3SL2A

Atp forms a stable complex with the essential histidine kinase walk (yycg) domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
145
Chain Sequence
MWIQIVRFMSLIIDRFEMTKEQEFIRNLPDRDLYVEIDQDKITQVLDNIISNALKYSPEGGHVTFSIDVNEEEELLYISVKDEGIGIPKKDVEKVFDRFYRVDLGGTGLGLAIAKEMVQAHGGDIWADSIEGKGTTITFTLPYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ATP forms a stable complex with the essential histidine kinase WalK (YycG) domain.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Sensor histidine kinase yycG
total genus 38
structure length 145
sequence length 153
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3sl2A00
3WQ9A 2WI6A 4O0BA 4CWOA 2ZDXA 2YE5A 1R62A 4O04A 4GT8A 1YSRA 1YC4A 3OW6A 1YESA 4YKZA 4XITA 2YJXA 1Z5AA 3FT8A 4CWTA 2XDXA 1UYLA 4PU9A 1BKNA 2WEQA 1ZWHA 4XTJA 1GJVA 3VADA 3O6OA 3INXA 3JZ3A 4O07A 4MBCA 4GQTA 3CRLA 1Z59A 4PRXA 1BYQA 4R3AA 4ASAA 2YE3A 3WHAA 1ZXMA 2VCJA 2YI5A 2FWZA 2XCMA 3BM9A 4PL9A 4BQGA 1KZNA 3A0YA 2XDSA 4KQVA 1MX0A 3R4MA 2BU6A 3TZ4A 4GEEA 1Y8OA 2IOPA 3CGYA 2IWUA 4LP0A 3FT5A 5CPHA 5D6QA 3INWA 4CWRA 4H81A 2BYHA 2WI4A 3T0ZA 2XX4A 3U67A 4AWPA 4EFTA 4JAUA 3EHHA 2YE7A 2CG9A 3KE6A 2XABA 5F5RA 2YKIA 1ID0A 4L90A 3G7BA 3SL2A 2QF6A 4XKKA 4AWQA 4HZ0A 3K99A 4YKWA 3OMUA 4YKQA 2YEHA 2XK2A 5GGZA 4BQJA 2EXLA 2IWSA 5IDJA 2QFOA 4URLA 4HYMA 4E01A 4P7AA 2YKEA 4HY6A 1YS3A 5F3KA 2AKPA 2YE4A 5BOCA 2PNRA 2BU7A 4MPEA 4E02A 4U7NA 2WEPA 1BXDA 2HG1A 2YGEA 4L93A 2Q8HA 1Y4SA 2QG2A 4U93A 4EMVA 4KTNA 2Q8GA 2UWDA 2YI6A 4EM7A 4Q20A 4U7OA 4MP7A 4QPKA 4ASFA 5J71A 3B27A 2WI3A 4ZKIA 3R91A 5FNDA 4XD8A 3RLRA 3ZXOA 2YJWA 4EFUA 4K4OA 1NHHA 4HY1A 2YEDA 4HXZA 1S16A 4GGLA 1I5BA 2YI0A 2Q8FA 4XC0A 2WERA 4I3HA 1UYKA 3ZM7A 3TZ2A 3RLQA 2YEAA 4CE1A 2IOQA 3FV5A 3A0RA 1QYEA 2BU2A 2O1VA 2WI5A 1YT2A 2CCSA 3ZXQA 4ASBA 4YKUA 4XCLA 4HZ5A 1ZXNA 5M4NA 5M4MA 2BYIA 2IWXA 3NMQA 5L3JA 4MPCA 4H7QA 2YKBA 5CTXA 4BAEA 4W7TA 4CE3A 5M4KA 2XHXA 2BU5A 4JASA 3HZ5A 2ZBKB 1B62A 4DZYA 4R3MA 4UROA 4YKXA 2JJCA 3TTZA 2CCTA 2BSMA 1EA6A 3U2KA 4O05A 3OWBA 2HCHA 1AH6A 2YEGA 2WI7A 4JQLA 1I59A 3GIEA 3T0HA 2IORA 1I5DA 2XX5A 4X9LA 1Y8PA 3QTFA 2YGFA 3U2DA 5IDMA 3A0XA 1YC1A 3O2FA 3QDDA 1UYDA 3T2SA 4PRVA 4NH7A 4FCRA 2YEJA 1TIDA 3EHFA 2GFDA 2CCUA 4NH9A 4E00A 4XIPA 2E0AA 2BU8A 2XHRA 4XKOA 1TH8A 4WUBA 3EKOA 4MPNA 5FWKA 3R4PA 2HKJA 3DGEA 3GIGB 1UY9A 3HZ1A 2ESAA 3GIFA 3VHDA 3OPDA 1TC0A 3K97A 4FCQA 5CF0A 4URNA 1AH8A 2ZKJA 4B7PA 4AS9A 3HEKA 1UYFA 1PVGA 2YEBA 4CE2A 4CWNA 1TC6A 4P8OA 2ZDYA 1THNA 5C93A 1QZRA 2FXSA 1YETA 2BT0A 3EHGA 3MNRP 1U0ZA 4L94A 4KSGA 3ZKDA 1NHJA 3EHJA 2YKJA 3VHAA 4WUDA 3EKRA 5BODA 1UYEA 5CTYA 1AJ6A 3TZ0A 4BIUA 4URMA 5FNFA 4QPJA 3A0TA 4KSHA 3C11A 2CGFA 3D2RA 3D0BA 5CTWA 3RKZA 2XJGA 4HYPA 2VWCA 1YERA 1UYGA 2H55A 1Z5BA 4XDMA 2XD6A 4BXIA 2XJXA 2C2AA 3HYYA 4LWEA 5M4HA 1A4HA 1H7UA 3HYZA 4XKAA 3T10A 4YKYA 1NHIA 4I5SA 1US7A 2YEEA 4V26A 2CH4A 4XCJA 2XDUA 2XJJA 2BTZA 2QG0A 1B63A 3R4NA 3PEHA 1L0OA 1YT1A 4B6CA 1I58A 4CWFA 5CTUA 5M4PA 2YI7A 1UYHA 2VW5A 2YEIA 4KP4A 3A0ZA 3Q5JA 1Y4UA 4YKRA 3LPSA 3R92A 3RLPA 3B24A 3G75A 2WI1A 2XDLA 3HHUA 1AMWA 3B26A 4R1FA 3Q5KA 5D7RA 2YK9A 4CWSA 1YT0A 4EGHA 3GIGA 4XIRA 3VHCA 4BIZA 3TZ5A 1UY6A 2YGAA 3H4LA 4YKTA 2YE6A 2BREA 4MB9A 5J6AA 2YECA 3D36A 3B25A 2YE9A 3O0IA 3K98A 4KFGA 4ZVIA 3A0WA 4MP2A 4FPPA 1Z5CA 4NH8A 1I5CA 2XX2A 3T1KA 2FWYA 3ZKBA 4GCZA 5D7DA 3LNUA 1UYMA 4HXWA 2BRCA 4CWPA 2WI2A 2Q8IA 2XDKA 3G7EA 4ASGA 3CGZA 3PEJA 4JAVA 4CWQA 3IEDA 1Y8NA 1U2OA 2Q2EB 2YK2A 3H80A 1I5AA 2JKIA 2XHTA 4EGIA 1UYIA 4L91A 4XE2A 5D6PA 2VCIA 2GQPA 3B28A 1JM6A 5IN9A 1QY8A 1UY7A 2YEFA 1H7SA 1BGQA 3CRKA 3TUHA 1UY8A 5D7CA 4LWFA 2BZ5A 4MOTA 4V25A 5M4EA 3CWVA 1EI1A 4LWHA 1MU5A 3K60A 4EGKA 4LPBA 4AWOA 4O09A 5FNCA 1GKXA 4LWIA 1OSFA 1KIJA 2FYPA 1S14A 1B3QA 2O1WA 3R4OA 4LWGA 2YE8A 4DUHA 3BMYA 1TBWA 1ZW9A 4XIQA 2YKCA 1YC3A 4H85A 4WUCA 3OWDA 2YE2A 2O1UA 1TILA 1UYCA 2H8MA 4EEHA 1AM1A 1YSZA 3Q5LA 1GKZA 4FCPA 4FMTA 4GFNA 2K5BA 4L8ZA 3C0EA
chains in the Genus database with same CATH superfamily
3WQ9A 2WI6A 4O0BA 4CWOA 2ZDXA 2YE5A 1R62A 4O04A 4GT8A 1YSRA 1YC4A 3OW6A 5JENA 1YESA 4YKZA 4XITA 2YJXA 1Z5AA 3FT8A 4CWTA 2XDXA 1UYLA 4PU9A 1BKNA 2WEQA 1ZWHA 4XTJA 1GJVA 3VADA 3O6OA 3INXA 3JZ3A 4O07A 4MBCA 4GQTA 3CRLA 1Z59A 4PRXA 1BYQA 4R3AA 4ASAA 2YE3A 3WHAA 1ZXMA 2VCJA 2YI5A 2FWZA 2XCMA 3BM9A 4PL9A 4BQGA 1KZNA 3A0YA 2XDSA 4KQVA 1MX0A 3R4MA 2BU6A 3TZ4A 4GEEA 1Y8OA 2HHIA 2IOPA 3CGYA 2IWUA 4LP0A 3FT5A 5CPHA 5D6QA 3INWA 4CWRA 4H81A 2BYHA 2WI4A 3T0ZA 2XX4A 3U67A 4AWPA 4EFTA 4JAUA 3EHHA 2YE7A 2CG9A 3KE6A 2XABA 3LMMA 5F5RA 2YKIA 1ID0A 4L90A 3G7BA 3SL2A 2QF6A 4XKKA 4AWQA 4HZ0A 3K99A 4YKWA 3OMUA 4YKQA 2YEHA 2XK2A 5GGZA 4BQJA 2EXLA 2IWSA 5IDJA 2QFOA 4URLA 4HYMA 4E01A 4P7AA 2YKEA 4HY6A 1YS3A 5F3KA 2AKPA 2YE4A 5BOCA 2PNRA 2BU7A 4MPEA 4E02A 4U7NA 2WEPA 1BXDA 2HG1A 2YGEA 4L93A 2Q8HA 1Y4SA 2QG2A 4U93A 4EMVA 4KTNA 1IXMA 2UWDA 2YI6A 2Q8GA 4EM7A 4Q20A 4U7OA 4MP7A 4QPKA 4ASFA 5J71A 3B27A 2WI3A 4ZKIA 3R91A 5FNDA 4XD8A 3RLRA 3ZXOA 2YJWA 4EFUA 4K4OA 1NHHA 4HY1A 2YEDA 4HXZA 1S16A 4GGLA 1I5BA 2YI0A 1F51A 2Q8FA 4XC0A 2WERA 4I3HA 1UYKA 3ZM7A 3TZ2A 3RLQA 2YEAA 4CE1A 2IOQA 3FV5A 3A0RA 1QYEA 2BU2A 2O1VA 2WI5A 1YT2A 2CCSA 3ZXQA 4ASBA 4YKUA 4XCLA 4HZ5A 1ZXNA 5M4NA 5M4MA 2BYIA 2IWXA 3NMQA 5L3JA 4MPCA 4H7QA 2YKBA 5CTXA 4BAEA 4W7TA 4CE3A 5M4KA 2XHXA 2BU5A 4JASA 3HZ5A 2ZBKB 1B62A 4DZYA 4R3MA 4UROA 4YKXA 2JJCA 3TTZA 2CCTA 2BSMA 1EA6A 3U2KA 4O05A 3OWBA 2HCHA 1AH6A 2YEGA 2WI7A 4JQLA 1I59A 3GIEA 3T0HA 2IORA 1I5DA 2XX5A 4X9LA 1Y8PA 3QTFA 2YGFA 3U2DA 5IDMA 3A0XA 1YC1A 3O2FA 3QDDA 1UYDA 3T2SA 2FTKA 4PRVA 4NH7A 4FCRA 2YEJA 1TIDA 3EHFA 2GFDA 2CCUA 4NH9A 4E00A 4XIPA 2E0AA 2BU8A 2XHRA 4XKOA 1TH8A 4WUBA 3EKOA 4MPNA 5FWKA 3R4PA 2HKJA 3DGEA 3GIGB 1UY9A 3HZ1A 2ESAA 3GIFA 3VHDA 3OPDA 1TC0A 3K97A 4FCQA 5CF0A 4URNA 1AH8A 2ZKJA 4B7PA 4AS9A 3HEKA 1UYFA 1PVGA 2YEBA 4CE2A 4CWNA 1TC6A 4P8OA 2ZDYA 1THNA 5C93A 1QZRA 2FXSA 1YETA 2BT0A 3EHGA 3MNRP 1U0ZA 4L94A 4KSGA 3ZKDA 1NHJA 3EHJA 2YKJA 3VHAA 4WUDA 3EKRA 5BODA 1UYEA 5CTYA 1AJ6A 3TZ0A 4BIUA 4URMA 5FNFA 4QPJA 3A0TA 4KSHA 3C11A 2CGFA 3D2RA 3D0BA 5CTWA 3RKZA 2XJGA 4HYPA 2VWCA 1YERA 1UYGA 2H55A 1Z5BA 4XDMA 2XD6A 4BXIA 2XJXA 2C2AA 3HYYA 4LWEA 5M4HA 1A4HA 1H7UA 3HYZA 4XKAA 3T10A 4YKYA 1NHIA 4I5SA 1US7A 2YEEA 3S5TA 4V26A 2CH4A 4XCJA 2XDUA 2XJJA 2BTZA 2QG0A 1B63A 3R4NA 3PEHA 1L0OA 1YT1A 4B6CA 1I58A 4CWFA 5CTUA 5M4PA 2YI7A 1UYHA 2VW5A 2YEIA 4KP4A 3A0ZA 3Q5JA 1Y4UA 4YKRA 3LPSA 3R92A 3RLPA 3B24A 3G75A 2WI1A 2XDLA 3HHUA 1AMWA 3B26A 4R1FA 3Q5KA 5D7RA 2YK9A 4CWSA 1YT0A 4EGHA 3GIGA 4XIRA 3VHCA 4BIZA 3TZ5A 1UY6A 4E72A 2YGAA 3H4LA 4YKTA 2YE6A 2BREA 4MB9A 5J6AA 2YECA 3D36A 3B25A 2YE9A 3O0IA 3K98A 4KFGA 4ZVIA 3A0WA 4MP2A 4FPPA 1Z5CA 4NH8A 1I5CA 2XX2A 3T1KA 2FWYA 3ZKBA 4GCZA 5D7DA 3LNUA 1UYMA 4HXWA 2BRCA 4CWPA 2WI2A 2Q8IA 2XDKA 3G7EA 4ASGA 3CGZA 3PEJA 4JAVA 4CWQA 3IEDA 1Y8NA 1U2OA 2Q2EB 2YK2A 3H80A 1I5AA 2JKIA 2XHTA 4EGIA 1UYIA 4L91A 4XE2A 5D6PA 2VCIA 2GQPA 3B28A 1JM6A 5IN9A 1QY8A 1UY7A 2YEFA 1H7SA 1BGQA 3CRKA 3TUHA 1UY8A 5D7CA 4LWFA 2BZ5A 4MOTA 4V25A 5M4EA 3CWVA 1EI1A 4LWHA 1MU5A 3K60A 4EGKA 4LPBA 4AWOA 2C1IA 4O09A 5FNCA 1GKXA 4LWIA 1OSFA 1KIJA 2FYPA 1S14A 1B3QA 2O1WA 3R4OA 4LWGA 2YE8A 4DUHA 3BMYA 1TBWA 1ZW9A 4XIQA 2YKCA 1YC3A 4H85A 4WUCA 3OWDA 2YE2A 2O1UA 1TILA 2C1GA 1UYCA 2H8MA 4EEHA 1AM1A 1YSZA 3Q5LA 1GKZA 4FCPA 4FMTA 4GFNA 2K5BA 3CYGA 4L8ZA 3C0EA
chains in the Genus database with same CATH topology
3WQ9A 2WI6A 4O0BA 4CWOA 2ZDXA 2YE5A 1R62A 4O04A 4GT8A 1YSRA 1YC4A 3OW6A 1YESA 4YKZA 4XITA 2YJXA 1Z5AA 3FT8A 4CWTA 2XDXA 1UYLA 4PU9A 1BKNA 2WEQA 1ZWHA 4XTJA 1GJVA 3VADA 3O6OA 3INXA 3JZ3A 4O07A 4MBCA 4GQTA 3CRLA 1Z59A 4PRXA 1BYQA 4R3AA 4ASAA 2YE3A 3WHAA 1ZXMA 2VCJA 2YI5A 2FWZA 2XCMA 3BM9A 4PL9A 4BQGA 1KZNA 3A0YA 2XDSA 4KQVA 1MX0A 3R4MA 2BU6A 3TZ4A 4GEEA 1Y8OA 2IOPA 3CGYA 2IWUA 4LP0A 3FT5A 5CPHA 5D6QA 3INWA 4CWRA 4H81A 2BYHA 2WI4A 3T0ZA 2XX4A 3U67A 4AWPA 4EFTA 4JAUA 3EHHA 2YE7A 2CG9A 3KE6A 2XABA 5F5RA 2YKIA 1ID0A 4L90A 3G7BA 3SL2A 2QF6A 4XKKA 4AWQA 4HZ0A 3K99A 4YKWA 3OMUA 4YKQA 2YEHA 2XK2A 5GGZA 4BQJA 2EXLA 2IWSA 5IDJA 2QFOA 4URLA 4HYMA 4E01A 4P7AA 2YKEA 4HY6A 1YS3A 5F3KA 2AKPA 2YE4A 5BOCA 2PNRA 2BU7A 4MPEA 4E02A 4U7NA 2WEPA 1BXDA 2HG1A 2YGEA 4L93A 2Q8HA 1Y4SA 2QG2A 4U93A 4EMVA 4KTNA 2Q8GA 2UWDA 2YI6A 4EM7A 4Q20A 4U7OA 4MP7A 4QPKA 4ASFA 5J71A 3B27A 2WI3A 4ZKIA 3R91A 5FNDA 4XD8A 3RLRA 3ZXOA 2YJWA 4EFUA 4K4OA 1NHHA 4HY1A 2YEDA 4HXZA 1S16A 4GGLA 1I5BA 2YI0A 2Q8FA 4XC0A 2WERA 4I3HA 1UYKA 3ZM7A 3TZ2A 3RLQA 2YEAA 4CE1A 2IOQA 3FV5A 3A0RA 1QYEA 2BU2A 2O1VA 2WI5A 1YT2A 2CCSA 3ZXQA 4ASBA 4YKUA 4XCLA 4HZ5A 1ZXNA 5M4NA 5M4MA 2BYIA 2IWXA 3NMQA 5L3JA 4MPCA 4H7QA 2YKBA 5CTXA 4BAEA 4W7TA 4CE3A 5M4KA 2XHXA 2BU5A 4JASA 3HZ5A 2ZBKB 1B62A 4DZYA 4R3MA 4UROA 4YKXA 2JJCA 3TTZA 2CCTA 2BSMA 1EA6A 3U2KA 4O05A 3OWBA 2HCHA 1AH6A 2YEGA 2WI7A 4JQLA 1I59A 3GIEA 3T0HA 2IORA 1I5DA 2XX5A 4X9LA 1Y8PA 3QTFA 2YGFA 3U2DA 5IDMA 3A0XA 1YC1A 3O2FA 3QDDA 1UYDA 3T2SA 4PRVA 4NH7A 4FCRA 2YEJA 1TIDA 3EHFA 2GFDA 2CCUA 4NH9A 4E00A 4XIPA 2E0AA 2BU8A 2XHRA 4XKOA 1TH8A 4WUBA 3EKOA 4MPNA 5FWKA 3R4PA 2HKJA 3DGEA 3GIGB 1UY9A 3HZ1A 2ESAA 3GIFA 3VHDA 3OPDA 1TC0A 3K97A 4FCQA 5CF0A 4URNA 1AH8A 2ZKJA 4B7PA 4AS9A 3HEKA 1UYFA 1PVGA 2YEBA 4CE2A 4CWNA 1TC6A 4P8OA 2ZDYA 1THNA 5C93A 1QZRA 2FXSA 1YETA 2BT0A 3EHGA 3MNRP 1U0ZA 4L94A 4KSGA 3ZKDA 1NHJA 3EHJA 2YKJA 3VHAA 4WUDA 3EKRA 5BODA 1UYEA 5CTYA 1AJ6A 3TZ0A 4BIUA 4URMA 5FNFA 4QPJA 3A0TA 4KSHA 3C11A 2CGFA 3D2RA 3D0BA 5CTWA 3RKZA 2XJGA 4HYPA 2VWCA 1YERA 1UYGA 2H55A 1Z5BA 4XDMA 2XD6A 4BXIA 2XJXA 2C2AA 3HYYA 4LWEA 5M4HA 1A4HA 1H7UA 3HYZA 4XKAA 3T10A 4YKYA 1NHIA 4I5SA 1US7A 2YEEA 4V26A 2CH4A 4XCJA 2XDUA 2XJJA 2BTZA 2QG0A 1B63A 3R4NA 3PEHA 1L0OA 1YT1A 4B6CA 1I58A 4CWFA 5CTUA 5M4PA 2YI7A 1UYHA 2VW5A 2YEIA 4KP4A 3A0ZA 3Q5JA 1Y4UA 4YKRA 3LPSA 3R92A 3RLPA 3B24A 3G75A 2WI1A 2XDLA 3HHUA 1AMWA 3B26A 4R1FA 3Q5KA 5D7RA 2YK9A 4CWSA 1YT0A 4EGHA 3GIGA 4XIRA 3VHCA 4BIZA 3TZ5A 1UY6A 2YGAA 3H4LA 4YKTA 2YE6A 2BREA 4MB9A 5J6AA 2YECA 3D36A 3B25A 2YE9A 3O0IA 3K98A 4KFGA 4ZVIA 3A0WA 4MP2A 4FPPA 1Z5CA 4NH8A 1I5CA 2XX2A 3T1KA 2FWYA 3ZKBA 4GCZA 5D7DA 3LNUA 1UYMA 4HXWA 2BRCA 4CWPA 2WI2A 2Q8IA 2XDKA 3G7EA 4ASGA 3CGZA 3PEJA 4JAVA 4CWQA 3IEDA 1Y8NA 1U2OA 2Q2EB 2YK2A 3H80A 1I5AA 2JKIA 2XHTA 4EGIA 1UYIA 4L91A 4XE2A 5D6PA 2VCIA 2GQPA 3B28A 1JM6A 5IN9A 1QY8A 1UY7A 2YEFA 1H7SA 1BGQA 3CRKA 3TUHA 1UY8A 5D7CA 4LWFA 2BZ5A 4MOTA 4V25A 5M4EA 3CWVA 1EI1A 4LWHA 1MU5A 3K60A 4EGKA 4LPBA 4AWOA 4O09A 5FNCA 1GKXA 4LWIA 1OSFA 1KIJA 2FYPA 1S14A 1B3QA 2O1WA 3R4OA 4LWGA 2YE8A 4DUHA 3BMYA 1TBWA 1ZW9A 4XIQA 2YKCA 1YC3A 4H85A 4WUCA 3OWDA 2YE2A 2O1UA 1TILA 1UYCA 2H8MA 4EEHA 1AM1A 1YSZA 3Q5LA 1GKZA 4FCPA 4FMTA 4GFNA 2K5BA 4L8ZA 3C0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WQ9 A;  2WI6 A;  4O0B A;  4CWO A;  2ZDX A;  2YE5 A;  1R62 A;  4O04 A;  4GT8 A;  1YSR A;  1YC4 A;  3OW6 A;  1YES A;  4YKZ A;  4XIT A;  2YJX A;  1Z5A A;  3FT8 A;  4CWT A;  2XDX A;  1UYL A;  4PU9 A;  1BKN A;  2WEQ A;  1ZWH A;  4XTJ A;  1GJV A;  3VAD A;  3O6O A;  3INX A;  3JZ3 A;  4O07 A;  4MBC A;  4GQT A;  3CRL A;  1Z59 A;  4PRX A;  1BYQ A;  4R3A A;  4ASA A;  2YE3 A;  3WHA A;  1ZXM A;  2VCJ A;  2YI5 A;  2FWZ A;  2XCM A;  3BM9 A;  4PL9 A;  4BQG A;  1KZN A;  3A0Y A;  2XDS A;  4KQV A;  1MX0 A;  3R4M A;  2BU6 A;  3TZ4 A;  4GEE A;  1Y8O A;  2IOP A;  3CGY A;  2IWU A;  4LP0 A;  3FT5 A;  5CPH A;  5D6Q A;  3INW A;  4CWR A;  4H81 A;  2BYH A;  2WI4 A;  3T0Z A;  2XX4 A;  3U67 A;  4AWP A;  4EFT A;  4JAU A;  3EHH A;  2YE7 A;  2CG9 A;  3KE6 A;  2XAB A;  5F5R A;  2YKI A;  1ID0 A;  4L90 A;  3G7B A;  3SL2 A;  2QF6 A;  4XKK A;  4AWQ A;  4HZ0 A;  3K99 A;  4YKW A;  3OMU A;  4YKQ A;  2YEH A;  2XK2 A;  5GGZ A;  4BQJ A;  2EXL A;  2IWS A;  5IDJ A;  2QFO A;  4URL A;  4HYM A;  4E01 A;  4P7A A;  2YKE A;  4HY6 A;  1YS3 A;  5F3K A;  2AKP A;  2YE4 A;  5BOC A;  2PNR A;  2BU7 A;  4MPE A;  4E02 A;  4U7N A;  2WEP A;  1BXD A;  2HG1 A;  2YGE A;  4L93 A;  2Q8H A;  1Y4S A;  2QG2 A;  4U93 A;  4EMV A;  4KTN A;  2Q8G A;  2UWD A;  2YI6 A;  4EM7 A;  4Q20 A;  4U7O A;  4MP7 A;  4QPK A;  4ASF A;  5J71 A;  3B27 A;  2WI3 A;  4ZKI A;  3R91 A;  5FND A;  4XD8 A;  3RLR A;  3ZXO A;  2YJW A;  4EFU A;  4K4O A;  1NHH A;  4HY1 A;  2YED A;  4HXZ A;  1S16 A;  4GGL A;  1I5B A;  2YI0 A;  2Q8F A;  4XC0 A;  2WER A;  4I3H A;  1UYK A;  3ZM7 A;  3TZ2 A;  3RLQ A;  2YEA A;  4CE1 A;  2IOQ A;  3FV5 A;  3A0R A;  1QYE A;  2BU2 A;  2O1V A;  2WI5 A;  1YT2 A;  2CCS A;  3ZXQ A;  4ASB A;  4YKU A;  4XCL A;  4HZ5 A;  1ZXN A;  5M4N A;  5M4M A;  2BYI A;  2IWX A;  3NMQ A;  5L3J A;  4MPC A;  4H7Q A;  2YKB A;  5CTX A;  4BAE A;  4W7T A;  4CE3 A;  5M4K A;  2XHX A;  2BU5 A;  4JAS A;  3HZ5 A;  2ZBK B;  1B62 A;  4DZY A;  4R3M A;  4URO A;  4YKX A;  2JJC A;  3TTZ A;  2CCT A;  2BSM A;  1EA6 A;  3U2K A;  4O05 A;  3OWB A;  2HCH A;  1AH6 A;  2YEG A;  2WI7 A;  4JQL A;  1I59 A;  3GIE A;  3T0H A;  2IOR A;  1I5D A;  2XX5 A;  4X9L A;  1Y8P A;  3QTF A;  2YGF A;  3U2D A;  5IDM A;  3A0X A;  1YC1 A;  3O2F A;  3QDD A;  1UYD A;  3T2S A;  4PRV A;  4NH7 A;  4FCR A;  2YEJ A;  1TID A;  3EHF A;  2GFD A;  2CCU A;  4NH9 A;  4E00 A;  4XIP A;  2E0A A;  2BU8 A;  2XHR A;  4XKO A;  1TH8 A;  4WUB A;  3EKO A;  4MPN A;  5FWK A;  3R4P A;  2HKJ A;  3DGE A;  3GIG B;  1UY9 A;  3HZ1 A;  2ESA A;  3GIF A;  3VHD A;  3OPD A;  1TC0 A;  3K97 A;  4FCQ A;  5CF0 A;  4URN A;  1AH8 A;  2ZKJ A;  4B7P A;  4AS9 A;  3HEK A;  1UYF A;  1PVG A;  2YEB A;  4CE2 A;  4CWN A;  1TC6 A;  4P8O A;  2ZDY A;  1THN A;  5C93 A;  1QZR A;  2FXS A;  1YET A;  2BT0 A;  3EHG A;  3MNR P;  1U0Z A;  4L94 A;  4KSG A;  3ZKD A;  1NHJ A;  3EHJ A;  2YKJ A;  3VHA A;  4WUD A;  3EKR A;  5BOD A;  1UYE A;  5CTY A;  1AJ6 A;  3TZ0 A;  4BIU A;  4URM A;  5FNF A;  4QPJ A;  3A0T A;  4KSH A;  3C11 A;  2CGF A;  3D2R A;  3D0B A;  5CTW A;  3RKZ A;  2XJG A;  4HYP A;  2VWC A;  1YER A;  1UYG A;  2H55 A;  1Z5B A;  4XDM A;  2XD6 A;  4BXI A;  2XJX A;  2C2A A;  3HYY A;  4LWE A;  5M4H A;  1A4H A;  1H7U A;  3HYZ A;  4XKA A;  3T10 A;  4YKY A;  1NHI A;  4I5S A;  1US7 A;  2YEE A;  4V26 A;  2CH4 A;  4XCJ A;  2XDU A;  2XJJ A;  2BTZ A;  2QG0 A;  1B63 A;  3R4N A;  3PEH A;  1L0O A;  1YT1 A;  4B6C A;  1I58 A;  4CWF A;  5CTU A;  5M4P A;  2YI7 A;  1UYH A;  2VW5 A;  2YEI A;  4KP4 A;  3A0Z A;  3Q5J A;  1Y4U A;  4YKR A;  3LPS A;  3R92 A;  3RLP A;  3B24 A;  3G75 A;  2WI1 A;  2XDL A;  3HHU A;  1AMW A;  3B26 A;  4R1F A;  3Q5K A;  5D7R A;  2YK9 A;  4CWS A;  1YT0 A;  4EGH A;  3GIG A;  4XIR A;  3VHC A;  4BIZ A;  3TZ5 A;  1UY6 A;  2YGA A;  3H4L A;  4YKT A;  2YE6 A;  2BRE A;  4MB9 A;  5J6A A;  2YEC A;  3D36 A;  3B25 A;  2YE9 A;  3O0I A;  3K98 A;  4KFG A;  4ZVI A;  3A0W A;  4MP2 A;  4FPP A;  1Z5C A;  4NH8 A;  1I5C A;  2XX2 A;  3T1K A;  2FWY A;  3ZKB A;  4GCZ A;  5D7D A;  3LNU A;  1UYM A;  4HXW A;  2BRC A;  4CWP A;  2WI2 A;  2Q8I A;  2XDK A;  3G7E A;  4ASG A;  3CGZ A;  3PEJ A;  4JAV A;  4CWQ A;  3IED A;  1Y8N A;  1U2O A;  2Q2E B;  2YK2 A;  3H80 A;  1I5A A;  2JKI A;  2XHT A;  4EGI A;  1UYI A;  4L91 A;  4XE2 A;  5D6P A;  2VCI A;  2GQP A;  3B28 A;  1JM6 A;  5IN9 A;  1QY8 A;  1UY7 A;  2YEF A;  1H7S A;  1BGQ A;  3CRK A;  3TUH A;  1UY8 A;  5D7C A;  4LWF A;  2BZ5 A;  4MOT A;  4V25 A;  5M4E A;  3CWV A;  1EI1 A;  4LWH A;  1MU5 A;  3K60 A;  4EGK A;  4LPB A;  4AWO A;  4O09 A;  5FNC A;  1GKX A;  4LWI A;  1OSF A;  1KIJ A;  2FYP A;  1S14 A;  1B3Q A;  2O1W A;  3R4O A;  4LWG A;  2YE8 A;  4DUH A;  3BMY A;  1TBW A;  1ZW9 A;  4XIQ A;  2YKC A;  1YC3 A;  4H85 A;  4WUC A;  3OWD A;  2YE2 A;  2O1U A;  1TIL A;  1UYC A;  2H8M A;  4EEH A;  1AM1 A;  1YSZ A;  3Q5L A;  1GKZ A;  4FCP A;  4FMT A;  4GFN A;  2K5B A;  4L8Z A;  3C0E A; 
#chains in the Genus database with same CATH topology
 3WQ9 A;  2WI6 A;  4O0B A;  4CWO A;  2ZDX A;  2YE5 A;  1R62 A;  4O04 A;  4GT8 A;  1YSR A;  1YC4 A;  3OW6 A;  5JEN A;  1YES A;  4YKZ A;  4XIT A;  2YJX A;  1Z5A A;  3FT8 A;  4CWT A;  2XDX A;  1UYL A;  4PU9 A;  1BKN A;  2WEQ A;  1ZWH A;  4XTJ A;  1GJV A;  3VAD A;  3O6O A;  3INX A;  3JZ3 A;  4O07 A;  4MBC A;  4GQT A;  3CRL A;  1Z59 A;  4PRX A;  1BYQ A;  4R3A A;  4ASA A;  2YE3 A;  3WHA A;  1ZXM A;  2VCJ A;  2YI5 A;  2FWZ A;  2XCM A;  3BM9 A;  4PL9 A;  4BQG A;  1KZN A;  3A0Y A;  2XDS A;  4KQV A;  1MX0 A;  3R4M A;  2BU6 A;  3TZ4 A;  4GEE A;  1Y8O A;  2HHI A;  2IOP A;  3CGY A;  2IWU A;  4LP0 A;  3FT5 A;  5CPH A;  5D6Q A;  3INW A;  4CWR A;  4H81 A;  2BYH A;  2WI4 A;  3T0Z A;  2XX4 A;  3U67 A;  4AWP A;  4EFT A;  4JAU A;  3EHH A;  2YE7 A;  2CG9 A;  3KE6 A;  2XAB A;  3LMM A;  5F5R A;  2YKI A;  1ID0 A;  4L90 A;  3G7B A;  3SL2 A;  2QF6 A;  4XKK A;  4AWQ A;  4HZ0 A;  3K99 A;  4YKW A;  3OMU A;  4YKQ A;  2YEH A;  2XK2 A;  5GGZ A;  4BQJ A;  2EXL A;  2IWS A;  5IDJ A;  2QFO A;  4URL A;  4HYM A;  4E01 A;  4P7A A;  2YKE A;  4HY6 A;  1YS3 A;  5F3K A;  2AKP A;  2YE4 A;  5BOC A;  2PNR A;  2BU7 A;  4MPE A;  4E02 A;  4U7N A;  2WEP A;  1BXD A;  2HG1 A;  2YGE A;  4L93 A;  2Q8H A;  1Y4S A;  2QG2 A;  4U93 A;  4EMV A;  4KTN A;  1IXM A;  2UWD A;  2YI6 A;  2Q8G A;  4EM7 A;  4Q20 A;  4U7O A;  4MP7 A;  4QPK A;  4ASF A;  5J71 A;  3B27 A;  2WI3 A;  4ZKI A;  3R91 A;  5FND A;  4XD8 A;  3RLR A;  3ZXO A;  2YJW A;  4EFU A;  4K4O A;  1NHH A;  4HY1 A;  2YED A;  4HXZ A;  1S16 A;  4GGL A;  1I5B A;  2YI0 A;  1F51 A;  2Q8F A;  4XC0 A;  2WER A;  4I3H A;  1UYK A;  3ZM7 A;  3TZ2 A;  3RLQ A;  2YEA A;  4CE1 A;  2IOQ A;  3FV5 A;  3A0R A;  1QYE A;  2BU2 A;  2O1V A;  2WI5 A;  1YT2 A;  2CCS A;  3ZXQ A;  4ASB A;  4YKU A;  4XCL A;  4HZ5 A;  1ZXN A;  5M4N A;  5M4M A;  2BYI A;  2IWX A;  3NMQ A;  5L3J A;  4MPC A;  4H7Q A;  2YKB A;  5CTX A;  4BAE A;  4W7T A;  4CE3 A;  5M4K A;  2XHX A;  2BU5 A;  4JAS A;  3HZ5 A;  2ZBK B;  1B62 A;  4DZY A;  4R3M A;  4URO A;  4YKX A;  2JJC A;  3TTZ A;  2CCT A;  2BSM A;  1EA6 A;  3U2K A;  4O05 A;  3OWB A;  2HCH A;  1AH6 A;  2YEG A;  2WI7 A;  4JQL A;  1I59 A;  3GIE A;  3T0H A;  2IOR A;  1I5D A;  2XX5 A;  4X9L A;  1Y8P A;  3QTF A;  2YGF A;  3U2D A;  5IDM A;  3A0X A;  1YC1 A;  3O2F A;  3QDD A;  1UYD A;  3T2S A;  2FTK A;  4PRV A;  4NH7 A;  4FCR A;  2YEJ A;  1TID A;  3EHF A;  2GFD A;  2CCU A;  4NH9 A;  4E00 A;  4XIP A;  2E0A A;  2BU8 A;  2XHR A;  4XKO A;  1TH8 A;  4WUB A;  3EKO A;  4MPN A;  5FWK A;  3R4P A;  2HKJ A;  3DGE A;  3GIG B;  1UY9 A;  3HZ1 A;  2ESA A;  3GIF A;  3VHD A;  3OPD A;  1TC0 A;  3K97 A;  4FCQ A;  5CF0 A;  4URN A;  1AH8 A;  2ZKJ A;  4B7P A;  4AS9 A;  3HEK A;  1UYF A;  1PVG A;  2YEB A;  4CE2 A;  4CWN A;  1TC6 A;  4P8O A;  2ZDY A;  1THN A;  5C93 A;  1QZR A;  2FXS A;  1YET A;  2BT0 A;  3EHG A;  3MNR P;  1U0Z A;  4L94 A;  4KSG A;  3ZKD A;  1NHJ A;  3EHJ A;  2YKJ A;  3VHA A;  4WUD A;  3EKR A;  5BOD A;  1UYE A;  5CTY A;  1AJ6 A;  3TZ0 A;  4BIU A;  4URM A;  5FNF A;  4QPJ A;  3A0T A;  4KSH A;  3C11 A;  2CGF A;  3D2R A;  3D0B A;  5CTW A;  3RKZ A;  2XJG A;  4HYP A;  2VWC A;  1YER A;  1UYG A;  2H55 A;  1Z5B A;  4XDM A;  2XD6 A;  4BXI A;  2XJX A;  2C2A A;  3HYY A;  4LWE A;  5M4H A;  1A4H A;  1H7U A;  3HYZ A;  4XKA A;  3T10 A;  4YKY A;  1NHI A;  4I5S A;  1US7 A;  2YEE A;  3S5T A;  4V26 A;  2CH4 A;  4XCJ A;  2XDU A;  2XJJ A;  2BTZ A;  2QG0 A;  1B63 A;  3R4N A;  3PEH A;  1L0O A;  1YT1 A;  4B6C A;  1I58 A;  4CWF A;  5CTU A;  5M4P A;  2YI7 A;  1UYH A;  2VW5 A;  2YEI A;  4KP4 A;  3A0Z A;  3Q5J A;  1Y4U A;  4YKR A;  3LPS A;  3R92 A;  3RLP A;  3B24 A;  3G75 A;  2WI1 A;  2XDL A;  3HHU A;  1AMW A;  3B26 A;  4R1F A;  3Q5K A;  5D7R A;  2YK9 A;  4CWS A;  1YT0 A;  4EGH A;  3GIG A;  4XIR A;  3VHC A;  4BIZ A;  3TZ5 A;  1UY6 A;  4E72 A;  2YGA A;  3H4L A;  4YKT A;  2YE6 A;  2BRE A;  4MB9 A;  5J6A A;  2YEC A;  3D36 A;  3B25 A;  2YE9 A;  3O0I A;  3K98 A;  4KFG A;  4ZVI A;  3A0W A;  4MP2 A;  4FPP A;  1Z5C A;  4NH8 A;  1I5C A;  2XX2 A;  3T1K A;  2FWY A;  3ZKB A;  4GCZ A;  5D7D A;  3LNU A;  1UYM A;  4HXW A;  2BRC A;  4CWP A;  2WI2 A;  2Q8I A;  2XDK A;  3G7E A;  4ASG A;  3CGZ A;  3PEJ A;  4JAV A;  4CWQ A;  3IED A;  1Y8N A;  1U2O A;  2Q2E B;  2YK2 A;  3H80 A;  1I5A A;  2JKI A;  2XHT A;  4EGI A;  1UYI A;  4L91 A;  4XE2 A;  5D6P A;  2VCI A;  2GQP A;  3B28 A;  1JM6 A;  5IN9 A;  1QY8 A;  1UY7 A;  2YEF A;  1H7S A;  1BGQ A;  3CRK A;  3TUH A;  1UY8 A;  5D7C A;  4LWF A;  2BZ5 A;  4MOT A;  4V25 A;  5M4E A;  3CWV A;  1EI1 A;  4LWH A;  1MU5 A;  3K60 A;  4EGK A;  4LPB A;  4AWO A;  2C1I A;  4O09 A;  5FNC A;  1GKX A;  4LWI A;  1OSF A;  1KIJ A;  2FYP A;  1S14 A;  1B3Q A;  2O1W A;  3R4O A;  4LWG A;  2YE8 A;  4DUH A;  3BMY A;  1TBW A;  1ZW9 A;  4XIQ A;  2YKC A;  1YC3 A;  4H85 A;  4WUC A;  3OWD A;  2YE2 A;  2O1U A;  1TIL A;  2C1G A;  1UYC A;  2H8M A;  4EEH A;  1AM1 A;  1YSZ A;  3Q5L A;  1GKZ A;  4FCP A;  4FMT A;  4GFN A;  2K5B A;  3CYG A;  4L8Z A;  3C0E A; 
#chains in the Genus database with same CATH homology
 3WQ9 A;  2WI6 A;  4O0B A;  4CWO A;  2ZDX A;  2YE5 A;  1R62 A;  4O04 A;  4GT8 A;  1YSR A;  1YC4 A;  3OW6 A;  1YES A;  4YKZ A;  4XIT A;  2YJX A;  1Z5A A;  3FT8 A;  4CWT A;  2XDX A;  1UYL A;  4PU9 A;  1BKN A;  2WEQ A;  1ZWH A;  4XTJ A;  1GJV A;  3VAD A;  3O6O A;  3INX A;  3JZ3 A;  4O07 A;  4MBC A;  4GQT A;  3CRL A;  1Z59 A;  4PRX A;  1BYQ A;  4R3A A;  4ASA A;  2YE3 A;  3WHA A;  1ZXM A;  2VCJ A;  2YI5 A;  2FWZ A;  2XCM A;  3BM9 A;  4PL9 A;  4BQG A;  1KZN A;  3A0Y A;  2XDS A;  4KQV A;  1MX0 A;  3R4M A;  2BU6 A;  3TZ4 A;  4GEE A;  1Y8O A;  2IOP A;  3CGY A;  2IWU A;  4LP0 A;  3FT5 A;  5CPH A;  5D6Q A;  3INW A;  4CWR A;  4H81 A;  2BYH A;  2WI4 A;  3T0Z A;  2XX4 A;  3U67 A;  4AWP A;  4EFT A;  4JAU A;  3EHH A;  2YE7 A;  2CG9 A;  3KE6 A;  2XAB A;  5F5R A;  2YKI A;  1ID0 A;  4L90 A;  3G7B A;  3SL2 A;  2QF6 A;  4XKK A;  4AWQ A;  4HZ0 A;  3K99 A;  4YKW A;  3OMU A;  4YKQ A;  2YEH A;  2XK2 A;  5GGZ A;  4BQJ A;  2EXL A;  2IWS A;  5IDJ A;  2QFO A;  4URL A;  4HYM A;  4E01 A;  4P7A A;  2YKE A;  4HY6 A;  1YS3 A;  5F3K A;  2AKP A;  2YE4 A;  5BOC A;  2PNR A;  2BU7 A;  4MPE A;  4E02 A;  4U7N A;  2WEP A;  1BXD A;  2HG1 A;  2YGE A;  4L93 A;  2Q8H A;  1Y4S A;  2QG2 A;  4U93 A;  4EMV A;  4KTN A;  2Q8G A;  2UWD A;  2YI6 A;  4EM7 A;  4Q20 A;  4U7O A;  4MP7 A;  4QPK A;  4ASF A;  5J71 A;  3B27 A;  2WI3 A;  4ZKI A;  3R91 A;  5FND A;  4XD8 A;  3RLR A;  3ZXO A;  2YJW A;  4EFU A;  4K4O A;  1NHH A;  4HY1 A;  2YED A;  4HXZ A;  1S16 A;  4GGL A;  1I5B A;  2YI0 A;  2Q8F A;  4XC0 A;  2WER A;  4I3H A;  1UYK A;  3ZM7 A;  3TZ2 A;  3RLQ A;  2YEA A;  4CE1 A;  2IOQ A;  3FV5 A;  3A0R A;  1QYE A;  2BU2 A;  2O1V A;  2WI5 A;  1YT2 A;  2CCS A;  3ZXQ A;  4ASB A;  4YKU A;  4XCL A;  4HZ5 A;  1ZXN A;  5M4N A;  5M4M A;  2BYI A;  2IWX A;  3NMQ A;  5L3J A;  4MPC A;  4H7Q A;  2YKB A;  5CTX A;  4BAE A;  4W7T A;  4CE3 A;  5M4K A;  2XHX A;  2BU5 A;  4JAS A;  3HZ5 A;  2ZBK B;  1B62 A;  4DZY A;  4R3M A;  4URO A;  4YKX A;  2JJC A;  3TTZ A;  2CCT A;  2BSM A;  1EA6 A;  3U2K A;  4O05 A;  3OWB A;  2HCH A;  1AH6 A;  2YEG A;  2WI7 A;  4JQL A;  1I59 A;  3GIE A;  3T0H A;  2IOR A;  1I5D A;  2XX5 A;  4X9L A;  1Y8P A;  3QTF A;  2YGF A;  3U2D A;  5IDM A;  3A0X A;  1YC1 A;  3O2F A;  3QDD A;  1UYD A;  3T2S A;  4PRV A;  4NH7 A;  4FCR A;  2YEJ A;  1TID A;  3EHF A;  2GFD A;  2CCU A;  4NH9 A;  4E00 A;  4XIP A;  2E0A A;  2BU8 A;  2XHR A;  4XKO A;  1TH8 A;  4WUB A;  3EKO A;  4MPN A;  5FWK A;  3R4P A;  2HKJ A;  3DGE A;  3GIG B;  1UY9 A;  3HZ1 A;  2ESA A;  3GIF A;  3VHD A;  3OPD A;  1TC0 A;  3K97 A;  4FCQ A;  5CF0 A;  4URN A;  1AH8 A;  2ZKJ A;  4B7P A;  4AS9 A;  3HEK A;  1UYF A;  1PVG A;  2YEB A;  4CE2 A;  4CWN A;  1TC6 A;  4P8O A;  2ZDY A;  1THN A;  5C93 A;  1QZR A;  2FXS A;  1YET A;  2BT0 A;  3EHG A;  3MNR P;  1U0Z A;  4L94 A;  4KSG A;  3ZKD A;  1NHJ A;  3EHJ A;  2YKJ A;  3VHA A;  4WUD A;  3EKR A;  5BOD A;  1UYE A;  5CTY A;  1AJ6 A;  3TZ0 A;  4BIU A;  4URM A;  5FNF A;  4QPJ A;  3A0T A;  4KSH A;  3C11 A;  2CGF A;  3D2R A;  3D0B A;  5CTW A;  3RKZ A;  2XJG A;  4HYP A;  2VWC A;  1YER A;  1UYG A;  2H55 A;  1Z5B A;  4XDM A;  2XD6 A;  4BXI A;  2XJX A;  2C2A A;  3HYY A;  4LWE A;  5M4H A;  1A4H A;  1H7U A;  3HYZ A;  4XKA A;  3T10 A;  4YKY A;  1NHI A;  4I5S A;  1US7 A;  2YEE A;  4V26 A;  2CH4 A;  4XCJ A;  2XDU A;  2XJJ A;  2BTZ A;  2QG0 A;  1B63 A;  3R4N A;  3PEH A;  1L0O A;  1YT1 A;  4B6C A;  1I58 A;  4CWF A;  5CTU A;  5M4P A;  2YI7 A;  1UYH A;  2VW5 A;  2YEI A;  4KP4 A;  3A0Z A;  3Q5J A;  1Y4U A;  4YKR A;  3LPS A;  3R92 A;  3RLP A;  3B24 A;  3G75 A;  2WI1 A;  2XDL A;  3HHU A;  1AMW A;  3B26 A;  4R1F A;  3Q5K A;  5D7R A;  2YK9 A;  4CWS A;  1YT0 A;  4EGH A;  3GIG A;  4XIR A;  3VHC A;  4BIZ A;  3TZ5 A;  1UY6 A;  2YGA A;  3H4L A;  4YKT A;  2YE6 A;  2BRE A;  4MB9 A;  5J6A A;  2YEC A;  3D36 A;  3B25 A;  2YE9 A;  3O0I A;  3K98 A;  4KFG A;  4ZVI A;  3A0W A;  4MP2 A;  4FPP A;  1Z5C A;  4NH8 A;  1I5C A;  2XX2 A;  3T1K A;  2FWY A;  3ZKB A;  4GCZ A;  5D7D A;  3LNU A;  1UYM A;  4HXW A;  2BRC A;  4CWP A;  2WI2 A;  2Q8I A;  2XDK A;  3G7E A;  4ASG A;  3CGZ A;  3PEJ A;  4JAV A;  4CWQ A;  3IED A;  1Y8N A;  1U2O A;  2Q2E B;  2YK2 A;  3H80 A;  1I5A A;  2JKI A;  2XHT A;  4EGI A;  1UYI A;  4L91 A;  4XE2 A;  5D6P A;  2VCI A;  2GQP A;  3B28 A;  1JM6 A;  5IN9 A;  1QY8 A;  1UY7 A;  2YEF A;  1H7S A;  1BGQ A;  3CRK A;  3TUH A;  1UY8 A;  5D7C A;  4LWF A;  2BZ5 A;  4MOT A;  4V25 A;  5M4E A;  3CWV A;  1EI1 A;  4LWH A;  1MU5 A;  3K60 A;  4EGK A;  4LPB A;  4AWO A;  4O09 A;  5FNC A;  1GKX A;  4LWI A;  1OSF A;  1KIJ A;  2FYP A;  1S14 A;  1B3Q A;  2O1W A;  3R4O A;  4LWG A;  2YE8 A;  4DUH A;  3BMY A;  1TBW A;  1ZW9 A;  4XIQ A;  2YKC A;  1YC3 A;  4H85 A;  4WUC A;  3OWD A;  2YE2 A;  2O1U A;  1TIL A;  1UYC A;  2H8M A;  4EEH A;  1AM1 A;  1YSZ A;  3Q5L A;  1GKZ A;  4FCP A;  4FMT A;  4GFN A;  2K5B A;  4L8Z A;  3C0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...