 3U67A 2UWDA 2YEFA 4GFNA 2XX2A 2ESAA 2YI0A 1B63A 2YKIA 2WERA 2BZ5A 4HY1A 5D6QA 5F5RA 3ZKDA 1NHHA 1TBWA 5BOCA 5M4HA 3HZ5A 1B62A 5M4NA 1AH8A 1UYCA 3OWDA 1GJVA 4P7AA 3TTZA 1KZNA 2EXLA 4HXZA 2HCHA 3VHCA 2CCUA 4O05A 2IWSA 4EFUA 2GQPA 5J71A 3JZ3A 2YEJA 3TZ0A 2YKJA 4KSHA 5D6PA 5CTWA 2WI6A 4BIUA 1TIDA 2XHRA 1U0ZA 2XHXA 4NH8A 3RLRA 4XKAA 3ZKBA 3WQ9A 2FWZA 1UYKA 2PNRA 4YKZA 1I5AA 3TZ2A 2YI6A 2YEGA 3B27A 3EHJA 1Y8NA 1Y4SA 2XX5A 4KSGA 3T10A 2FYPA 4GCZA 4NH7A 3HZ1A 3Q5JA 3RLQA 4AWPA 1ZXMA 1QY8A 1UY8A 3R4PA 2XDKA 4GGLA 4XCJA 1BGQA 2XX4A 4MP2A 3FT5A 3ZM7A 2YE7A 3EKOA 4EFTA 4ZVIA 4HY6A 4YKUA 3G75A 4AWOA 3KE6A 4R1FA 1UYIA 3EHGA 4CWPA 1A4HA 3D2RA 2YEBA 1Z5BA 3T0HA 3DGEA 4BXIA 1I5DA 4CWRA 4ZKIA 4HYPA 2YJWA 5CTUA 5CTYA 3EHHA 4WUDA 2YE2A 3RLPA 4L91A 4QPJA 4LP0A 3A0ZA 3C11A 4E02A 3O2FA 4KFGA 4YKRA 4U7OA 4EGHA 2JKIA 3OWBA 4L8ZA 4E00A 2ZBKB 3U2KA
chains in the Genus database with same CATH superfamily
5IN9A 3K99A 3R4OA 3VHAA 2QG0A 2BT0A 5D7RA 5D7CA 4WUCA 4YKWA 4L90A 2YEEA 2BREA 5CPHA 4EM7A 4CE2A 4YKYA 4BIZA 4R3AA 1OSFA 4GT8A 1I5BA 1EI1A 1ID0A 2BU7A 2BU5A 2XHTA 3HYYA 1TC6A 2YI7A 3TUHA 1MU5A 3D36A 4FCPA 4O09A 5M4PA 3A0TA 3K97A 4XE2A 2Q8HA 1BKNA 1Z5AA 3A0WA 4B6CA 4X9LA 4JASA 2XD6A 1YS3A 3VADA 1H7SA 3S5TA 2FXSA 1MX0A 5M4KA 2WI7A 2YGAA 2VCJA 1U2OA 4H7QA 1YT2A 1UY6A 1YT0A 4CWSA 4MB9A 3Q5KA 4I3HA 3CWVA 2WEQA 4MPCA 4ASFA 2H55A 2K5BA 4XIRA 2BU2A 3SL2A 1YESA 3T1KA 4EGKA 3BM9A 4L94A 3EKRA 3HEKA 5M4MA 3WHAA 3FT8A 4DZYA 1B3QA 1I5CA 3CGZA 4MPEA 2FWYA 4MPNA 2Q8GA 2BRCA 4URMA 2YEAA 2YEHA 4NH9A 3INWA 2XDSA 2VCIA 5M4EA 1UYHA 2BU6A 4XKOA 2YE9A 3H4LA 1THNA 1UYDA 3EHFA 3B24A 4CWNA 1GKXA 4CWFA 1QZRA 4GEEA 4EEHA 3CRLA 1UYEA 3GIGA 3T0ZA 5J6AA 3TZ4A 2CCSA 2IORA 1TH8A 2ZDXA 3B25A 2HKJA 1AJ6A 3G7EA 4KTNA 1UY9A 4Q20A 4LWIA 3OPDA 4XC0A 3G7BA 5GGZA 4FCQA 1S16A 5CTXA 5CF0A 2YJXA 4HXWA 5F3KA 4K4OA 2YK9A 4LWEA 3QDDA 4MOTA 4O04A 1YC1A 2WI3A 2YKCA 2E0AA 2YGEA 4I5SA 4LWFA 5FNFA 4O07A 3O6OA 5L3JA 2WI2A 2YEDA 3GIGB 1ZXNA 3VHDA 4FCRA 3Q5LA 5FNCA 1YSZA 2ZKJA 4XCLA 1Y8OA 3OMUA 2BSMA 1H7UA 4R3MA 4AWQA 3INXA 3IEDA 1YETA 3MNRP 3HHUA 4XD8A 2Q8FA 3QTFA 2IOPA 1TC0A 2WEPA 3A0YA 3R4NA 3H80A 4FPPA 2XJGA 2CG9A 2YE8A 2YECA 2IWUA 2O1WA 4LWGA 4EMVA 1EA6A 2XK2A 2XCMA 4MP7A 1JM6A 4L93A 4BQGA 1PVGA 2AKPA 2YGFA 2YE3A 4HYMA 4LWHA 3LPSA 2H8MA 1GKZA 4HZ5A 4UROA 4YKQA 4AS9A 5FWKA 2QFOA 3D0BA 4MBCA 4CWQA 3R4MA 4CE1A 4BAEA 5BODA 2HG1A 2GFDA 1NHJA 2CH4A 3U2DA 4CWTA 4GQTA 4URNA 5IDJA 1KIJA 4PRXA 5D7DA 1S14A 4ASAA 2WI1A 2Q8IA 4XKKA 3BMYA 4YKXA 1BXDA 4V26A 1I59A 1UYGA 4U7NA 2BYIA 2C2AA 4YKTA 1F51A 1Y4UA 4PL9A 3ZXOA 4P8OA 5IDMA 2VW5A 2YE6A 2ZDYA 2YE4A 4H81A 3NMQA 2XJJA 4JQLA 1Z59A 3C0EA 4W7TA 3GIFA 2YEIA 4FMTA 4V25A 4O0BA 2O1UA 4XITA 1AH6A 1Z5CA 2YE5A 4B7PA 4XTJA 1YSRA 4E01A 4EGIA 1TILA 3LMMA 4CWOA 1L0OA 2YKBA 5FNDA 3LNUA 2JJCA 3B26A 2BU8A 1UYLA 3OW6A 1ZW9A 2QF6A 2O1VA 3CGYA 2IOQA 4ASGA 3O0IA 1Y8PA 2BTZA 1R62A 2C1IA 3K60A 3TZ5A 4U93A 4DUHA 1IXMA 1UY7A 1UYMA 2IWXA 4XIPA 2XDUA 4QPKA 3T2SA 1NHIA 3FV5A 3R92A 4BQJA 1US7A 2YI5A 2YK2A 4CE3A 2Q2EB 3R91A 2YKEA 4JAVA 3HYZA 1YT1A 3RKZA 2QG2A 4XIQA 4KQVA 5C93A 1YERA 3PEJA 4JAUA 4WUBA 4H85A 1YC3A 2WI5A 4KP4A 1QYEA 1BYQA 2WI4A 3A0RA 2CCTA 2CGFA 2VWCA 1AM1A 4PU9A 2BYHA 1I58A 1AMWA 4PRVA 2XABA 1ZWHA 3GIEA 4XDMA 4ASBA 3ZXQA 2FTKA 3CRKA 3PEHA 4URLA 1UYFA 4HZ0A 2XJXA 1YC4A 4LPBA 3A0XA 2HHIA 3K98A 3B28A 2XDXA 2XDLA 3U67A 2UWDA 2YEFA 4GFNA 2XX2A 2ESAA 2YI0A 1B63A 2YKIA 2WERA 2BZ5A 4HY1A 5D6QA 5F5RA 3ZKDA 1NHHA 1TBWA 5BOCA 5M4HA 3HZ5A 1B62A 5M4NA 1AH8A 1UYCA 3OWDA 1GJVA 4P7AA 3TTZA 1KZNA 2EXLA 4HXZA 2HCHA 3VHCA 2CCUA 4O05A 2IWSA 4EFUA 2GQPA 2C1GA 5J71A 3JZ3A 2YEJA 3TZ0A 2YKJA 4KSHA 5D6PA 5CTWA 2WI6A 4BIUA 1TIDA 2XHRA 1U0ZA 2XHXA 4NH8A 3RLRA 4XKAA 3ZKBA 3WQ9A 2FWZA 1UYKA 2PNRA 4YKZA 1I5AA 3TZ2A 4E72A 2YI6A 3CYGA 2YEGA 3B27A 3EHJA 1Y8NA 1Y4SA 2XX5A 4KSGA 3T10A 2FYPA 4GCZA 4NH7A 3HZ1A 3Q5JA 3RLQA 4AWPA 1ZXMA 1QY8A 1UY8A 3R4PA 2XDKA 4GGLA 4XCJA 1BGQA 2XX4A 4MP2A 3FT5A 3ZM7A 2YE7A 3EKOA 4EFTA 4ZVIA 4HY6A 4YKUA 3G75A 4AWOA 3KE6A 4R1FA 1UYIA 3EHGA 4CWPA 1A4HA 3D2RA 2YEBA 1Z5BA 3T0HA 3DGEA 4BXIA 1I5DA 4CWRA 4ZKIA 4HYPA 2YJWA 5CTUA 5CTYA 3EHHA 4WUDA 2YE2A 5JENA 3RLPA 4L91A 4QPJA 4LP0A 3A0ZA 3C11A 4E02A 3O2FA 4KFGA 4YKRA 4U7OA 4EGHA 2JKIA 3OWBA 4L8ZA 4E00A 2ZBKB 3U2KA
chains in the Genus database with same CATH topology
5IN9A 3K99A 3R4OA 3VHAA 2QG0A 2BT0A 5D7RA 5D7CA 4WUCA 4YKWA 4L90A 2YEEA 2BREA 5CPHA 4EM7A 4CE2A 4YKYA 4BIZA 4R3AA 1OSFA 4GT8A 1I5BA 1EI1A 1ID0A 2BU7A 2BU5A 2XHTA 3HYYA 1TC6A 2YI7A 3TUHA 1MU5A 3D36A 4FCPA 4O09A 5M4PA 3A0TA 3K97A 4XE2A 2Q8HA 1BKNA 1Z5AA 3A0WA 4B6CA 4X9LA 4JASA 2XD6A 1YS3A 3VADA 1H7SA 2FXSA 1MX0A 5M4KA 2WI7A 2YGAA 2VCJA 1U2OA 4H7QA 1YT2A 1UY6A 1YT0A 4CWSA 4MB9A 3Q5KA 4I3HA 3CWVA 2WEQA 4MPCA 4ASFA 2H55A 2K5BA 4XIRA 2BU2A 3SL2A 1YESA 3T1KA 4EGKA 3BM9A 4L94A 3EKRA 3HEKA 5M4MA 3WHAA 3FT8A 4DZYA 1B3QA 1I5CA 3CGZA 4MPEA 2FWYA 4MPNA 2Q8GA 2BRCA 4URMA 2YEAA 2YEHA 4NH9A 3INWA 2XDSA 2VCIA 5M4EA 1UYHA 2BU6A 4XKOA 2YE9A 3H4LA 1THNA 1UYDA 3EHFA 3B24A 4CWNA 1GKXA 4CWFA 1QZRA 4GEEA 4EEHA 3CRLA 1UYEA 3GIGA 3T0ZA 5J6AA 3TZ4A 2CCSA 2IORA 1TH8A 2ZDXA 3B25A 2HKJA 1AJ6A 3G7EA 4KTNA 1UY9A 4Q20A 4LWIA 3OPDA 4XC0A 3G7BA 5GGZA 4FCQA 1S16A 5CTXA 5CF0A 2YJXA 4HXWA 5F3KA 4K4OA 2YK9A 4LWEA 3QDDA 4MOTA 4O04A 1YC1A 2WI3A 2YKCA 2E0AA 2YGEA 4I5SA 4LWFA 5FNFA 4O07A 3O6OA 5L3JA 2WI2A 2YEDA 3GIGB 1ZXNA 3VHDA 4FCRA 3Q5LA 5FNCA 1YSZA 2ZKJA 4XCLA 1Y8OA 3OMUA 2BSMA 1H7UA 4R3MA 4AWQA 3INXA 3IEDA 1YETA 3MNRP 3HHUA 4XD8A 2Q8FA 3QTFA 2IOPA 1TC0A 2WEPA 3A0YA 3R4NA 3H80A 4FPPA 2XJGA 2CG9A 2YE8A 2YECA 2IWUA 2O1WA 4LWGA 4EMVA 1EA6A 2XK2A 2XCMA 4MP7A 1JM6A 4L93A 4BQGA 1PVGA 2AKPA 2YGFA 2YE3A 4HYMA 4LWHA 3LPSA 2H8MA 1GKZA 4HZ5A 4UROA 4YKQA 4AS9A 5FWKA 2QFOA 3D0BA 4MBCA 4CWQA 3R4MA 4CE1A 4BAEA 5BODA 2HG1A 2GFDA 1NHJA 2CH4A 3U2DA 4CWTA 4GQTA 4URNA 5IDJA 1KIJA 4PRXA 5D7DA 1S14A 4ASAA 2WI1A 2Q8IA 4XKKA 3BMYA 4YKXA 1BXDA 4V26A 1I59A 1UYGA 4U7NA 2BYIA 2C2AA 4YKTA 1Y4UA 4PL9A 3ZXOA 4P8OA 5IDMA 2VW5A 2YE6A 2ZDYA 2YE4A 4H81A 3NMQA 2XJJA 4JQLA 1Z59A 3C0EA 4W7TA 3GIFA 2YEIA 4FMTA 4V25A 4O0BA 2O1UA 4XITA 1AH6A 1Z5CA 2YE5A 4B7PA 4XTJA 1YSRA 4E01A 4EGIA 1TILA 4CWOA 1L0OA 2YKBA 5FNDA 3LNUA 2JJCA 3B26A 2BU8A 1UYLA 3OW6A 1ZW9A 2QF6A 2O1VA 3CGYA 2IOQA 4ASGA 3O0IA 1Y8PA 2BTZA 1R62A 3K60A 3TZ5A 4U93A 4DUHA 1UY7A 1UYMA 2IWXA 4XIPA 2XDUA 4QPKA 3T2SA 1NHIA 3FV5A 3R92A 4BQJA 1US7A 2YI5A 2YK2A 4CE3A 2Q2EB 3R91A 2YKEA 4JAVA 3HYZA 1YT1A 3RKZA 2QG2A 4XIQA 4KQVA 5C93A 1YERA 3PEJA 4JAUA 4WUBA 4H85A 1YC3A 2WI5A 4KP4A 1QYEA 1BYQA 2WI4A 3A0RA 2CCTA 2CGFA 2VWCA 1AM1A 4PU9A 2BYHA 1I58A 1AMWA 4PRVA 2XABA 1ZWHA 3GIEA 4XDMA 4ASBA 3ZXQA 3CRKA 3PEHA 4URLA 1UYFA 4HZ0A 2XJXA 1YC4A 4LPBA 3A0XA 3K98A 3B28A 2XDXA 2XDLA 3U67A 2UWDA 2YEFA 4GFNA 2XX2A 2ESAA 2YI0A 1B63A 2YKIA 2WERA 2BZ5A 4HY1A 5D6QA 5F5RA 3ZKDA 1NHHA 1TBWA 5BOCA 5M4HA 3HZ5A 1B62A 5M4NA 1AH8A 1UYCA 3OWDA 1GJVA 4P7AA 3TTZA 1KZNA 2EXLA 4HXZA 2HCHA 3VHCA 2CCUA 4O05A 2IWSA 4EFUA 2GQPA 5J71A 3JZ3A 2YEJA 3TZ0A 2YKJA 4KSHA 5D6PA 5CTWA 2WI6A 4BIUA 1TIDA 2XHRA 1U0ZA 2XHXA 4NH8A 3RLRA 4XKAA 3ZKBA 3WQ9A 2FWZA 1UYKA 2PNRA 4YKZA 1I5AA 3TZ2A 2YI6A 2YEGA 3B27A 3EHJA 1Y8NA 1Y4SA 2XX5A 4KSGA 3T10A 2FYPA 4GCZA 4NH7A 3HZ1A 3Q5JA 3RLQA 4AWPA 1ZXMA 1QY8A 1UY8A 3R4PA 2XDKA 4GGLA 4XCJA 1BGQA 2XX4A 4MP2A 3FT5A 3ZM7A 2YE7A 3EKOA 4EFTA 4ZVIA 4HY6A 4YKUA 3G75A 4AWOA 3KE6A 4R1FA 1UYIA 3EHGA 4CWPA 1A4HA 3D2RA 2YEBA 1Z5BA 3T0HA 3DGEA 4BXIA 1I5DA 4CWRA 4ZKIA 4HYPA 2YJWA 5CTUA 5CTYA 3EHHA 4WUDA 2YE2A 3RLPA 4L91A 4QPJA 4LP0A 3A0ZA 3C11A 4E02A 3O2FA 4KFGA 4YKRA 4U7OA 4EGHA 2JKIA 3OWBA 4L8ZA 4E00A 2ZBKB 3U2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IN9 A;  3K99 A;  3R4O A;  3VHA A;  2QG0 A;  2BT0 A;  5D7R A;  5D7C A;  4WUC A;  4YKW A;  4L90 A;  2YEE A;  2BRE A;  5CPH A;  4EM7 A;  4CE2 A;  4YKY A;  4BIZ A;  4R3A A;  1OSF A;  4GT8 A;  1I5B A;  1EI1 A;  1ID0 A;  2BU7 A;  2BU5 A;  2XHT A;  3HYY A;  1TC6 A;  2YI7 A;  3TUH A;  1MU5 A;  3D36 A;  4FCP A;  4O09 A;  5M4P A;  3A0T A;  3K97 A;  4XE2 A;  2Q8H A;  1BKN A;  1Z5A A;  3A0W A;  4B6C A;  4X9L A;  4JAS A;  2XD6 A;  1YS3 A;  3VAD A;  1H7S A;  2FXS A;  1MX0 A;  5M4K A;  2WI7 A;  2YGA A;  2VCJ A;  1U2O A;  4H7Q A;  1YT2 A;  1UY6 A;  1YT0 A;  4CWS A;  4MB9 A;  3Q5K A;  4I3H A;  3CWV A;  2WEQ A;  4MPC A;  4ASF A;  2H55 A;  2K5B A;  4XIR A;  2BU2 A;  3SL2 A;  1YES A;  3T1K A;  4EGK A;  3BM9 A;  4L94 A;  3EKR A;  3HEK A;  5M4M A;  3WHA A;  3FT8 A;  4DZY A;  1B3Q A;  1I5C A;  3CGZ A;  4MPE A;  2FWY A;  4MPN A;  2Q8G A;  2BRC A;  4URM A;  2YEA A;  2YEH A;  4NH9 A;  3INW A;  2XDS A;  2VCI A;  5M4E A;  1UYH A;  2BU6 A;  4XKO A;  2YE9 A;  3H4L A;  1THN A;  1UYD A;  3EHF A;  3B24 A;  4CWN A;  1GKX A;  4CWF A;  1QZR A;  4GEE A;  4EEH A;  3CRL A;  1UYE A;  3GIG A;  3T0Z A;  5J6A A;  3TZ4 A;  2CCS A;  2IOR A;  1TH8 A;  2ZDX A;  3B25 A;  2HKJ A;  1AJ6 A;  3G7E A;  4KTN A;  1UY9 A;  4Q20 A;  4LWI A;  3OPD A;  4XC0 A;  3G7B A;  5GGZ A;  4FCQ A;  1S16 A;  5CTX A;  5CF0 A;  2YJX A;  4HXW A;  5F3K A;  4K4O A;  2YK9 A;  4LWE A;  3QDD A;  4MOT A;  4O04 A;  1YC1 A;  2WI3 A;  2YKC A;  2E0A A;  2YGE A;  4I5S A;  4LWF A;  5FNF A;  4O07 A;  3O6O A;  5L3J A;  2WI2 A;  2YED A;  3GIG B;  1ZXN A;  3VHD A;  4FCR A;  3Q5L A;  5FNC A;  1YSZ A;  2ZKJ A;  4XCL A;  1Y8O A;  3OMU A;  2BSM A;  1H7U A;  4R3M A;  4AWQ A;  3INX A;  3IED A;  1YET A;  3MNR P;  3HHU A;  4XD8 A;  2Q8F A;  3QTF A;  2IOP A;  1TC0 A;  2WEP A;  3A0Y A;  3R4N A;  3H80 A;  4FPP A;  2XJG A;  2CG9 A;  2YE8 A;  2YEC A;  2IWU A;  2O1W A;  4LWG A;  4EMV A;  1EA6 A;  2XK2 A;  2XCM A;  4MP7 A;  1JM6 A;  4L93 A;  4BQG A;  1PVG A;  2AKP A;  2YGF A;  2YE3 A;  4HYM A;  4LWH A;  3LPS A;  2H8M A;  1GKZ A;  4HZ5 A;  4URO A;  4YKQ A;  4AS9 A;  5FWK A;  2QFO A;  3D0B A;  4MBC A;  4CWQ A;  3R4M A;  4CE1 A;  4BAE A;  5BOD A;  2HG1 A;  2GFD A;  1NHJ A;  2CH4 A;  3U2D A;  4CWT A;  4GQT A;  4URN A;  5IDJ A;  1KIJ A;  4PRX A;  5D7D A;  1S14 A;  4ASA A;  2WI1 A;  2Q8I A;  4XKK A;  3BMY A;  4YKX A;  1BXD A;  4V26 A;  1I59 A;  1UYG A;  4U7N A;  2BYI A;  2C2A A;  4YKT A;  1Y4U A;  4PL9 A;  3ZXO A;  4P8O A;  5IDM A;  2VW5 A;  2YE6 A;  2ZDY A;  2YE4 A;  4H81 A;  3NMQ A;  2XJJ A;  4JQL A;  1Z59 A;  3C0E A;  4W7T A;  3GIF A;  2YEI A;  4FMT A;  4V25 A;  4O0B A;  2O1U A;  4XIT A;  1AH6 A;  1Z5C A;  2YE5 A;  4B7P A;  4XTJ A;  1YSR A;  4E01 A;  4EGI A;  1TIL A;  4CWO A;  1L0O A;  2YKB A;  5FND A;  3LNU A;  2JJC A;  3B26 A;  2BU8 A;  1UYL A;  3OW6 A;  1ZW9 A;  2QF6 A;  2O1V A;  3CGY A;  2IOQ A;  4ASG A;  3O0I A;  1Y8P A;  2BTZ A;  1R62 A;  3K60 A;  3TZ5 A;  4U93 A;  4DUH A;  1UY7 A;  1UYM A;  2IWX A;  4XIP A;  2XDU A;  4QPK A;  3T2S A;  1NHI A;  3FV5 A;  3R92 A;  4BQJ A;  1US7 A;  2YI5 A;  2YK2 A;  4CE3 A;  2Q2E B;  3R91 A;  2YKE A;  4JAV A;  3HYZ A;  1YT1 A;  3RKZ A;  2QG2 A;  4XIQ A;  4KQV A;  5C93 A;  1YER A;  3PEJ A;  4JAU A;  4WUB A;  4H85 A;  1YC3 A;  2WI5 A;  4KP4 A;  1QYE A;  1BYQ A;  2WI4 A;  3A0R A;  2CCT A;  2CGF A;  2VWC A;  1AM1 A;  4PU9 A;  2BYH A;  1I58 A;  1AMW A;  4PRV A;  2XAB A;  1ZWH A;  3GIE A;  4XDM A;  4ASB A;  3ZXQ A;  3CRK A;  3PEH A;  4URL A;  1UYF A;  4HZ0 A;  2XJX A;  1YC4 A;  4LPB A;  3A0X A;  3K98 A;  3B28 A;  2XDX A;  2XDL A;  3U67 A;  2UWD A;  2YEF A;  4GFN A;  2XX2 A;  2ESA A;  2YI0 A;  1B63 A;  2YKI A;  2WER A;  2BZ5 A;  4HY1 A;  5D6Q A;  5F5R A;  3ZKD A;  1NHH A;  1TBW A;  5BOC A;  5M4H A;  3HZ5 A;  1B62 A;  5M4N A;  1AH8 A;  1UYC A;  3OWD A;  1GJV A;  4P7A A;  3TTZ A;  1KZN A;  2EXL A;  4HXZ A;  2HCH A;  3VHC A;  2CCU A;  4O05 A;  2IWS A;  4EFU A;  2GQP A;  5J71 A;  3JZ3 A;  2YEJ A;  3TZ0 A;  2YKJ A;  4KSH A;  5D6P A;  5CTW A;  2WI6 A;  4BIU A;  1TID A;  2XHR A;  1U0Z A;  2XHX A;  4NH8 A;  3RLR A;  4XKA A;  3ZKB A;  3WQ9 A;  2FWZ A;  1UYK A;  2PNR A;  4YKZ A;  1I5A A;  3TZ2 A;  2YI6 A;  2YEG A;  3B27 A;  3EHJ A;  1Y8N A;  1Y4S A;  2XX5 A;  4KSG A;  3T10 A;  2FYP A;  4GCZ A;  4NH7 A;  3HZ1 A;  3Q5J A;  3RLQ A;  4AWP A;  1ZXM A;  1QY8 A;  1UY8 A;  3R4P A;  2XDK A;  4GGL A;  4XCJ A;  1BGQ A;  2XX4 A;  4MP2 A;  3FT5 A;  3ZM7 A;  2YE7 A;  3EKO A;  4EFT A;  4ZVI A;  4HY6 A;  4YKU A;  3G75 A;  4AWO A;  3KE6 A;  4R1F A;  1UYI A;  3EHG A;  4CWP A;  1A4H A;  3D2R A;  2YEB A;  1Z5B A;  3T0H A;  3DGE A;  4BXI A;  1I5D A;  4CWR A;  4ZKI A;  4HYP A;  2YJW A;  5CTU A;  5CTY A;  3EHH A;  4WUD A;  2YE2 A;  3RLP A;  4L91 A;  4QPJ A;  4LP0 A;  3A0Z A;  3C11 A;  4E02 A;  3O2F A;  4KFG A;  4YKR A;  4U7O A;  4EGH A;  2JKI A;  3OWB A;  4L8Z A;  4E00 A;  2ZBK B;  3U2K A; 
#chains in the Genus database with same CATH topology
 5IN9 A;  3K99 A;  3R4O A;  3VHA A;  2QG0 A;  2BT0 A;  5D7R A;  5D7C A;  4WUC A;  4YKW A;  4L90 A;  2YEE A;  2BRE A;  5CPH A;  4EM7 A;  4CE2 A;  4YKY A;  4BIZ A;  4R3A A;  1OSF A;  4GT8 A;  1I5B A;  1EI1 A;  1ID0 A;  2BU7 A;  2BU5 A;  2XHT A;  3HYY A;  1TC6 A;  2YI7 A;  3TUH A;  1MU5 A;  3D36 A;  4FCP A;  4O09 A;  5M4P A;  3A0T A;  3K97 A;  4XE2 A;  2Q8H A;  1BKN A;  1Z5A A;  3A0W A;  4B6C A;  4X9L A;  4JAS A;  2XD6 A;  1YS3 A;  3VAD A;  1H7S A;  3S5T A;  2FXS A;  1MX0 A;  5M4K A;  2WI7 A;  2YGA A;  2VCJ A;  1U2O A;  4H7Q A;  1YT2 A;  1UY6 A;  1YT0 A;  4CWS A;  4MB9 A;  3Q5K A;  4I3H A;  3CWV A;  2WEQ A;  4MPC A;  4ASF A;  2H55 A;  2K5B A;  4XIR A;  2BU2 A;  3SL2 A;  1YES A;  3T1K A;  4EGK A;  3BM9 A;  4L94 A;  3EKR A;  3HEK A;  5M4M A;  3WHA A;  3FT8 A;  4DZY A;  1B3Q A;  1I5C A;  3CGZ A;  4MPE A;  2FWY A;  4MPN A;  2Q8G A;  2BRC A;  4URM A;  2YEA A;  2YEH A;  4NH9 A;  3INW A;  2XDS A;  2VCI A;  5M4E A;  1UYH A;  2BU6 A;  4XKO A;  2YE9 A;  3H4L A;  1THN A;  1UYD A;  3EHF A;  3B24 A;  4CWN A;  1GKX A;  4CWF A;  1QZR A;  4GEE A;  4EEH A;  3CRL A;  1UYE A;  3GIG A;  3T0Z A;  5J6A A;  3TZ4 A;  2CCS A;  2IOR A;  1TH8 A;  2ZDX A;  3B25 A;  2HKJ A;  1AJ6 A;  3G7E A;  4KTN A;  1UY9 A;  4Q20 A;  4LWI A;  3OPD A;  4XC0 A;  3G7B A;  5GGZ A;  4FCQ A;  1S16 A;  5CTX A;  5CF0 A;  2YJX A;  4HXW A;  5F3K A;  4K4O A;  2YK9 A;  4LWE A;  3QDD A;  4MOT A;  4O04 A;  1YC1 A;  2WI3 A;  2YKC A;  2E0A A;  2YGE A;  4I5S A;  4LWF A;  5FNF A;  4O07 A;  3O6O A;  5L3J A;  2WI2 A;  2YED A;  3GIG B;  1ZXN A;  3VHD A;  4FCR A;  3Q5L A;  5FNC A;  1YSZ A;  2ZKJ A;  4XCL A;  1Y8O A;  3OMU A;  2BSM A;  1H7U A;  4R3M A;  4AWQ A;  3INX A;  3IED A;  1YET A;  3MNR P;  3HHU A;  4XD8 A;  2Q8F A;  3QTF A;  2IOP A;  1TC0 A;  2WEP A;  3A0Y A;  3R4N A;  3H80 A;  4FPP A;  2XJG A;  2CG9 A;  2YE8 A;  2YEC A;  2IWU A;  2O1W A;  4LWG A;  4EMV A;  1EA6 A;  2XK2 A;  2XCM A;  4MP7 A;  1JM6 A;  4L93 A;  4BQG A;  1PVG A;  2AKP A;  2YGF A;  2YE3 A;  4HYM A;  4LWH A;  3LPS A;  2H8M A;  1GKZ A;  4HZ5 A;  4URO A;  4YKQ A;  4AS9 A;  5FWK A;  2QFO A;  3D0B A;  4MBC A;  4CWQ A;  3R4M A;  4CE1 A;  4BAE A;  5BOD A;  2HG1 A;  2GFD A;  1NHJ A;  2CH4 A;  3U2D A;  4CWT A;  4GQT A;  4URN A;  5IDJ A;  1KIJ A;  4PRX A;  5D7D A;  1S14 A;  4ASA A;  2WI1 A;  2Q8I A;  4XKK A;  3BMY A;  4YKX A;  1BXD A;  4V26 A;  1I59 A;  1UYG A;  4U7N A;  2BYI A;  2C2A A;  4YKT A;  1F51 A;  1Y4U A;  4PL9 A;  3ZXO A;  4P8O A;  5IDM A;  2VW5 A;  2YE6 A;  2ZDY A;  2YE4 A;  4H81 A;  3NMQ A;  2XJJ A;  4JQL A;  1Z59 A;  3C0E A;  4W7T A;  3GIF A;  2YEI A;  4FMT A;  4V25 A;  4O0B A;  2O1U A;  4XIT A;  1AH6 A;  1Z5C A;  2YE5 A;  4B7P A;  4XTJ A;  1YSR A;  4E01 A;  4EGI A;  1TIL A;  3LMM A;  4CWO A;  1L0O A;  2YKB A;  5FND A;  3LNU A;  2JJC A;  3B26 A;  2BU8 A;  1UYL A;  3OW6 A;  1ZW9 A;  2QF6 A;  2O1V A;  3CGY A;  2IOQ A;  4ASG A;  3O0I A;  1Y8P A;  2BTZ A;  1R62 A;  2C1I A;  3K60 A;  3TZ5 A;  4U93 A;  4DUH A;  1IXM A;  1UY7 A;  1UYM A;  2IWX A;  4XIP A;  2XDU A;  4QPK A;  3T2S A;  1NHI A;  3FV5 A;  3R92 A;  4BQJ A;  1US7 A;  2YI5 A;  2YK2 A;  4CE3 A;  2Q2E B;  3R91 A;  2YKE A;  4JAV A;  3HYZ A;  1YT1 A;  3RKZ A;  2QG2 A;  4XIQ A;  4KQV A;  5C93 A;  1YER A;  3PEJ A;  4JAU A;  4WUB A;  4H85 A;  1YC3 A;  2WI5 A;  4KP4 A;  1QYE A;  1BYQ A;  2WI4 A;  3A0R A;  2CCT A;  2CGF A;  2VWC A;  1AM1 A;  4PU9 A;  2BYH A;  1I58 A;  1AMW A;  4PRV A;  2XAB A;  1ZWH A;  3GIE A;  4XDM A;  4ASB A;  3ZXQ A;  2FTK A;  3CRK A;  3PEH A;  4URL A;  1UYF A;  4HZ0 A;  2XJX A;  1YC4 A;  4LPB A;  3A0X A;  2HHI A;  3K98 A;  3B28 A;  2XDX A;  2XDL A;  3U67 A;  2UWD A;  2YEF A;  4GFN A;  2XX2 A;  2ESA A;  2YI0 A;  1B63 A;  2YKI A;  2WER A;  2BZ5 A;  4HY1 A;  5D6Q A;  5F5R A;  3ZKD A;  1NHH A;  1TBW A;  5BOC A;  5M4H A;  3HZ5 A;  1B62 A;  5M4N A;  1AH8 A;  1UYC A;  3OWD A;  1GJV A;  4P7A A;  3TTZ A;  1KZN A;  2EXL A;  4HXZ A;  2HCH A;  3VHC A;  2CCU A;  4O05 A;  2IWS A;  4EFU A;  2GQP A;  2C1G A;  5J71 A;  3JZ3 A;  2YEJ A;  3TZ0 A;  2YKJ A;  4KSH A;  5D6P A;  5CTW A;  2WI6 A;  4BIU A;  1TID A;  2XHR A;  1U0Z A;  2XHX A;  4NH8 A;  3RLR A;  4XKA A;  3ZKB A;  3WQ9 A;  2FWZ A;  1UYK A;  2PNR A;  4YKZ A;  1I5A A;  3TZ2 A;  4E72 A;  2YI6 A;  3CYG A;  2YEG A;  3B27 A;  3EHJ A;  1Y8N A;  1Y4S A;  2XX5 A;  4KSG A;  3T10 A;  2FYP A;  4GCZ A;  4NH7 A;  3HZ1 A;  3Q5J A;  3RLQ A;  4AWP A;  1ZXM A;  1QY8 A;  1UY8 A;  3R4P A;  2XDK A;  4GGL A;  4XCJ A;  1BGQ A;  2XX4 A;  4MP2 A;  3FT5 A;  3ZM7 A;  2YE7 A;  3EKO A;  4EFT A;  4ZVI A;  4HY6 A;  4YKU A;  3G75 A;  4AWO A;  3KE6 A;  4R1F A;  1UYI A;  3EHG A;  4CWP A;  1A4H A;  3D2R A;  2YEB A;  1Z5B A;  3T0H A;  3DGE A;  4BXI A;  1I5D A;  4CWR A;  4ZKI A;  4HYP A;  2YJW A;  5CTU A;  5CTY A;  3EHH A;  4WUD A;  2YE2 A;  5JEN A;  3RLP A;  4L91 A;  4QPJ A;  4LP0 A;  3A0Z A;  3C11 A;  4E02 A;  3O2F A;  4KFG A;  4YKR A;  4U7O A;  4EGH A;  2JKI A;  3OWB A;  4L8Z A;  4E00 A;  2ZBK B;  3U2K A; 
#chains in the Genus database with same CATH homology
 5IN9 A;  3K99 A;  3R4O A;  3VHA A;  2QG0 A;  2BT0 A;  5D7R A;  5D7C A;  4WUC A;  4YKW A;  4L90 A;  2YEE A;  2BRE A;  5CPH A;  4EM7 A;  4CE2 A;  4YKY A;  4BIZ A;  4R3A A;  1OSF A;  4GT8 A;  1I5B A;  1EI1 A;  1ID0 A;  2BU7 A;  2BU5 A;  2XHT A;  3HYY A;  1TC6 A;  2YI7 A;  3TUH A;  1MU5 A;  3D36 A;  4FCP A;  4O09 A;  5M4P A;  3A0T A;  3K97 A;  4XE2 A;  2Q8H A;  1BKN A;  1Z5A A;  3A0W A;  4B6C A;  4X9L A;  4JAS A;  2XD6 A;  1YS3 A;  3VAD A;  1H7S A;  2FXS A;  1MX0 A;  5M4K A;  2WI7 A;  2YGA A;  2VCJ A;  1U2O A;  4H7Q A;  1YT2 A;  1UY6 A;  1YT0 A;  4CWS A;  4MB9 A;  3Q5K A;  4I3H A;  3CWV A;  2WEQ A;  4MPC A;  4ASF A;  2H55 A;  2K5B A;  4XIR A;  2BU2 A;  3SL2 A;  1YES A;  3T1K A;  4EGK A;  3BM9 A;  4L94 A;  3EKR A;  3HEK A;  5M4M A;  3WHA A;  3FT8 A;  4DZY A;  1B3Q A;  1I5C A;  3CGZ A;  4MPE A;  2FWY A;  4MPN A;  2Q8G A;  2BRC A;  4URM A;  2YEA A;  2YEH A;  4NH9 A;  3INW A;  2XDS A;  2VCI A;  5M4E A;  1UYH A;  2BU6 A;  4XKO A;  2YE9 A;  3H4L A;  1THN A;  1UYD A;  3EHF A;  3B24 A;  4CWN A;  1GKX A;  4CWF A;  1QZR A;  4GEE A;  4EEH A;  3CRL A;  1UYE A;  3GIG A;  3T0Z A;  5J6A A;  3TZ4 A;  2CCS A;  2IOR A;  1TH8 A;  2ZDX A;  3B25 A;  2HKJ A;  1AJ6 A;  3G7E A;  4KTN A;  1UY9 A;  4Q20 A;  4LWI A;  3OPD A;  4XC0 A;  3G7B A;  5GGZ A;  4FCQ A;  1S16 A;  5CTX A;  5CF0 A;  2YJX A;  4HXW A;  5F3K A;  4K4O A;  2YK9 A;  4LWE A;  3QDD A;  4MOT A;  4O04 A;  1YC1 A;  2WI3 A;  2YKC A;  2E0A A;  2YGE A;  4I5S A;  4LWF A;  5FNF A;  4O07 A;  3O6O A;  5L3J A;  2WI2 A;  2YED A;  3GIG B;  1ZXN A;  3VHD A;  4FCR A;  3Q5L A;  5FNC A;  1YSZ A;  2ZKJ A;  4XCL A;  1Y8O A;  3OMU A;  2BSM A;  1H7U A;  4R3M A;  4AWQ A;  3INX A;  3IED A;  1YET A;  3MNR P;  3HHU A;  4XD8 A;  2Q8F A;  3QTF A;  2IOP A;  1TC0 A;  2WEP A;  3A0Y A;  3R4N A;  3H80 A;  4FPP A;  2XJG A;  2CG9 A;  2YE8 A;  2YEC A;  2IWU A;  2O1W A;  4LWG A;  4EMV A;  1EA6 A;  2XK2 A;  2XCM A;  4MP7 A;  1JM6 A;  4L93 A;  4BQG A;  1PVG A;  2AKP A;  2YGF A;  2YE3 A;  4HYM A;  4LWH A;  3LPS A;  2H8M A;  1GKZ A;  4HZ5 A;  4URO A;  4YKQ A;  4AS9 A;  5FWK A;  2QFO A;  3D0B A;  4MBC A;  4CWQ A;  3R4M A;  4CE1 A;  4BAE A;  5BOD A;  2HG1 A;  2GFD A;  1NHJ A;  2CH4 A;  3U2D A;  4CWT A;  4GQT A;  4URN A;  5IDJ A;  1KIJ A;  4PRX A;  5D7D A;  1S14 A;  4ASA A;  2WI1 A;  2Q8I A;  4XKK A;  3BMY A;  4YKX A;  1BXD A;  4V26 A;  1I59 A;  1UYG A;  4U7N A;  2BYI A;  2C2A A;  4YKT A;  1Y4U A;  4PL9 A;  3ZXO A;  4P8O A;  5IDM A;  2VW5 A;  2YE6 A;  2ZDY A;  2YE4 A;  4H81 A;  3NMQ A;  2XJJ A;  4JQL A;  1Z59 A;  3C0E A;  4W7T A;  3GIF A;  2YEI A;  4FMT A;  4V25 A;  4O0B A;  2O1U A;  4XIT A;  1AH6 A;  1Z5C A;  2YE5 A;  4B7P A;  4XTJ A;  1YSR A;  4E01 A;  4EGI A;  1TIL A;  4CWO A;  1L0O A;  2YKB A;  5FND A;  3LNU A;  2JJC A;  3B26 A;  2BU8 A;  1UYL A;  3OW6 A;  1ZW9 A;  2QF6 A;  2O1V A;  3CGY A;  2IOQ A;  4ASG A;  3O0I A;  1Y8P A;  2BTZ A;  1R62 A;  3K60 A;  3TZ5 A;  4U93 A;  4DUH A;  1UY7 A;  1UYM A;  2IWX A;  4XIP A;  2XDU A;  4QPK A;  3T2S A;  1NHI A;  3FV5 A;  3R92 A;  4BQJ A;  1US7 A;  2YI5 A;  2YK2 A;  4CE3 A;  2Q2E B;  3R91 A;  2YKE A;  4JAV A;  3HYZ A;  1YT1 A;  3RKZ A;  2QG2 A;  4XIQ A;  4KQV A;  5C93 A;  1YER A;  3PEJ A;  4JAU A;  4WUB A;  4H85 A;  1YC3 A;  2WI5 A;  4KP4 A;  1QYE A;  1BYQ A;  2WI4 A;  3A0R A;  2CCT A;  2CGF A;  2VWC A;  1AM1 A;  4PU9 A;  2BYH A;  1I58 A;  1AMW A;  4PRV A;  2XAB A;  1ZWH A;  3GIE A;  4XDM A;  4ASB A;  3ZXQ A;  3CRK A;  3PEH A;  4URL A;  1UYF A;  4HZ0 A;  2XJX A;  1YC4 A;  4LPB A;  3A0X A;  3K98 A;  3B28 A;  2XDX A;  2XDL A;  3U67 A;  2UWD A;  2YEF A;  4GFN A;  2XX2 A;  2ESA A;  2YI0 A;  1B63 A;  2YKI A;  2WER A;  2BZ5 A;  4HY1 A;  5D6Q A;  5F5R A;  3ZKD A;  1NHH A;  1TBW A;  5BOC A;  5M4H A;  3HZ5 A;  1B62 A;  5M4N A;  1AH8 A;  1UYC A;  3OWD A;  1GJV A;  4P7A A;  3TTZ A;  1KZN A;  2EXL A;  4HXZ A;  2HCH A;  3VHC A;  2CCU A;  4O05 A;  2IWS A;  4EFU A;  2GQP A;  5J71 A;  3JZ3 A;  2YEJ A;  3TZ0 A;  2YKJ A;  4KSH A;  5D6P A;  5CTW A;  2WI6 A;  4BIU A;  1TID A;  2XHR A;  1U0Z A;  2XHX A;  4NH8 A;  3RLR A;  4XKA A;  3ZKB A;  3WQ9 A;  2FWZ A;  1UYK A;  2PNR A;  4YKZ A;  1I5A A;  3TZ2 A;  2YI6 A;  2YEG A;  3B27 A;  3EHJ A;  1Y8N A;  1Y4S A;  2XX5 A;  4KSG A;  3T10 A;  2FYP A;  4GCZ A;  4NH7 A;  3HZ1 A;  3Q5J A;  3RLQ A;  4AWP A;  1ZXM A;  1QY8 A;  1UY8 A;  3R4P A;  2XDK A;  4GGL A;  4XCJ A;  1BGQ A;  2XX4 A;  4MP2 A;  3FT5 A;  3ZM7 A;  2YE7 A;  3EKO A;  4EFT A;  4ZVI A;  4HY6 A;  4YKU A;  3G75 A;  4AWO A;  3KE6 A;  4R1F A;  1UYI A;  3EHG A;  4CWP A;  1A4H A;  3D2R A;  2YEB A;  1Z5B A;  3T0H A;  3DGE A;  4BXI A;  1I5D A;  4CWR A;  4ZKI A;  4HYP A;  2YJW A;  5CTU A;  5CTY A;  3EHH A;  4WUD A;  2YE2 A;  3RLP A;  4L91 A;  4QPJ A;  4LP0 A;  3A0Z A;  3C11 A;  4E02 A;  3O2F A;  4KFG A;  4YKR A;  4U7O A;  4EGH A;  2JKI A;  3OWB A;  4L8Z A;  4E00 A;  2ZBK B;  3U2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...