3SLJA

Pre-cleavage structure of the autotransporter espp - n1023a mutant
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
305
structure length
305
Chain Sequence
HHHANKEATRNAAALFSVDYKAFLNEVANLNKRMGDLRDINGEAGAWARIMSGTGSASGGFSDNYTHVQVGVDKKHELDGLDLFTGFTVTHTDSSASADVFSGKTKSVGAGLYASAMFDSGAYIDLIGKYVHHDNEYTATFAGLGTRDYSTHSWYAGAEAGYRYHVTEDAWIEPQAELVYGSVSGKQFAWKDQGMHLSMKDKDYNPLIGRTGVDVGKSFSGKDWKVTARAGLGYQFDLLANGETVLRDASGEKRIKGEKDSRMLMSVGLNAEIRDNVRFGLEFEKSAFGKYNVDNAVNANFRYSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine protease espP
publication title Molecular basis for the activation of a catalytic asparagine residue in a self-cleaving bacterial autotransporter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 85
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03797 Autotransporter Autotransporter beta-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.130 Mainly Beta Beta Barrel Lipocalin Autotransporter beta-domain 3sljA00
3AEHA 3KVNA 3SLTA 3QQ2A 1UYOX 2QOMA 4MEEA 3SLJA 1UYNX 3SLOA
chains in the Genus database with same CATH superfamily
4U8UM 5K67A 3S5XA 1CBIA 3D97A 2G79A 3O19A 3VHHA 4NP1A 4DNEA 1BJ7A 4A60A 4FBVA 3EM0A 1B8EA 1X8QA 2I5VO 5CSEA 5F6ZA 3WBGA 1ZNLA 1NGLA 4YBPA 4CDEA 1DF3A 4ZH9A 2RTFB 1SWGA 2L9CA 4TJZA 2FT9A 2KTSA 3FIDA 3RY2A 4GK9A 3GE2A 3TGBA 4IAXA 4YFPA 1DFVA 5HCDC 3BDRA 4ZGFA 3PH6A 1YWAA 4U46A 3RE6A 1N43A 1DC9A 1LFOA 4WFVA 3NPOA 4DQ3A 2A0AA 2HNXA 3WZOA 1ALBA 5F2BA 2IZKA 4Z2VA 4ORYA 5KHPA 4Y0RA 3FW5A 1QABE 2VFCA 3AEHA 4QZUA 2X45A 3CKGA 1FENA 1B4MA 1RLBE 3OE3A 4M6SA 4ZCBA 5HZ6A 3NQ3A 4FBOA 3FR4A 4GGZA 4FGIB 4HPBA 1EQDA 2OYBO 2Q39A 1ADLA 2BSZA 1X8NA 2WEXA 4XMEA 4QQ1A 2AT5X 1AB0A 2AKQA 4IAWA 5LJKA 1MK5A 3FEKA 3WXQA 1XCAA 1VWGB 2IZHB 1VWRB 2RTDB 4GNYA 3FENA 5IRAA 4UU3A 3STMX 4CPFA 5LJEA 3P6GA 2OF9A 4I95A 4QRLA 4TKBA 5HZ5A 4IB6A 3VG5A 3T1DA 1ICNA 1LCWA 4QYNA 1AQBA 1VYFA 1A18A 4U8UO 1SWBA 3L4RA 2WQAE 4EQAC 4MEEA 2IZBA 5F1EA 5B2AO 3PDFA 1PBOA 4JGLA 2IZCB 3I0AA 5BVSA 2FR2A 1SXUA 4MVEA 3FA8A 4BX6B 3HOLA 1HY2A 2RTRB 4ZFXA 1NC9A 2ACPX 2ALLX 4B55A 4Z28A 1KZXA 1E2TA 5LJHA 1KOIA 3APWA 4INNA 3HWEA 4I3CA 4NYQA 4BX5B 1CBSA 1WBIA 3JSQA 2G5LA 2Y3FA 4ZJ0A 3FIQA 2OZQA 4GJSA 1LUQA 1R0UA 4L1NA 3TZSA 1PTSA 1JJJA 5HZ8A 2RCQA 1NQNA 1YWCA 4NLJA 4QGXA 4YH0A 5C0NA 2ASNX 4NNTA 4D6AA 3RSWA 1KZWA 4GUZA 5EPQA 5HCCC 1ZRYA 3KVNA 3NADA 3NX2A 4TLJA 1QG5A 1SA8A 4YCEA 2HZQA 2WSJA 3WZPA 1O1UA 1CBRA 2HLVA 1SY2A 4AYHA 4C5PA 4IABA 4YMYA 3RKGA 4GE1A 4I3BA 1E5PA 1TOUA 3N91A 1B0OA 1ERBA 1SWAA 2RTPB 1LF7A 2RTGB 1YP7A 1SY0A 5F58A 1SWKA 3RZYA 2JU7A 2LA7A 2RTNB 3EBWA 2LKKA 4GRJA 1EPAA 2R73A 4O4OA 2FKJA 4QNIA 1X71A 2QMIA 1STSB 1S2PA 3EBKA 3X00A 1VWJB 3CKFA 2X8FA 4ALBA 1O1VA 1NP1A 1SWCA 4OELA 1VWOB 3SLOA 1EXSA 5AJBA 2RTIB 1KT6A 3CMPA 3P6FA 1MOYA 5L8OA 5L8NA 2Y32A 3WJGA 4IB8A 3T6LA 1MVGA 2MHDA 4ZR2A 4XMDA 2KT4B 1SLEB 3FMZA 3WYPA 1DZKA 1VWHB 2X4MA 3HOEA 4ID2A 2WWPA 2OFBA 3P6CA 5HWZA 4KIIA 3G7XA 2YMSA 2HYSA 3SZJA 5IO6A 2OY7A 2QM9A 1SWUA 4AZRA 1E00A 2IZJA 3BY0A 3S60A 4AW8A 2RTMA 4BGFA 3I17A 1EIOA 3MX7A 1JJXA 4N7CA 1AELA 3B2LA 1N9MA 2F09A 2N93A 1SRIA 3C78X 4I9RA 3D96A 5B11O 3RDQA 4XMHA 4BBOA 3BRNA 4KCAA 5L3YA 1GT4A 4EEJA 1IJ8A 1KT7A 3TGCA 4GU8A 4ODDA 4XMGA 5HTEA 3FA7A 1W4TA 3P6DA 4ORWA 4XMCA 1DV9A 5L8IA 4OS3A 1ZNEA 1SLDB 3MG5A 5H9KA 5BVQA 2AL0X 2RTHB 3T2XA 4GDAA 4Y0QA 1SXXA 1QFTA 1BSOA 1GX3A 5KIDA 2DM5A 2CZTA 1CJ5A 1AVEA 1KQXA 5HZQA 2LB6A 4XMFA 2RCTA 3F9DA 4YCHA 1VWLB 3F6ZB 3EW1A 1ICMA 2A5CA 1SWSA 1Y0GA 1HXZA 1Y9TA 4IB9A 4U8UN 3VPJE 4Y59A 2IZAA 2UYWA 4I60A 1MUPA 4RUNA 3RDSA 2BHVA 1BSYA 1GX9A 1DF8A 4TNNA 4OKAA 3RDXA 3WZQA 2BS5A 1OSPO 4AZQA 1HMTA 5JD2A 4RUUA 4BX7A 3BX8A 1I05A 3FELA 2BT9A 4LZUA 4ORSA 2FS6A 2FWVA 2JGSA 1NP4A 1U17A 2JN3A 2A8GA 2O62A 3LHNA 2RTBB 1SLGB 1P6PA 3HK1A 3T2WA 2IZDB 1IKJA 3PH5A 1HXLA 3TF6A 1HMRA 4FQBB 1BWYA 1EIIA 5F6BA 3BU1A 4Z6JA 2MO5A 3VG7A 3U9PC 1OPAA 3ZWEA 2RTCB 5K68A 4BX7B 5CE4A 3UEVA 4ZHCA 3APVA 2NNQA 3RWXA 2QOSC 2RA6A 1CBQA 1GXAA 3D9WA 1OBUA 3RE5A 1BM5A 2DJFA 1U18A 1LICA 1LIBA 1SXYA 2POAA 3B2IA 4JO6A 5IO5A 1LIDA 2KTDA 3DSZA 1SWDA 2RN4A 4YBUA 3AKMA 2AT0X 4LKTA 1YIVA 1PEEA 3DTQA 3SAOA 1QFVA 2IZGB 2RTQB 3FA6A 3PEDA 4GH7A 3RBYA 1IIUA 1QY1A 4BX6A 1SWPA 1LCZA 1UYOX 2UZ2A 4WBKA 4KT5A 3S5VA 3KQ0A 1RSTB 5CHKA 4GGRA 2X8SA 1IKEA 5EDBA 3EW2A 3P6HA 5H9LA 4BX5A 4D6BA 4CDFA 1N7YA 1SWRA 1ZNHA 3P02A 5EZ2A 3NP1A 1LDOA 3AUMO 4LQZA 1JYJA 4I6SA 4BCSA 2Q2MA 1SRFA 1FJ1E 2Q9SA 2A5BA 4Z27A 3WJEA 4O3WA 3WVMA 4QYPA 3APXA 5B5FA 1TW4A 2FHNX 2AF5A 3HWFA 4NW4A 2R56A 4WFUA 4U9CA 1OEEA 5B3MO 1YUPA 2M4LA 3SZIA 3PPTA 1STPA 2FGSA 1A57A 4YFRA 1VPRA 3EC5A 4QAEA 4BQUA 4CPHA 4BJ8A 4I3DA 3B2HA 4PJ2A 4IMNA 1X8PA 5D8JA 4KC8A 3PK2A 1Y52X 1RXJA 2WEWA 3GAQA 4GETA 1VWNB 1I4UA 1JZUA 3SLJA 2DJGA 2Y3EA 4A1HA 1QY2A 5FQ7E 1SMPI 4EFGA 1EPBA 4ZGUA 5HAEA 1HMSA 3ZUOA 1KGLA 2QO5A 1VWPB 3CBSA 1LPJA 1I78A 2BLGA 2RTAA 3NBXX 4JHQA 4COTA 4I9SA 1NQMA 1GT1A 2AT8X 2BC3A 3C76X 4CPHB 5BYPA 3KFHA 3FA9A 4HPAA 1RBPA 3WYQA 3STNA 1DZJA 5JR8A 5B29A 1MM9A 1OEKA 5LJBA 5FQ8E 1UYNX 1G74A 1JMXA 3ZI8A 1VYGA 2GTLO 1D3SA 2KW1A 4CSBA 2MF6A 2XSTA 3CWKA 3VG4A 1RXHA 2F01A 2CM4A 1U0XA 3CBCA 5H9AA 5AJCA 3TGAA 2WQ9A 1TXLA 4ML7B 3PQUA 2RTKA 5F7GA 2GTFX 2OY1O 3UEWA 4O4XA 3WJBA 2AT3X 4MISA 4Y5DA 1HQPA 2C1SA 4O3ZA 3CR6A 1JMZA 1LIEA 2OVAA 3BX7A 3D4RA 4GKCA 4O4SA 5FAZA 2RQ0A 4AZNA 1SWTA 4EXZA 2FKGA 2QOMA 1SRGA 5HZ9A 2JOZA 1LELA 2X55A 2JMBA 3SOTA 1ERXA 1JJUA 3P24A 1T68X 2OL7A 1EI5A 4U3QA 1VWFB 1Y55X 2CZUA 3VE2A 5HBSA 3F8AA 3P6EA 5LJCA 3T6FA 4CDDA 2AT6X 1VWDB 3STKA 5B27A 4OMXA 2LFOA 1N0SA 3C77X 1FE3A 2X34A 3Q6LA 2W2BA 5LJGA 2R74A 1KT3A 1LIFA 4HPCA 1SWQA 5AQ6A 4MVIA 3FR2A 4FBRA 2IZIA 2Z4HA 4GGTA 5CYBA 1I04A 2HMBA 4TQ2A 5IO7A 2W2AA 1OBPA 3CQRA 3RY1A 3ELXA 1EW3A 2MJIA 3FYFA 3IA8A 3Q34A 4UU2A 5FQ6E 1VWCB 5AEOA 1OBQA 3E3CA 2L5PA 4NV8A 4HPDA 4TKJA 3BS2A 3NQ9A 2OFMX 2QO4A 2X32A 4DCBA 1G5WA 4IBAA 4WHIA 1ZNGA 1QQSA 1VYOA 2JU8A 3NX1A 2FS7A 1SWEA 2OVDA 2XKLA 1TVQA 2RTOB 2FRSA 1VWIB 3O22A 1LDQA 1H91A 1SWOA 4YGZA 1GT5A 5IRWA 1OEJA 1K3BA 1I9HA 1ZNDA 3B2JA 1PMPA 5LJDA 3ZW1A 2OY5O 4Z2OA 1LKEA 2G7BA 2RTJA 3WJDA 2GH7A 4N7DA 3HWGA 1VWBB 2OFRX 3QKGA 4IRWA 4L3RA 1UREA 3EYCA 5HA1A 5HTDA 1LCVA 1VWMB 3H3IA 2E4JA 1A3YA 2QCBA 1KL3A 4YGHA 2ANSA 3V8UA 2VFBA 1B56A 3ZZVA 4HFOA 2PY1A 2RTLA 3ZW1B 5B5GA 1PM1X 4O3YA 4CV7A 4ARHA 1SY1A 1Y9LA 1EUOA 2WR6A 3MM0A 4MIRA 4NYRA 4O9SA 4ORUA 4CDCA 2BS6A 3BSZE 4O49A 1DZMA 1JQPA 4OEMA 3JQOA 2VDFA 4TKHA 3LTWA 4DQ4A 1T0VA 2F73A 4BOEA 1UZ2X 1RSUB 1OPBA 4K19A 4BVMA 2GTLN 1N4JA 2KD2A 1SREA 1W5RA 3KFIA 2GTLM 4Y0SA 1G7NA 4AZOA 4EDEA 1EALA 5H8TA 3RDMA 4MVKA 4AZMA 4OMWA 3VG3A 2FR3A 2JU3A 1HBPA 2C4IA 2OF8A 5IRUA 4KC7A 3MBTA 3WOVA 2X56A 3HWDA 1HQQA 3LV4A 3KFFA 5IXGA 1KL5A 2OL8O 1NBXA 4M7MA 1JYDA 1AVDA 4IB7A 4CK4A 1KT5A 3PP6A 2ACOA 4GJVA 3WJFA 5LKEA 3U0DA 2C1QA 3SLTA 5EEDA 1KFFA 2P8GA 3QQ2A 4Z2PA 5FENA 1SRJA 1I06A 2FTBA 3WJCA 2NNDA 1DZPA 1WUBA 2NNEA 4LZVA 4CPEA 2OY8A 3VE1A 1Y53X 1YWBA 4OS0A 1BLRA 2A13A 3VGWA 5D45A 3UAQA 1O8VA 2G78A 2OVEA 3CQNA 5D48A 4GZVA 5EDCA 1LNMA 1GT3A 1SWJA 2WPUA 3B2KA 3APUA 3OJYC 2CBSA 1N9YA 4NLIA 1MX7A 2RTEB 4MVLA 4YDBA 1TOWA 3FDCA 2A2UA 2CM9A 4PSQA 1JBHA 1RXKA 5D47A 4QGWA 3S26A 1AVGI 5LKFA 3SZHA 4O4UA 3O2YA 1STRB 2EU7X 1VWQB 4O3XB 1X8OA 1FDQA 5EEEA 1MDCA 1D2UA 2ZAIA 3VHIA 4IMOA 1GKAA 5D4AA 2PI3O 3MVFA 5KICA 4HWMA 2WUTA 5DPQA 5BVTA 3FLLA 3KFGA 4ORRA 3U03A 1SWFA 3OD9A 1GM6A 1ZNKA 2HKDA 1HBQA 3ZW0A 4Y0PA 4JNJA 2OFAA 5B10O 1FELA 1GGLA 1BEBA 4GD9A 2A2GA 4QZTA 3UEXA 1MX8A 1SWHA 1IW2A 1NDJA 2MWHA 3UEUA 1SXWA 1SWLA 1GKAB 3EMMA 4YGGA 1A2DA 1SRHA 1KT4A 4NV7A 3K3LA 3AKNA 3JS1A 4LKPA 1FEMA 2GJ5A 4AZPA 4YFQA 1E02A 1E06A 3KZAA 1T8VA 3PQSA 5FFHA 2K23A 1BBPA 1YP6A 5HCEC 1L6MA 1SWNA 3ZW0B 2X8TA 4QGVA 1YWDA 2LBVA 1K24A 3VU1A 1MEPA 2AH7X 4EKVA 4YKMA 3HPEA 1S7DA 2GC9A 1FTPA 3VG6A 3VHMA 1IFCA 4R0BA 1X89A 3FW4A 2RD7C 2IZLB 2G8CO 3ZW2A 4A1YA 4ZHDA 3NQKA 3FR5A 2MM3A 1G85A 4GNWA 1JIWI 2LBAA 2Z4IA 1RAVA 2OVSA 4ZH6A 3BLGA 2IZEB 1SLFB 2IZFB 1BRPA 1VWEB 4YDAA 1SY3A 1PBYA 2HZRA 2OL6O 5DG4A 2CBRA 2NP1A 1XKIA 5H9NA 4ZHGA 5HA0A 1VWKB 1BRQA 3VG2A 2X46A 4ZHFA 2IFBA 1VWAB 3RDOA 1KQWA 3RDUA 3ELZA 2L68A 1KL4A 2CAMA 1CRBA 2QO6A 2FHLA 4YKOA 3PECA 4A8ZA 2Q4NA 1BSQA 2A3FX 4ZHHA 1JV4A 3WZNA 4YVBA 4OS8A 4ALOA 2ZSCA 3ZQ3A 1ML7A 1ACDA 1X8UA 1KXOA 2FLJA 4ES7A 1IFBA 2I5ZO 2JW1A 2W2FA 4ORXA 1HN2A 5K06A 4GDZA 1W6FA 1S44A 2AMMX 4ON1A 2ZAGA 1Z24A 1QWDA 3NR3A 2Q2PA 2AVIA 4CPIA 3IFBA 3OBLA 3HTYA 1QY0A 2L67A 3BU9A 2K62A 2YG2A 1GX8A 3D95A 4KH8A 3ZUIA 3FEPA 4NNSA
chains in the Genus database with same CATH topology
3AEHA 3KVNA 3SLTA 3QQ2A 1UYOX 2QOMA 4MEEA 3SLJA 1UYNX 3SLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEH A;  3KVN A;  3SLT A;  3QQ2 A;  1UYO X;  2QOM A;  4MEE A;  3SLJ A;  1UYN X;  3SLO A; 
#chains in the Genus database with same CATH topology
 4U8U M;  5K67 A;  3S5X A;  1CBI A;  3D97 A;  2G79 A;  3O19 A;  3VHH A;  4NP1 A;  4DNE A;  1BJ7 A;  4A60 A;  4FBV A;  3EM0 A;  1B8E A;  1X8Q A;  2I5V O;  5CSE A;  5F6Z A;  3WBG A;  1ZNL A;  1NGL A;  4YBP A;  4CDE A;  1DF3 A;  4ZH9 A;  2RTF B;  1SWG A;  2L9C A;  4TJZ A;  2FT9 A;  2KTS A;  3FID A;  3RY2 A;  4GK9 A;  3GE2 A;  3TGB A;  4IAX A;  4YFP A;  1DFV A;  5HCD C;  3BDR A;  4ZGF A;  3PH6 A;  1YWA A;  4U46 A;  3RE6 A;  1N43 A;  1DC9 A;  1LFO A;  4WFV A;  3NPO A;  4DQ3 A;  2A0A A;  2HNX A;  3WZO A;  1ALB A;  5F2B A;  2IZK A;  4Z2V A;  4ORY A;  5KHP A;  4Y0R A;  3FW5 A;  1QAB E;  2VFC A;  3AEH A;  4QZU A;  2X45 A;  3CKG A;  1FEN A;  1B4M A;  1RLB E;  3OE3 A;  4M6S A;  4ZCB A;  5HZ6 A;  3NQ3 A;  4FBO A;  3FR4 A;  4GGZ A;  4FGI B;  4HPB A;  1EQD A;  2OYB O;  2Q39 A;  1ADL A;  2BSZ A;  1X8N A;  2WEX A;  4XME A;  4QQ1 A;  2AT5 X;  1AB0 A;  2AKQ A;  4IAW A;  5LJK A;  1MK5 A;  3FEK A;  3WXQ A;  1XCA A;  1VWG B;  2IZH B;  1VWR B;  2RTD B;  4GNY A;  3FEN A;  5IRA A;  4UU3 A;  3STM X;  4CPF A;  5LJE A;  3P6G A;  2OF9 A;  4I95 A;  4QRL A;  4TKB A;  5HZ5 A;  4IB6 A;  3VG5 A;  3T1D A;  1ICN A;  1LCW A;  4QYN A;  1AQB A;  1VYF A;  1A18 A;  4U8U O;  1SWB A;  3L4R A;  2WQA E;  4EQA C;  4MEE A;  2IZB A;  5F1E A;  5B2A O;  3PDF A;  1PBO A;  4JGL A;  2IZC B;  3I0A A;  5BVS A;  2FR2 A;  1SXU A;  4MVE A;  3FA8 A;  4BX6 B;  3HOL A;  1HY2 A;  2RTR B;  4ZFX A;  1NC9 A;  2ACP X;  2ALL X;  4B55 A;  4Z28 A;  1KZX A;  1E2T A;  5LJH A;  1KOI A;  3APW A;  4INN A;  3HWE A;  4I3C A;  4NYQ A;  4BX5 B;  1CBS A;  1WBI A;  3JSQ A;  2G5L A;  2Y3F A;  4ZJ0 A;  3FIQ A;  2OZQ A;  4GJS A;  1LUQ A;  1R0U A;  4L1N A;  3TZS A;  1PTS A;  1JJJ A;  5HZ8 A;  2RCQ A;  1NQN A;  1YWC A;  4NLJ A;  4QGX A;  4YH0 A;  5C0N A;  2ASN X;  4NNT A;  4D6A A;  3RSW A;  1KZW A;  4GUZ A;  5EPQ A;  5HCC C;  1ZRY A;  3KVN A;  3NAD A;  3NX2 A;  4TLJ A;  1QG5 A;  1SA8 A;  4YCE A;  2HZQ A;  2WSJ A;  3WZP A;  1O1U A;  1CBR A;  2HLV A;  1SY2 A;  4AYH A;  4C5P A;  4IAB A;  4YMY A;  3RKG A;  4GE1 A;  4I3B A;  1E5P A;  1TOU A;  3N91 A;  1B0O A;  1ERB A;  1SWA A;  2RTP B;  1LF7 A;  2RTG B;  1YP7 A;  1SY0 A;  5F58 A;  1SWK A;  3RZY A;  2JU7 A;  2LA7 A;  2RTN B;  3EBW A;  2LKK A;  4GRJ A;  1EPA A;  2R73 A;  4O4O A;  2FKJ A;  4QNI A;  1X71 A;  2QMI A;  1STS B;  1S2P A;  3EBK A;  3X00 A;  1VWJ B;  3CKF A;  2X8F A;  4ALB A;  1O1V A;  1NP1 A;  1SWC A;  4OEL A;  1VWO B;  3SLO A;  1EXS A;  5AJB A;  2RTI B;  1KT6 A;  3CMP A;  3P6F A;  1MOY A;  5L8O A;  5L8N A;  2Y32 A;  3WJG A;  4IB8 A;  3T6L A;  1MVG A;  2MHD A;  4ZR2 A;  4XMD A;  2KT4 B;  1SLE B;  3FMZ A;  3WYP A;  1DZK A;  1VWH B;  2X4M A;  3HOE A;  4ID2 A;  2WWP A;  2OFB A;  3P6C A;  5HWZ A;  4KII A;  3G7X A;  2YMS A;  2HYS A;  3SZJ A;  5IO6 A;  2OY7 A;  2QM9 A;  1SWU A;  4AZR A;  1E00 A;  2IZJ A;  3BY0 A;  3S60 A;  4AW8 A;  2RTM A;  4BGF A;  3I17 A;  1EIO A;  3MX7 A;  1JJX A;  4N7C A;  1AEL A;  3B2L A;  1N9M A;  2F09 A;  2N93 A;  1SRI A;  3C78 X;  4I9R A;  3D96 A;  5B11 O;  3RDQ A;  4XMH A;  4BBO A;  3BRN A;  4KCA A;  5L3Y A;  1GT4 A;  4EEJ A;  1IJ8 A;  1KT7 A;  3TGC A;  4GU8 A;  4ODD A;  4XMG A;  5HTE A;  3FA7 A;  1W4T A;  3P6D A;  4ORW A;  4XMC A;  1DV9 A;  5L8I A;  4OS3 A;  1ZNE A;  1SLD B;  3MG5 A;  5H9K A;  5BVQ A;  2AL0 X;  2RTH B;  3T2X A;  4GDA A;  4Y0Q A;  1SXX A;  1QFT A;  1BSO A;  1GX3 A;  5KID A;  2DM5 A;  2CZT A;  1CJ5 A;  1AVE A;  1KQX A;  5HZQ A;  2LB6 A;  4XMF A;  2RCT A;  3F9D A;  4YCH A;  1VWL B;  3F6Z B;  3EW1 A;  1ICM A;  2A5C A;  1SWS A;  1Y0G A;  1HXZ A;  1Y9T A;  4IB9 A;  4U8U N;  3VPJ E;  4Y59 A;  2IZA A;  2UYW A;  4I60 A;  1MUP A;  4RUN A;  3RDS A;  2BHV A;  1BSY A;  1GX9 A;  1DF8 A;  4TNN A;  4OKA A;  3RDX A;  3WZQ A;  2BS5 A;  1OSP O;  4AZQ A;  1HMT A;  5JD2 A;  4RUU A;  4BX7 A;  3BX8 A;  1I05 A;  3FEL A;  2BT9 A;  4LZU A;  4ORS A;  2FS6 A;  2FWV A;  2JGS A;  1NP4 A;  1U17 A;  2JN3 A;  2A8G A;  2O62 A;  3LHN A;  2RTB B;  1SLG B;  1P6P A;  3HK1 A;  3T2W A;  2IZD B;  1IKJ A;  3PH5 A;  1HXL A;  3TF6 A;  1HMR A;  4FQB B;  1BWY A;  1EII A;  5F6B A;  3BU1 A;  4Z6J A;  2MO5 A;  3VG7 A;  3U9P C;  1OPA A;  3ZWE A;  2RTC B;  5K68 A;  4BX7 B;  5CE4 A;  3UEV A;  4ZHC A;  3APV A;  2NNQ A;  3RWX A;  2QOS C;  2RA6 A;  1CBQ A;  1GXA A;  3D9W A;  1OBU A;  3RE5 A;  1BM5 A;  2DJF A;  1U18 A;  1LIC A;  1LIB A;  1SXY A;  2POA A;  3B2I A;  4JO6 A;  5IO5 A;  1LID A;  2KTD A;  3DSZ A;  1SWD A;  2RN4 A;  4YBU A;  3AKM A;  2AT0 X;  4LKT A;  1YIV A;  1PEE A;  3DTQ A;  3SAO A;  1QFV A;  2IZG B;  2RTQ B;  3FA6 A;  3PED A;  4GH7 A;  3RBY A;  1IIU A;  1QY1 A;  4BX6 A;  1SWP A;  1LCZ A;  1UYO X;  2UZ2 A;  4WBK A;  4KT5 A;  3S5V A;  3KQ0 A;  1RST B;  5CHK A;  4GGR A;  2X8S A;  1IKE A;  5EDB A;  3EW2 A;  3P6H A;  5H9L A;  4BX5 A;  4D6B A;  4CDF A;  1N7Y A;  1SWR A;  1ZNH A;  3P02 A;  5EZ2 A;  3NP1 A;  1LDO A;  3AUM O;  4LQZ A;  1JYJ A;  4I6S A;  4BCS A;  2Q2M A;  1SRF A;  1FJ1 E;  2Q9S A;  2A5B A;  4Z27 A;  3WJE A;  4O3W A;  3WVM A;  4QYP A;  3APX A;  5B5F A;  1TW4 A;  2FHN X;  2AF5 A;  3HWF A;  4NW4 A;  2R56 A;  4WFU A;  4U9C A;  1OEE A;  5B3M O;  1YUP A;  2M4L A;  3SZI A;  3PPT A;  1STP A;  2FGS A;  1A57 A;  4YFR A;  1VPR A;  3EC5 A;  4QAE A;  4BQU A;  4CPH A;  4BJ8 A;  4I3D A;  3B2H A;  4PJ2 A;  4IMN A;  1X8P A;  5D8J A;  4KC8 A;  3PK2 A;  1Y52 X;  1RXJ A;  2WEW A;  3GAQ A;  4GET A;  1VWN B;  1I4U A;  1JZU A;  3SLJ A;  2DJG A;  2Y3E A;  4A1H A;  1QY2 A;  5FQ7 E;  1SMP I;  4EFG A;  1EPB A;  4ZGU A;  5HAE A;  1HMS A;  3ZUO A;  1KGL A;  2QO5 A;  1VWP B;  3CBS A;  1LPJ A;  1I78 A;  2BLG A;  2RTA A;  3NBX X;  4JHQ A;  4COT A;  4I9S A;  1NQM A;  1GT1 A;  2AT8 X;  2BC3 A;  3C76 X;  4CPH B;  5BYP A;  3KFH A;  3FA9 A;  4HPA A;  1RBP A;  3WYQ A;  3STN A;  1DZJ A;  5JR8 A;  5B29 A;  1MM9 A;  1OEK A;  5LJB A;  5FQ8 E;  1UYN X;  1G74 A;  1JMX A;  3ZI8 A;  1VYG A;  2GTL O;  1D3S A;  2KW1 A;  4CSB A;  2MF6 A;  2XST A;  3CWK A;  3VG4 A;  1RXH A;  2F01 A;  2CM4 A;  1U0X A;  3CBC A;  5H9A A;  5AJC A;  3TGA A;  2WQ9 A;  1TXL A;  4ML7 B;  3PQU A;  2RTK A;  5F7G A;  2GTF X;  2OY1 O;  3UEW A;  4O4X A;  3WJB A;  2AT3 X;  4MIS A;  4Y5D A;  1HQP A;  2C1S A;  4O3Z A;  3CR6 A;  1JMZ A;  1LIE A;  2OVA A;  3BX7 A;  3D4R A;  4GKC A;  4O4S A;  5FAZ A;  2RQ0 A;  4AZN A;  1SWT A;  4EXZ A;  2FKG A;  2QOM A;  1SRG A;  5HZ9 A;  2JOZ A;  1LEL A;  2X55 A;  2JMB A;  3SOT A;  1ERX A;  1JJU A;  3P24 A;  1T68 X;  2OL7 A;  1EI5 A;  4U3Q A;  1VWF B;  1Y55 X;  2CZU A;  3VE2 A;  5HBS A;  3F8A A;  3P6E A;  5LJC A;  3T6F A;  4CDD A;  2AT6 X;  1VWD B;  3STK A;  5B27 A;  4OMX A;  2LFO A;  1N0S A;  3C77 X;  1FE3 A;  2X34 A;  3Q6L A;  2W2B A;  5LJG A;  2R74 A;  1KT3 A;  1LIF A;  4HPC A;  1SWQ A;  5AQ6 A;  4MVI A;  3FR2 A;  4FBR A;  2IZI A;  2Z4H A;  4GGT A;  5CYB A;  1I04 A;  2HMB A;  4TQ2 A;  5IO7 A;  2W2A A;  1OBP A;  3CQR A;  3RY1 A;  3ELX A;  1EW3 A;  2MJI A;  3FYF A;  3IA8 A;  3Q34 A;  4UU2 A;  5FQ6 E;  1VWC B;  5AEO A;  1OBQ A;  3E3C A;  2L5P A;  4NV8 A;  4HPD A;  4TKJ A;  3BS2 A;  3NQ9 A;  2OFM X;  2QO4 A;  2X32 A;  4DCB A;  1G5W A;  4IBA A;  4WHI A;  1ZNG A;  1QQS A;  1VYO A;  2JU8 A;  3NX1 A;  2FS7 A;  1SWE A;  2OVD A;  2XKL A;  1TVQ A;  2RTO B;  2FRS A;  1VWI B;  3O22 A;  1LDQ A;  1H91 A;  1SWO A;  4YGZ A;  1GT5 A;  5IRW A;  1OEJ A;  1K3B A;  1I9H A;  1ZND A;  3B2J A;  1PMP A;  5LJD A;  3ZW1 A;  2OY5 O;  4Z2O A;  1LKE A;  2G7B A;  2RTJ A;  3WJD A;  2GH7 A;  4N7D A;  3HWG A;  1VWB B;  2OFR X;  3QKG A;  4IRW A;  4L3R A;  1URE A;  3EYC A;  5HA1 A;  5HTD A;  1LCV A;  1VWM B;  3H3I A;  2E4J A;  1A3Y A;  2QCB A;  1KL3 A;  4YGH A;  2ANS A;  3V8U A;  2VFB A;  1B56 A;  3ZZV A;  4HFO A;  2PY1 A;  2RTL A;  3ZW1 B;  5B5G A;  1PM1 X;  4O3Y A;  4CV7 A;  4ARH A;  1SY1 A;  1Y9L A;  1EUO A;  2WR6 A;  3MM0 A;  4MIR A;  4NYR A;  4O9S A;  4ORU A;  4CDC A;  2BS6 A;  3BSZ E;  4O49 A;  1DZM A;  1JQP A;  4OEM A;  3JQO A;  2VDF A;  4TKH A;  3LTW A;  4DQ4 A;  1T0V A;  2F73 A;  4BOE A;  1UZ2 X;  1RSU B;  1OPB A;  4K19 A;  4BVM A;  2GTL N;  1N4J A;  2KD2 A;  1SRE A;  1W5R A;  3KFI A;  2GTL M;  4Y0S A;  1G7N A;  4AZO A;  4EDE A;  1EAL A;  5H8T A;  3RDM A;  4MVK A;  4AZM A;  4OMW A;  3VG3 A;  2FR3 A;  2JU3 A;  1HBP A;  2C4I A;  2OF8 A;  5IRU A;  4KC7 A;  3MBT A;  3WOV A;  2X56 A;  3HWD A;  1HQQ A;  3LV4 A;  3KFF A;  5IXG A;  1KL5 A;  2OL8 O;  1NBX A;  4M7M A;  1JYD A;  1AVD A;  4IB7 A;  4CK4 A;  1KT5 A;  3PP6 A;  2ACO A;  4GJV A;  3WJF A;  5LKE A;  3U0D A;  2C1Q A;  3SLT A;  5EED A;  1KFF A;  2P8G A;  3QQ2 A;  4Z2P A;  5FEN A;  1SRJ A;  1I06 A;  2FTB A;  3WJC A;  2NND A;  1DZP A;  1WUB A;  2NNE A;  4LZV A;  4CPE A;  2OY8 A;  3VE1 A;  1Y53 X;  1YWB A;  4OS0 A;  1BLR A;  2A13 A;  3VGW A;  5D45 A;  3UAQ A;  1O8V A;  2G78 A;  2OVE A;  3CQN A;  5D48 A;  4GZV A;  5EDC A;  1LNM A;  1GT3 A;  1SWJ A;  2WPU A;  3B2K A;  3APU A;  3OJY C;  2CBS A;  1N9Y A;  4NLI A;  1MX7 A;  2RTE B;  4MVL A;  4YDB A;  1TOW A;  3FDC A;  2A2U A;  2CM9 A;  4PSQ A;  1JBH A;  1RXK A;  5D47 A;  4QGW A;  3S26 A;  1AVG I;  5LKF A;  3SZH A;  4O4U A;  3O2Y A;  1STR B;  2EU7 X;  1VWQ B;  4O3X B;  1X8O A;  1FDQ A;  5EEE A;  1MDC A;  1D2U A;  2ZAI A;  3VHI A;  4IMO A;  1GKA A;  5D4A A;  2PI3 O;  3MVF A;  5KIC A;  4HWM A;  2WUT A;  5DPQ A;  5BVT A;  3FLL A;  3KFG A;  4ORR A;  3U03 A;  1SWF A;  3OD9 A;  1GM6 A;  1ZNK A;  2HKD A;  1HBQ A;  3ZW0 A;  4Y0P A;  4JNJ A;  2OFA A;  5B10 O;  1FEL A;  1GGL A;  1BEB A;  4GD9 A;  2A2G A;  4QZT A;  3UEX A;  1MX8 A;  1SWH A;  1IW2 A;  1NDJ A;  2MWH A;  3UEU A;  1SXW A;  1SWL A;  1GKA B;  3EMM A;  4YGG A;  1A2D A;  1SRH A;  1KT4 A;  4NV7 A;  3K3L A;  3AKN A;  3JS1 A;  4LKP A;  1FEM A;  2GJ5 A;  4AZP A;  4YFQ A;  1E02 A;  1E06 A;  3KZA A;  1T8V A;  3PQS A;  5FFH A;  2K23 A;  1BBP A;  1YP6 A;  5HCE C;  1L6M A;  1SWN A;  3ZW0 B;  2X8T A;  4QGV A;  1YWD A;  2LBV A;  1K24 A;  3VU1 A;  1MEP A;  2AH7 X;  4EKV A;  4YKM A;  3HPE A;  1S7D A;  2GC9 A;  1FTP A;  3VG6 A;  3VHM A;  1IFC A;  4R0B A;  1X89 A;  3FW4 A;  2RD7 C;  2IZL B;  2G8C O;  3ZW2 A;  4A1Y A;  4ZHD A;  3NQK A;  3FR5 A;  2MM3 A;  1G85 A;  4GNW A;  1JIW I;  2LBA A;  2Z4I A;  1RAV A;  2OVS A;  4ZH6 A;  3BLG A;  2IZE B;  1SLF B;  2IZF B;  1BRP A;  1VWE B;  4YDA A;  1SY3 A;  1PBY A;  2HZR A;  2OL6 O;  5DG4 A;  2CBR A;  2NP1 A;  1XKI A;  5H9N A;  4ZHG A;  5HA0 A;  1VWK B;  1BRQ A;  3VG2 A;  2X46 A;  4ZHF A;  2IFB A;  1VWA B;  3RDO A;  1KQW A;  3RDU A;  3ELZ A;  2L68 A;  1KL4 A;  2CAM A;  1CRB A;  2QO6 A;  2FHL A;  4YKO A;  3PEC A;  4A8Z A;  2Q4N A;  1BSQ A;  2A3F X;  4ZHH A;  1JV4 A;  3WZN A;  4YVB A;  4OS8 A;  4ALO A;  2ZSC A;  3ZQ3 A;  1ML7 A;  1ACD A;  1X8U A;  1KXO A;  2FLJ A;  4ES7 A;  1IFB A;  2I5Z O;  2JW1 A;  2W2F A;  4ORX A;  1HN2 A;  5K06 A;  4GDZ A;  1W6F A;  1S44 A;  2AMM X;  4ON1 A;  2ZAG A;  1Z24 A;  1QWD A;  3NR3 A;  2Q2P A;  2AVI A;  4CPI A;  3IFB A;  3OBL A;  3HTY A;  1QY0 A;  2L67 A;  3BU9 A;  2K62 A;  2YG2 A;  1GX8 A;  3D95 A;  4KH8 A;  3ZUI A;  3FEP A;  4NNS A; 
#chains in the Genus database with same CATH homology
 3AEH A;  3KVN A;  3SLT A;  3QQ2 A;  1UYO X;  2QOM A;  4MEE A;  3SLJ A;  1UYN X;  3SLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...