3SM3A

Crystal structure of sam-dependent methyltransferases q8puk2_metma from methanosarcina mazei. northeast structural genomics consortium target mar262.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
b'LDLYPIIHNYLQEDDEILDIGCGSGKISLELASKGYSVTGIDINSEAIRLAETAARSPGLNQKTGGKAEFKVENASSLSFHDSSFDFAVMQAFLTSVPDPKERSRIIKEVFRVLKPGAYLYLVEFGQNWHLKLYRKRYLHDFPITKEEGSFLARDPETGETEFIAHHFTEKELVFLLTDCRFEIDYFRVKELETRTGNKILGFVIIAQKLLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferases
molecule tags Transferase
source organism Methanosarcina mazei
publication title Crystal Structure of SAM-dependent methyltransferases Q8PUK2_METMA from Methanosarcina mazei.
rcsb
total genus 67
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2011-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3sm3A00
2R3SA 3LGAA 3AJDA 4EKGA 4RTKA 5ERGB 1R74A 5H02A 4QQKA 2B3TA 2C7QA 2P3OA 1N7IA 5EKXA 1FP1D 4RTMA 2Q41A 1TPYA 1R00A 2IGTA 2PT9A 4IKPA 2P7IA 3TM5A 2ZCJA 1NW8A 3LDFA 2UYHA 1MJFA 1PRYA 2H11A 1RI4A 4AZSA 4FGZA 4ER5A 3CBGA 4POOA 2NP7A 1EQAA 2ESRA 3M6XA 4RX1A 2AOVA 4DM3A 5K03A 3FUWA 3SSNA 2BM9A 3T7SA 5CUQA 1ZHFA 5EOVA 4FZVA 1QAQA 3A4TA 4P7JA 1P1CA 5HIIA 3CJTA 2B2CA 3EGVA 2XYRA 4HTFA 4RTLA 1WXWA 3C3YA 4MHTA 5EMLA 1KXZA 5F2NA 2DULA 5CVDA 3T7TA 1JTEA 2ZIGA 3IHTA 4PGHA 3MAGA 3NTVA 3EVGA 1G55A 5F2KA 3LX6A 4EMSA 2YUIA 2OB2A 2PBFA 5LQAA 3TQSA 4YMHA 3PFGA 5LQJA 2YVLA 3BZBA 2AOUA 2G71A 2IPXA 2PX8A 2JG3A 2Z6UA 3I9FA 3KQVA 5DSTA 1X1AA 5FQOA 2Y1WA 5EKUA 4YUXA 2OKCA 2GAFA 2PT6A 3B89A 2CMGA 2VDVE 3ELYA 3LSTA 5GIPE 3D2LA 1JG4A 4OX9Y 5FTWA 1IM8A 3DTNA 5T64A 4Y2HA 5CVJA 3G5LA 3THRA 5DTRA 4LWPA 5CM2Z 3EEYA 5BXYA 4BP1A 2AOWA 3UJBA 1R18A 2FK7A 5EZQA 4PONA 3B5IA 4C07A 2FPOA 5C0OE 3VC2A 10MHA 3EVAA 3SSMA 3BGIA 2ONZA 5EVJA 1R6AA 2YQZA 1AQIA 1KR5A 2ERCA 3A25A 2I7CA 4E2XA 5CIYA 3FPGA 2ZZNA 4HRAA 3DR5A 4QDJA 2P35A 3R0QA 4HTFB 4E70A 4GOOD 4KIGA 2FYTA 3EGIA 3V8VA 2I9KA 5EZSA 2ZSUA 1IXKA 3GXOA 5T6BA 5KQRA 3A27A 4QVKA 3HTXA 4PCAA 3Q87B 4DCMA 3SM3A 4MWZA 3VC1A 3CJRA 4Z2YA 3FTDA 3TM4A 2AZTA 3KPJA 3LPMA 4DMGA 4V0RA 3EVDA 3BUSA 3GRZA 3KQWA 1XCLA 2PXAA 4ISCA 1WZNA 1KIAA 1RJEA 3R6TA 2E5WA 4RVFA 5EHGA 4HGZA 4YUWA 5E1MA 4DZRA 5K0JA 3UJDA 3QOWA 5G02A 1NBIA 4C05A 2OPBA 2ZLBA 2JHPA 3FYCA 1O54A 4OQEA 4C4AA 2OO3A 2AOTA 3OPNA 4QQNA 4RTQA 1KYWA 3LCVB 4ER3A 1RI5A 5DT2A 3TPZA 2WA2A 1L3CA 4KIFA 3MHTA 2CKDA 4RVGA 4AUKA 2VZ9A 4RVDA 4PNEA 2OZVA 4FR0A 1G6Q1 5ICGA 1D2HA 1KPHA 4E30A 5FHRA 5EG5A 4GOLD 3WSTA 4HSGA 5JUWA 3P2KA 1RJDA 3CJQA 1NV8A 3LKDA 5DPMA 5K0BA 2VS1A 3E8SA 3KU1A 1M6YA 3B7PA 3DLIA 3KQSA 1NT2A 3MTIA 4GOND 3HEMA 3MCZA 3P9NA 3JWGA 3V97A 5DWQA 3HA7A 4LWOA 5LQCA 2P7HA 2AOTB 2OY0A 2GA9A 1BKYA 2JH9A 5K01A 1VIDA 1R8YA 3S68A 5BW5A 1T43A 5K0GA 4PYMA 2QY6A 3O31A 3GRRA 2IP2A 1XCJA 2P1DA 1VLMA 1JSZA 4WXHA 5C1IA 5CVEA 5HFJA 3PVCA 4GOMD 2O05A 3BWBA 3G5TA 4ATNA 1INLA 2IH5A 5EPEA 2NXEA 4C06A 5EIWA 5GINE 3SXJA 3G89A 5CCXA 3DOUA 3KQQA 4CTKA 2ONYA 3JWJA 2AS0A 2QM3A 1Y8CA 2EFJA 3T7RA 4P7FA 4F85A 5HIKA 4HG2A 3THSA 2CL5A 3SMQA 2G72A 2PGXA 4CXMA 2O57A 4RTSA 3SR4A 5FWAA 2IDKA 2YXEA 4F86A 4GC9A 4EK9A 3UA4A 3DXYA 2XBMA 4OA8A 1M0EA 3LBFA 5FULA 4MQ4A 5KYGA 2P8JA 2F8LA 3HVJA 5U4XA 5DX0A 2PJDA 3FRHA 5CVVA 5D1HA 5DX8A 3GRVA 3HVKA 2FCAA 3JWIA 4IV8A 4EQZA 1WY7A 1HNNA 3ELUA 3OE4A 2XYQA 2Y1XA 1X1DA 5GIOE 3FUVA 3NMUF 1JQDA 2CWWA 3HM2A 3ELWA 3R24A 2AVDA 4QDKA 4R6WA 1EIZA 3MGGA 3P2EA 4YV0A 3TMAA 2ZFUA 5DTMA 1I4WA 4X60A 2JH8A 4CKEA 5DLYA 5FCDA 1SVUA 4YUYA 4E2YA 4U7TB 3TFWA 4P7GA 1WG8A 5EHIA 1EJ0A 3BT7A 5DRYA 4AZVA 3GJYA 3BWYA 5FHQA 2ZBPA 4FSXA 4FSDA 4YMGA 3ID6C 3DMGA 3HCDA 5K0LA 2EJTA 4LG1A 2ZZMA 3B3JA 4OBXA 3LECA 1NBHA 4QPPA 5EQJB 2OYRA 1ZQ9A 3DUWA 3PX3A 3PFHA 4PIPA 3GRYA 4RTJA 3B3FA 2PXCA 4M37A 4PYLA 4QTUB 7MHTA 2NXNA 3EMBA 3EPPA 5E2BA 4RVHA 3VYWA 5K8VA 3FZGA 3MTEA 3OZTA 4X61A 2I6GA 4RTNA 2UZ4A 5IKMA 5K0EA 3AWIA 4F84A 4DA4A 1D2GA 3HCCA 3I53A 3GGDA 5DTQA 1JG2A 1XVAA 3TRKA 3G7UA 4HGYA 4PWYA 4A6DA 2Z6QA 1JQ3A 4EKIA 4EVIA 5LQRA 5LSAA 2UYQA 3EVZA 1ZG3A 3LCCA 1BC5A 4LECA 4RTOA 3DXZA 3B3GA 3HCEA 1KP9A 3O7WA 1R8XA 3HCFA 1JG3A 3M4XA 2AVNA 3NVMB 3DP7A 3QOXA 1FBNA 5GP1A 1L3IA 5HEKA 3HCBA 3TKAA 2ZTHA 1VPTA 4JXJA 3GDHA 5D1NA 1YB2A 1RI1A 2PSSA 2PX4A 1VP3A 4X1OA 3IEIA 3OU2A 4GC5A 1FP2A 1UIRA 2PKWA 4ZTBA 3ORHA 2GH1A 4FS8A 4OA5A 2NYUA 4AZWA 5LR6A 3DMHA 2H00A 3KHKA 3GWZA 4E31A 5K0CA 1TW3A 2P3QA 2JHAA 3G8AA 2AN4A 5E9WA 1Q0TA 1JR4A 3CCFA 2H1RA 3UJAA 2C7OA 1NE2A 2B78A 3FPFA 5E1BA 3EVBA 3BWCA 5HILA 5C9ZA 4KWCA 5LQNA 2HTEA 1JTFA 2BR5A 1HMYA 1QYRA 4XUCA 3OZSA 2AR0A 2QYOA 5DM2A 2HMYB 3FPEA 3KQPA 3LDUA 3AXSA 3FUUA 2PWPA 1VQ1A 3KQYA 2ORED 2QRVB 3R9XB 1VL5A 3BWMA 3NDJA 1G8AA 4KDRA 3FYDA 3G2QA 2FRXA 1G60A 1SUSA 5HOQA 4G56A 3VSEA 3DMFA 1EAMA 3FPJA 3PLAE 4RYLA 1SQGA 1VP9A 1ORHA 2AOUB 2JJQA 3C6MA 4ER6A 1YFLA 4HC4A 2P3LA 3PS9A 5FA5A 3FPHA 4CWAA 2GS9A 3LKZA 1O9GA 3M6WA 1TW2A 4E32A 4U7PB 2AOXA 4WVLA 4RTPA 1N2XA 3NW9A 4UOEA 4OQDA 3EEOA 1XDSA 3OU7A 2VDUE 5GM2A 1ORIA 1U2ZA 5DX1A 4ER7A 2QRVA 3U81A 4KRGA 4CTJA 3UJ7A 3GIWA 5DM0A 2OBFA 5EIFA 5E2AA 3M33A 4XCXA 1JG1A 4R05A 3ER9A 4CKBA 5CCBA 3ERCA 1KYZA 4OBWA 4IWNA 3KPUA 3P2IA 3UBTA 2I62A 3PB3A 4HH4A 3SVZA 5KQSA 3O4FA 1L3BA 2NXJA 3TR6A 4C03A 3OFKA 1AQJA 5E1OA 3G2OA 2N47A 3K6RA 5EEGA 3REOA 3P9CA 4QVGA 5DRTA 3SX0A 3K0BA 4ER0A 3NVKI 1ZKDA 1YUBA 4YV2A 5HIJA 5EMMA 1EG2A 3KPVA 2IH2A 4GF5A 5BW4A 4PYOA 2HWKA 3EVFA 3HP7A 2G70A 1I1NA 3KR9A 4B17A 2V74B 1DUSA 2NP6A 3DH0A 2PLWA 4BY9E 5DSXA 4RV9A 3PX2A 5EGSA 2G1PA 3RW9A 5FWDA 3TKYA 4BLVA 3BKWA 8MHTA 3T0IA 2IBTA 4K6MA 1V39A 5E9JA 4R8RA 4QTTB 2ZVJA 3LHDA 2P40A 4R6XA 2OXTA 3MCTA 1XJ5A 4L7VA 3UJ8A 5DXJA 1QAOA 3KPWA 3ER8A 4X41A 3F4KA 3GU3A 1F3LA 3FTEA 3E7PA 3SGLA 3FTFA 3MQ2A 3OCJA 3R3HA 3NWBA 2YXDA 3FUTA 2ZZKA 5DXAA 2ADMA 4RTRA 1P39A 2B25A 1QANA 2KW5A 2PV0A 2YR0A 3FTCA 3HVIA 3NWEA 3GRUA 1DL5A 4GEKA 9MHTA 3A7DA 2UYOA 5LQUA 3SSOA 2ZWVA 3MERA 2YX1A 4DCGA 3AY0A 4AX8A 4GBED 1XDZA 2IIPA 3CGGA 5HIMA 3UWPA 1KPGA 5CVUA 4DKJA 1XXLA 1NW5A 1ZGAA 4XUDA 3M6VA 3H2BA 4E33A 4FT2A 3A26A 1XTPA 2PY6A 3P8ZA 4YUZA 5HZMA 2Z6AA 2ZIFA 1UFKA 2WK1A 4H0NA 1IY9A 3NJRA 1L1EA 3TOSA 3CKKA 1BOOA 1X1CA 1QAMA 4X63A 1L9KA 4RWZA 3LBYA 1VBFA 5JR3A 3OE5A 4PYJA 1B42A 1RI3A 2HV9A 3M6UA 5B1SA 4DQ0A 3E05A 5P8WA 1AF7A 5KS2A 5FADA 3HNRA 5E8JA 2HR1A 2YTZA 5K09A 3CVOA 4BLUA 2BR3A 1D2CA 5ICEA 1O9HA 3PT9A 2PX2A 3MB5A 3HCAA 1NW3A 2ZIEA 1UWVA 2IFTA 1H1DA 4PYQA 4CKCA 2IH4A 5EC8A 1YFJA 3ME5A 5LQKA 1SQFA 4PINA 4BP3A 2R6ZA 2VDWA 4O29A 5IH3A 1RJGA 2ZW9A 2YXLA 3G2MA 1OR8A 5DM1A 2OB1A 2GLUA 1N7JA 5GWXA 2C7PA 1NKVA 3AXTA 2PXXA 5K0FA 1XDUA 3UA3A 2IDJA 3M70A 5K0NA 1PJZA 3UFBA 2LD4A 3I58A 3UJ6A 1BHJA 2NXCA 1KHHA 5E8RA 2DPMA 2XYVA 2GB4A 3BXOA 2ZULA 5KVAA 5E9QA 5MHTA 3P9IA 1SUIA 4C08A 4DF3A 4KDCA 1G8SA 3FRIA 1EJ6A 3IV6A 2XVMA 4XUEA 1WS6A 2FHPA 4KW7A 2ZBQA 5ICFA 3G8BA 4C04A 3HA5A 3IYLW 3FUXA 3CC8A 3HVHA 3L8DA 3KQOA 3KPYA 5GM1A 2B9EA 5BP7A 3E23A 2CMHA 5T67A 2QE6A 1NW6A 3ANXA 3DULA 4FT4A 4GQBA 2HNKA 3NDIA 3EGEA 5FQNA 2UYCA 3HA3A 5M5BA 3OZRA 1WXXA 3RODA 1VE3A 2O07A 3P71T 2BR4A 4P7KA 1YF3A 4P58A 1FJXA 4PYKA 4KVZA 1AV6A 2GPYA 4YV1A 3I5UA 1RI2A 4PIMA 4IV0A 2K4MA 1P91A 2XVAA 5EEHA 2AN3A 2JHCA 4A6EA 5K05A 1P1BA 1YZ3A 1KPIA 2EX4A 3PTAA 1FPQA 1SG9A 4Y30A 4V0QA 2O0LA 3KQTA 4E2ZA 4M36A 1M6EX 3BGVA 5E1DA 1DCTA 4AZTA 3C3PA 2PVCA 4YUVA 1F38A 3LL7A 1ZGJA 4M38A 5FA8A 2BH2A 3P97A 1QZZA 1X1BA 2FK8A 2VP3A 5CD1A 2G8NA 3GCZA 4PCLA 3TLJA 1JQEA 3LDGA 4QPNA 3Q7EA 2BZGA 4PYIA 1JSXA 3KR1A 2WA1A 3OFJA 4E2WA 3BKXA 3A7EA 2O06A 4MIKA 2IBSA 2EJUA 1Q0SA 3EMDA 2NNWB 4NECA 4GUAA 2A14A 5EMKA 2V7EA 4R8SA 3UZUA 2ZWAA 3DLCA 3DXXA 3C6KA 3EVEA 3G2PA 4PYNA 4MTLA 5F2OA 3RIEA 3JWHA 3ELDA 5FUBA 3KQMA 5ICCA 3QV2A 1YZHA 2PX5A 2BM8A 1NW7A 3EVCA 3KR0A 1G38A 5EMJA 3LCUA 2C7RA 1X19A 2AN5A 3G88A 3P9KA 3KKZA 2EG5A 3OU6A 2ZBRA 5DM4A 4RSRA 3UJCA 3GNLA 1SKMA 3UJ9A 4FP9A 4PGGA 4BLWA 1MHTA 1RJFA 3I64A 2PWYA 5GOZA 1I9GA 3KR2A 1Z3CA 2P41A 4M7RA 3GO4A 3C0KA 1NV9A 3X0DA 3BGDA
chains in the Genus database with same CATH superfamily
3LGAA 4J0FA 3TNFA 3SYMA 1MKYA 5EJFA 5ITZA 3INTA 1P7WA 4OQ4A 5TIIA 1XHFA 2PANA 4ME6A 3K8ZA 3I61A 1UBRS 4E5NA 1JZQA 1J8VA 4L9RA 1R00A 2I34A 2GJSA 2P7IA 1ZW1A 1OAOC 2WG2A 4B48A 4CEJA 3TDNA 4GMHA 1OIWA 1KZ7B 1SWVA 1C1DB 4RANA 4QUHA 5FWXA 4EB6B 4EG1A 5DCLA 1Z6XA 2L18A 1T3ZA 4AF7A 4EO9A 3DBIA 2BM9A 1NNEA 1DAKA 2XEDA 3F3YA 2V7VA 5CUQA 2C42A 3W5SA 1VPEA 3PT5A 3U80A 4KXLA 4D25A 1IBMB 2WJ6A 2CV0A 4PPYA 4MYTA 3U3XA 1G5TA 2IEBA 5EMLA 4JT4A 3ADPA 3GJ4A 3RRMA 3W3AH 1UJMA 3IUBA 2YOHA 4XD7A 2CDAA 4DDUA 3CW8X 1SXIA 1WQ1R 2XT6A 1SM4A 2BFCB 3TAHA 1YOBA 1NVVQ 4EQ6A 1O5TA 3RH0A 3TRJA 3WB9A 2Z95A 4ZT2A 3VTFA 4NLLA 5MDHA 2VDRB 1XC7A 2EL7A 4JQSA 4J1TA 1X1AA 3JQCA 4A23A 1Z74A 4UUNA 3R0VA 4MV8A 5LOVA 2W8BA 5FV7A 4RULA 5B3AA 1PT9A 1PV2A 2KQUA 4O5OA 1H2RS 3AB8A 4HDCA 3ZWYA 3CLUD 1A9TA 5JSKA 3KXIA 4JGGA 4MVJA 3EXFA 5CM2Z 2HIAA 4XWGA 4GXQA 1CJUC 1Z5OA 2VSFA 1GZHB 4OQNA 1P62B 4F72A 5M2QA 1V4BA 2WHPB 3BGIA 1D1SA 2BMVA 4QBIA 4KR6A 3GP5A 1ACJA 1HR0B 1DXHA 1X1EA 3D4LA 3WYCA 3FM9A 1XTTA 2C54A 4BN5A 1C4XA 4LYYA 1V37A 4I9HA 3C7KA 4WKOA 1ORVA 3HTXA 1ILWA 2AJBA 4X5OA 4BVGA 1UZNA 2PX3A 3IVRA 4N5DA 2PUGA 1VLLA 4DMRA 3E7WA 2AI2A 5L3SB 4R3UC 1AQLA 3CF4A 5FUWA 2OG1A 4RHFA 5FFFA 5K3BA 5JEDA 2PXAA 1GPLA 3RPEA 1NJ1A 4LGVA 2PSFA 3CEMA 5JAHA 2Q4OA 4N9WA 5TMPA 4X6LA 3ITDA 1EGAA 3ZLBA 4ZVNA 4ZT5A 4ARVA 1TFUA 3F98A 3LCVB 1NQAO 4LQ4A 1USWA 2AXEA 3H6HA 2F43B 2PE5A 2QN3A 4MKRA 1OOEA 2CKDA 4FZ5A 2Q49A 5F7XA 1N0IA 4HAZA 5AI4A 3HI6A 4N47A 2A0KA 3BD7A 4GGOA 4QGHA 3D3JA 3KWFA 5LBTA 3GFOA 4EAAA 4HWRA 5AQ1A 3SEAA 2Z57A 3B6EA 3LQFA 3DNMA 4OH1A 5KDLA 5TXGA 6REQB 4ESOA 3BWEA 3G9XA 1SU7A 2JAUA 1P29A 5C18A 3AESB 4DA8A 4ZCMA 1P19A 2XT9A 1XROA 4ROTA 3LUPA 2V6FA 2Q2OA 1NZFA 4F96A 3MZ0A 1CR0A 5FOUA 3RBVA 2HV8A 2VFAA 2DFDA 1LI5A 2EBUA 4K87A 4A0QA 1VJTA 1ZN9A 3A1CA 3L40A 5EJGA 1VG1A 1NVMB 3PCRB 3UHOA 2HIGA 2C5SA 2QLTA 5HFJA 2X0KA 3NT2A 3FNQA 2WSMA 5CEJA 1U2EA 2W00A 3D3WB 5AJTA 6LDHA 5DTJA 2WLSA 1WAMA 2FV8A 2ZUDA 3JWJA 4HLDA 3OEED 4FXPA 2QYSA 3TQCA 1RPJA 1TA0A 1Z3IX 2Q3LA 3SMQA 1P2TA 5CA1F 2GNPA 2FPIA 2Q5JA 3KV3O 3WK4A 4CXMA 1SXQA 4W7IA 4ENPA 1SKBA 1NOKA 4Z4CA 3PGLA 4I55A 4ADSG 3ORYA 4MAFA 4W6QA 5JWHA 1F2TB 2P8JA 5KJ6A 2AKAB 3P0EA 4RKWA 1FYDA 3FRHA 4DBLC 1CW2B 1AK9A 1DEAA 3GRVA 1KIFA 2II6A 5T4FA 4H7IA 2OM6A 4OGLA 1MVNA 3PC7A 1PFVA 5DBHX 1BU5A 3OP1A 4JAVC 4LZPA 5HZGA 3CLSD 3GOQA 3I01M 3RVRA 1A9QA 3CF6R 3N8KA 5F1YA 1JEYA 5T3UA 5IYZB 4KFRA 4Q9DA 5I9IA 5LQDA 1EDZA 2A0YA 3DP9A 3GMSA 1C8BA 4AMVA 3AZPA 4HQOA 3H05A 4UOZA 2R84A 3MOSA 4JEMA 5IHPA 3MJSA 2CXSA 1PFKA 3GGSA 3MOIA 2X2EA 5EWLA 3VPCA 2QQ5A 2LCQA 1OV6A 1UCFA 3FIJA 1QX3A 1V8OA 2FZVA 2O2SA 1CZOA 2A0UA 3ZTYA 3WGOA 2PKYX 3T9AA 3ZY2A 4D5GA 2ZG6A 1I7LA 4KB5A 4QGAA 5ARCA 3SC2B 2I29A 2PJUA 3SICE 3WLFA 3PFHA 2P0YA 3THYB 2WUGA 2PH7A 4G41A 3V4OA 4DYHA 3MCWA 3EPPA 3ABZA 2J3QA 3LI2A 3VO1A 3OZTA 3RSLA 3T61A 1YZYA 2BHRA 1BH6A 5K0EA 4GVXA 3V3KA 3HCCA 2EV9A 2IEDA 3WB2A 1UBSB 3OLQA 3LVRE 1XD8A 4D42A 2QJFA 5MGBA 1BWPA 2MYUA 1E9SA 2GZ1A 3BJMA 3ZWXA 3WMWA 3L8HA 3K0SA 3BDIA 2Z43A 1KYTA 4B5LA 4O5AA 3QOXA 4EPTA 2BD0A 1UL1X 4RM3A 2PGIA 4QOGA 3GDHA 3GELA 3AHFA 3H9GA 3AW8A 4GECA 2G9QA 2PRZA 3L7OA 2HL6A 4KTVE 5DF1A 2DHEA 2WJYA 1VP3A 4K9DA 5GONA 3X1WA 3ZK7A 4EI2A 4JYCA 4Q16A 4JI7B 2B8NA 4AX4A 3DO5A 4WNAB 4FS8A 1THTA 4OA5A 2H4XA 1OBOA 1W8IA 4U1RA 5JQGF 3WQBA 5JAPA 1E1MA 3C3BA 3RS5A 2V7QA 2PZFA 3JQ9C 5IBRA 2OQIA 1ESNA 2BR5A 2MSDB 3LK6A 4PR3A 3T3IA 2Q4RA 4PXAA 1V45E 3AKCA 3AB7A 3A70A 1RKQA 4KRGA 1TM7E 5KOYA 1LD3A 2CNWA 3CO0S 1VL5A 3OICA 5J5CA 4KDRA 3TZ6A 1FP4A 5BUZA 2GJKA 1TECE 3NQ41 4LJLA 5AK5A 4JOQA 1SUSA 2OD9A 1N2GA 2RH8A 3I37X 1YL7A 3DMFA 2X1HA 3NOQA 5KNBH 1MZPA 3PF9A 2C95A 1NXWA 5EPUA 3VU9B 4U6NA 1NBAA 5LQMA 1BGXT 3LQKA 4EUKA 3WOVA 4G1CA 3IKTA 4P4TA 4RLSA 4AD8A 4CLDA 1FYXA 3LA6A 4QARA 2BZSA 1Z62A 1Y6QA 2AOXA 1JQAA 4B2LA 1NI5A 1KZHA 3ZVKA 3OU7A 2RG1A 4RXTA 4ZOBA 1ZRSA 2L0XA 3KAPA 5FBVB 5LBIA 4RLQA 4XGNA 4PG5A 3ZS9A 1EVEA 4Q1AA 2GZ2A 3QIAA 1EFPB 3ZXYA 2AZXA 3I05A 4B4KA 4BX2A 3UBTA 3LC1O 4IVPA 1GQYA 5AI5A 4U02A 3T6KA 4ZN6A 2LBPA 1P8AA 4IDHA 3OFKA 4RIFA 4H60A 4UNQA 3FPAA 2XTMA 2JATA 4IOMA 4C5BA 3MT7A 2JF0A 4YJGB 1T24A 5B30A 1WHSA 3O91A 4MVJE 2ORYA 2YXNA 1NPDA 1SXGA 4HJXA 4ACAA 2WSYB 3DEYX 2ZIWB 3M4ZA 3N0TA 4MUBA 4KQ1A 3ZK8A 4EZEA 1E3WA 1J07A 2OGWA 4IYRA 4CMBA 4BZPA 4I7EA 4QLOA 2B83A 3M49A 1VCMA 2ZR8A 4TPKA 2RI0A 3L3BA 3GVPA 2DTEA 5FKJA 3TKYA 4KQ2A 3U6KA 4MKFA 4ND4A 1PK7A 2QD4A 3B38A 2UYGA 2FP4B 1CP2A 4ZIRB 2JVKA 2XE7A 2XZDA 5KTNA 4TTSA 4V3BA 1AN0A 1I7QB 1GNSA 4UVIA 2W6NA 5BOSB 3WIUA 2FFHA 1B0AA 1Z2DA 1ZOPA 3MQ2A 3NWBA 2NXWA 2ZJOA 4MQEB 4OYYA 2XMDA 1HORA 1KMHA 3L84A 4GEKA 4Q48A 2ZSIA 1Y6FA 2AW3A 4WCFB 4F5DA 5CA0F 4EGCB 1ESEA 1I1HA 4B3DA 1HDZA 4HEA1 1EXVA 2J46A 3BGOS 1XDZA 3HBNA 4RHTA 1CUUA 3CE9A 4A9AA 4IIJF 1MPTA 1QDEA 1J4AA 2OV8A 4N65A 3TZKA 4CCAA 5FWNA 3FGPA 4XUDA 4B33A 4KACA 3FDIA 3GDWA 3TUIC 5JXIA 3RS3A 2D0IA 2YFYA 1X0VA 1XTPA 4L72A 3ENWA 1UPBA 2X9LA 1UUFA 4KNWA 3OOEA 3TGLA 4P0PB 1Q0HA 2YICA 2ZR9A 1ZOSA 3ZWKA 4FS3A 4FN5A 4F11A 3EFHA 2D1YA 4ECEA 2VHQA 4TMTA 3A1DA 1LBTA 3ROZA 1BW9A 2EKDA 3IBSA 3G1UA 5EIOA 1S5PA 4WINA 3UV7A 1CT9A 3W2TA 4ARIA 4N12A 1XKLA 3JQPA 3K05A 4NDNE 1V8DA 3KL2A 1PBNA 2A5JA 2BJVA 4GOXA 4I6EA 1CTQA 3VNUA 1XZAA 3H6GA 1AZTA 5E8JA 4S2UA 4YH1A 1FRZA 5J9FA 2YQ4A 1E5XA 1JVBA 1D2CA 2IOFA 3DZKA 4YVFA 1G20B 3RGGA 3K5IA 4AUMA 3PDIA 4BXOA 1V7QA 1SCDA 3OM1A 1OYWA 4GPZA 3IVXA 1Z34A 5G53C 4ND7A 4X90A 1Q14A 2CBXA 2FF5A 2R2AA 1NYQA 3GZTB 3EA4A 3ME5A 3RR2A 5AIBA 3D54D 1KI6A 4HEJA 4DCTA 2A5LA 5EINA 2CHVA 5DIZA 1RJGA 4GMKA 2CVOA 5J40A 1RWOA 4ZVPA 1NUPA 1FXWF 5SYAA 1RWMA 1AUXA 2V8BA 1ULUA 3CRMA 1AS2A 3DG9A 4I8XA 4IWYA 4MVJD 4ND8B 3ROMA 4LFBB 1MTOA 2QD2A 2EW1A 2IUEA 3CLRC 4KAJA 2JIBA 5EHZA 1UC5B 1P45A 1QR6A 3DLHA 2GSWA 1WXGA 3V42A 5HP4A 2YYAA 4RMIA 1ZM7A 3OQBA 4XSVA 1KXJA 1JHYA 3BWVA 4KDCA 4JITA 1H4TA 2NO7A 1EJ6A 3IV6A 3ZBPA 4X84A 1C3OB 1K9VF 3DVSX 1B1CA 3GJSA 4GXRA 2A57A 2OORC 2ZREA 3IJRA 2BKVA 3HWX1 3KPYA 4DB4A 1UFQA 3FHTA 4P2GA 3K2BA 2P2YA 2NNLD 1DC3A 1ZRHA 1MFZA 3CEAA 4L78A 4LMBA 3V55A 3WGHA 2A2ZA 1U2DC 1E58A 4JLJA 3EK2A 4F3CA 5ILQA 4PO3X 1Z8NA 3L5KA 1PNRA 1CUDA 3THWA 2RJ3A 2Y4OA 3KEOA 3HYTA 2I2XB 4PYKA 4BGVA 3CZCA 4DANA 1BQEA 2JFOA 1NLFA 1YRQA 4AYWA 1FUIA 4ZGWA 4MINA 3W3AA 4EW3A 1WB9A 2C8VA 2RK3A 5H59A 5IDVA 3F4LA 3RJMA 4IGAA 5LA6A 4UDNA 4B3RB 1OX6A 3PF8A 3GGPA 1QWOA 3GW8A 1AKNA 3O8QB 1P1KA 5EKDA 4D4JA 2HXYA 2PVPA 4W5JA 2GM3A 1V5IA 3UGJA 2AD5A 5KB3A 2J87A 2YHAA 3ZEIA 1R0KA 3L7AA 2PVCA 2C99A 2J85A 2JGAA 4BNTA 4AI6A 5CB8A 3HMQA 3P97A 1X1BA 4NDZA 2P2LA 1IBLB 2XB8A 1NZJA 2QNRA 3D02A 4MVCA 2G76A 2ZEJA 3DMTC 1EVQA 1EA5A 1LSJA 2WA1A 3HLKA 3OPYI 4KE6A 3BKXA 4BUZA 5CFRA 4I55F 5L6MB 1KSFX 2EJUA 3EQ8A 2QVGA 3P1JA 4KN5A 4PHTA 1GNLA 4Q82A 5ENVA 2P9GA 2FWJA 4YGXB 5EMKA 4FDTA 4UXIA 3DHVA 3C6KA 3UTCA 2ZRHA 3C87A 3U4AA 5ITWA 3EPHA 2VAPA 1JDZA 4YCCA 2IOQA 1G38A 4OREX 5IDXA 2CXHA 4UD6A 4F2GA 4E14A 1DPGA 1L4HA 2ON6A 1TLTA 4RPLA 4Q6WA 3UJ9A 2WTBA 1IDOA 4JYAB 2I55A 3NU1A 4PGGA 4D02A 3ON5A 2AC2A 2JGMA 3NRBA 3TD9A 4D9JA 3LHSA 3K6SA 1XD9A 4ANFA 1S9DA 5D01A 3GO4A 4ND6A 4RKEA 2AXNA 3BGDA 1N3BA 3CH7A 4PWZA 4BZWA 1BCSB 3WIBA 1M2KA 5AW0A 1XTRA 2PUCA 3G2JA 3ZQKA 1BDBA 1Z4OA 3N2EA 4E5KA 2CNOA 4MHSA 5EKXA 4BO8A 1F4LA 2ADFA 1MA3A 2CE2X 1T5BA 2ACWA 3KLBA 4NZOA 2HPAA 1V3VA 4OGWA 1JL3A 2BGRA 1WU8A 3DMPA 2VSYA 2HSWA 3EJ6A 2HNAA 3KJEA 1EFCA 4JN6B 5ALXA 3SHVA 1H5UA 5IUJC 2FR8A 2H11A 1TE2A 2YFHA 3SEQA 3MC1A 3NBYC 4ER5A 3CBGA 4W4TA 4GX0A 3HUEA 1VPVA 5TEVA 3UT0A 2C2MA 3E3OA 3U44B 5DM60 2V58A 2VHUA 3WVNA 2J9RA 1FB5A 2QUIA 2XAUA 2ZVPX 3H5OA 2POQX 3TJZA 3UOGA 4LV8B 1MIOB 4Q7KA 1YJBA 3PDIB 5AXDA 4BO0A 3T1HB 1L4BA 1UAYA 4TXMA 5K51A 4LJRA 3WLHA 1USKA 4D9EA 1M10A 8OHMA 4TTTS 2EWWA 1RXWA 2ZI7A 1KF0A 3QWAA 2XUDA 2ZSHA 3QU5A 4X8MA 2WKRA 3WBKA 1ML3A 1NI3A 3UCXA 3WGMA 4HB3A 3PQ8A 3AF4A 2EGHA 3P9ZA 2ZTSA 2ZTUA 1Y98A 1C3LA 1RWWA 4EGAA 5JFGA 4P4NA 2ID4A 4QBHA 1JEYB 1NI4A 3LSTA 1VJGA 1KO4A 4HQFA 3D2LA 2XODA 5IBPA 4KOEC 1VPDA 5EN4A 1KS2A 4ILKA 1PUIA 3W8NA 1EM8B 4IJWA 4RIIA 3ZV6A 3GFRA 1GFZA 1U02A 2YIJA 3C8MA 3PX7A 1MQSA 1NAHA 2IV2X 2PVSA 3QKSB 5BXYA 3QKRA 4BNGA 3HBAA 4J4HA 1OZFA 2FP3A 2V7TA 1YZLA 2FFAA 4L6IA 2QF7A 2E48A 4QJ4A 1VA4A 4B2PA 2JH3A 5E7IA 2GWRA 1KJ8A 3WYFA 3GFGA 3FPGA 4NBKA 3T3MB 4DR1B 3I6QA 2H5JA 2KSQA 2RAPA 1K86A 2G0TA 2PZJA 2Z2IA 3Q5EA 4HWGA 5CM8B 2QRQA 3ZE6A 5CG1A 3P2OA 3G2LA 3A27A 2NVUB 4GSYA 3T5MA 2QS9A 3E5RA 4DEVA 5JWRA 3ZV4A 1GNQA 2YJGA 3HKEB 4RJJA 3PICA 4FSHA 1A3CA 4Z9AA 1UFOA 5A03A 3JTEA 1XCLA 3RS2A 4CEIA 1RJEA 2QN2A 1BXRB 2BFWA 4Q15A 1BN6A 1A98A 2HT6A 3I73A 1L2TA 3I32A 3JQ7B 3VGPA 1L4UA 3H1GA 4EYKA 2C9ZA 5IT5A 5T41A 3PGJA 4CGZA 4DILA 4DCNA 4CTMA 5DT2A 5BYJA 2DLCX 4RVGA 1YBVA 4RETA 4Y1RA 3BBLA 1JLLB 1NSFA 2XTNA 3DTVA 3IL2A 1OI4A 4FHCA 3OQIB 3V7WA 3WSTA 4EH1A 3K6SB 3IQHX 3P2KA 1E2UA 4FFBB 3UMYA 1W76A 3U5ZB 1UBUS 4QYTA 3CUYA 5CFOA 2XLBA 2GEJA 2YIVX 4MITA 1WSDA 1N2IA 2YXBA 4XB2A 4XUGB 5BR7A 3ENZA 3MCZA 3C7CB 3WGVA 1Z45A 2I4LA 3DONA 4IZOA 2OY0A 1NQXA 4MVWA 5IJ0A 2W2PA 4QBTA 5IN5A 5WRFA 1TADA 3RHTA 3OX4A 3DL7A 3E7DA 1JW9B 2DWOA 5AHRA 3I0NA 3TW8A 4CNBA 2G6BA 1Y0BA 2Z2ZA 1YB1A 1DBIA 4R1NA 4Y9RA 5T4EA 1JR3D 3WYNA 4BLSA 3DTVB 1KE2A 5LXTB 2PJRA 4TMFA 4YECA 3PA6A 1JEEA 4KC0A 3FSEA 4URHA 4BO4A 4AP9A 4G5QA 1E7QA 1DC5A 2ARKA 2D1FA 1M1NA 2V55B 3PKJA 1W2WB 1F8XA 4RC9A 2GKSA 3GJRA 4Q03A 3Q6IA 1QTRA 2X77A 1ODKA 2I3BA 2SICE 2EKPA 2VAWA 3ZEAA 4J16A 1T13A 5I01A 2ZCVA 1C3VA 2H16A 3ML1A 1LSUA 2FRVA 4YT8A 3EIXA 4PE5B 4IG9A 3GEIA 3I6BA 4HXEB 4QU9A 1FYFA 1UK9A 2Q6IA 1MEOA 2YVAA 1E20A 5KHLB 2XMSA 5DBFA 3TSCA 2FQYA 3WMGA 1ZHHA 2VPTA 3USES 3W0LB 1JJIA 5TRTA 4M9XA 1JQLB 3NGLA 1EB8A 5DHFA 2FDXA 1W93A 1JPVA 2YMQA 1JYSA 4EEKA 3PHGA 1OXVA 4NMXB 4EA6A 2IODA 4PVDA 1ZD3A 2PZBA 5F3WB 1GLNA 1V47A 4QATA 2GK4A 1QHSA 2JKYA 2C2YA 1E2PA 2IU6A 2I4IA 4GI5A 1GYRA 5I9SA 4CKEA 2ZR0A 1SVUA 4LVUA 3KUDA 1XGKA 4U7TB 3ZUGA 3W5AA 4P1ZA 4CU2A 3A9WA 2HUNA 3H7IA 3A6EA 1YZQA 2O2GA 1IRXA 4EQ6B 1KAOA 3AKZA 1CF4A 1GCGA 3MGAA 4XVRA 3UOWA 2JFXA 5ADUS 1EK0A 4BFVA 4YMGA 1A9RA 1QYXA 4FKZA 4QWMA 1DOZA 2Z2JA 3MEQA 4C20A 3V1LA 1SC3A 3LFUA 1KO8A 4IVNA 4IO0A 1ZY2A 3C98A 4FJ1A 4FYMA 2NSLA 4BMVA 1QTQA 3A4LA 5BN5A 4JVOA 3TR0A 2W11A 4JASB 3OJEA 1U7PA 4XKJA 5DYGA 5CNIA 1AQNA 3UVEA 4I9UA 2WM3A 3SZOA 3D81A 4H35A 5HKOA 3E0XA 3HDGA 3UC9A 2H4HA 4D6PA 4RTOA 2EP8A 3CKYA 4GKAA 2CCGA 3F6PA 4J75A 1ZM4A 1IYZA 4LBZA 4M9QA 3AM4A 4HYEA 3BE6A 3GFVA 4IWXA 1S7GA 2C5FA 1P9NA 4PM4A 4G23A 3OO1A 2JJ8A 1QC5B 3RD5A 2IUTA 1SCKA 3QVGB 3WGNA 2XUQA 1SUPA 5JAUA 4RZSA 4BAZA 5KDOA 3IILA 3ZCRA 1Z7YA 1NXVA 1RVDA 1VB5A 3DMHA 5K0CA 2ZUUA 5DHUA 1G6HA 4G67A 2JHAA 3G8AA 3NC0C 4LRYA 4FWIB 3PXDA 3VVCA 4GKJB 4S3MA 1LVGA 4D82A 1BX0A 3MTJA 4PC7A 1QDUA 2OCPA 4DCOA 2VOEA 2O14A 4FB5A 2FFBA 2XQJA 2ZPAA 4N5IX 5TSDA 2VJQA 3RVLA 2E2WA 5A3SA 3OUZA 4HLUA 1E0JA 3FPEA 3DGFC 1BGVA 1ONSA 3H9CA 1GRVA 2CFRA 3MHPA 1RAFA 1PVOA 4LOKA 5JS2A 5DT9A 1DRKA 4DJTA 4ZQEA 4K6GA 1Y9DA 3WL3A 1IQUA 2OXEA 4UBJA 4EFLA 4PS0A 5ULLA 1JAIA 3IUPA 4ZC1A 2FN7A 3HR8A 1II0A 3IP7A 4LN1A 3RYIA 1EK5A 3B8EA 3G49A 1Z2PX 4H16A 4P83A 4DLUA 1QQAA 4LXTA 1FIUA 1PKXA 2YN2A 5CX1B 1XP5A 3FYUB 3VR5H 3LKVA 3SX2A 3E1KA 5I51A 2BPOA 1M3SA 4GR5A 4E32A 3GCDA 3GLRA 3W3AD 1MABA 1N2XA 1CUEA 1HRKA 4JBGA 5GM2A 2G1AA 5HF9A 4C3OB 3GPBA 4CLHA 4EY5A 5I8WA 2G5TA 3NS7A 3U2QA 3BC1A 1KZ1A 4N40A 3DW3X 5JMWA 5CTJA 5EIFA 3OZ7A 2R4TA 3IC5A 3ODGA 1Q7EA 2JJ1A 4JL5A 4ASUD 4LGYA 3ERCA 2WEKA 3KJQA 2FP4A 5EZ6B 1KY5A 4FMBB 1M2WA 4FVTA 3PKIA 4RDCA 3VX3A 4ZIRA 5JJCA 1Z8DA 4ENVA 3MGKA 4HH1A 3SYRA 2J6BA 3CINA 3KVRA 1ZKDA 4TMKA 2C8KA 1KK0A 4WESA 2I6QA 2F1KA 4BNUA 5C8VA 2ZJFA 3NBXX 3VZRA 4KIWA 4LXXA 4J0CA 3ZGVA 3JAMA 1SKAA 4HXYA 4AS1A 2HBRA 1X7GA 2HMWA 1BJRE 3EVFA 4C7OA 3J81k 2OGZA 1DUSA 1GKIA 1D6NA 2CLKB 3L1VA 2OZLA 3ND8A 4I3GA 4U5XA 2WAXA 3Q40A 3K71B 4C5CA 5C5DA 2FX2A 1U5CA 5CURA 3VHRA 3KQKA 4F4JA 1DINA 2HGZA 1OX5A 1RE1A 2X0FA 1ZDMA 3RUFA 5DE3A 3ESDA 5FPKA 4YJFA 3DNPA 4HWSA 3ES9A 5JD5A 1QF6A 3O3MB 1AY0A 3PR3A 4NAUA 8ADHA 3FTEA 2XF8A 2P9QA 1W5TA 3DPUA 5IXYA 2Q9UA 4M0FA 5CR9A 3UGQA 3GN2A 3L8CA 1OU4A 1YI0A 2ZP1A 4TTRA 1TIBA 4ZODA 5BT8A 1UEXC 4PG7A 3EZ7A 3L0ZA 4ONEA 2WNIA 4DV6B 3K8OE 4KEAA 3N6XA 3DM9B 4Y0AA 2Q5IA 3G0CA 4TS3A 1J23A 4DCGA 3F96A 1WEHA 4HNVA 3DOIA 4LDJA 1MO6A 2RGNC 1SXJA 1QOZA 4TL7A 1R10A 1HDEA 1RMYA 5F7ZA 4P3PA 5CD9A 1CY2A 2C7GA 1SR8A 2HJGA 1Z6GA 5AW4A 2DSNA 4H77A 1HPLA 1QV6A 1HQDA 1OZAA 4PN7A 3M5DA 4HNQA 1Z83A 3E70C 1BOOA 1LS6A 2PQMA 1Z6ZA 1PFQA 5HKKD 4ID3A 4O2LA 2AXQA 1RWVA 2J32A 3DM5A 1H1LB 1M33A 2A7XA 5JR3A 5TMBA 4KI0A 2AK3A 4IH1A 4M0LA 1PR2A 2FVXA 3KS9A 2VRCD 3AUJB 3JRNA 3AUYA 1HK7A 2OC9A 4TLMB 1GZVA 3O4GA 1FXSA 1O9HA 3S1AB 3K5HA 4ZV4A 4CMKA 3NBUA 3Q3IA 1TD9A 2G9RA 4ALLA 1R9MA 5DEIA 3IMEA 1HEYA 4L51A 4PVCA 1HXHA 1LKZA 2MWMA 1J8FA 3AIIA 3QHPA 4LZOA 3ROQA 3NHWA 2EVWX 3UK2A 1F4VA 1UZAA 1MDFA 2QORA 5J2UA 4YP9A 4ACBA 2FZWA 3BTSA 4OHWA 3ZD9A 1KJNA 3G79A 4BO3A 2AUNA 3SXPA 5BUQA 3IUSA 5EHQA 3HDQA 2VEOA 1CHNA 4HFNA 3A0UA 1R27A 3UA3A 4BU1A 5LMUB 3M70A 1RYHA 3I58A 1ZJYA 4MR9B 3V1MA 3DKPA 4IPTA 4TL6A 4V0MA 3VSCA 3IE1A 1QFZA 4QDZA 3T54A 3ZE1B 2QSYA 4NPCA 1YK1A 3EVNA 4M60A 1ODLA 1JIJA 3TNLA 1K6IA 4HAXA 4KQXA 2I2FA 4WSOA 3AZOA 1RW4A 4KX5A 2IOYA 3DAGA 3T7EA 3I30X 1EP2B 2VJMA 2XECA 3DDSA 4RV5A 4DWJA 1AKUA 4W1RA 3KQOA 3KZKA 2NO0A 4IM7A 5JJ5A 4TWZA 4PAMA 1NFFA 1E7YA 1FX1A 1MH9A 3ANXA 3IEPA 3T99A 3AEQB 3EGEA 4I8IA 1JMYA 2ZI9A 3X2EA 5M5BA 1ZK0A 2BBOA 3NIDB 3RODA 3QVGA 4JNCA 5LCXA 4CUKA 5H3LA 2R7MA 1GNTA 4H1UA 2E87A 2F00A 1RXCA 3DZHA 1XJQA 4E3ZA 5JIBA 4GPIB 4PIMA 1QQ6A 3EMKA 3D5TA 3HGQA 3WWYA 1UKZA 3P94A 3T9CA 4C4YA 2R8PA 1GA1A 4XLZA 2B4QA 2Q1YA 2BELA 4NJMA 2KYRA 2XRFA 4EVRA 1Z6AA 2Y1LA 1DQSA 3L7BA 3TSAA 4ENQA 1CR1A 2O0LA 5ENZA 4WKPA 3G85A 2B92A 2REQA 1DX4A 1W88B 2C8LA 1D0SA 4ZZ3A 3QEKA 4MMZB 1ZIXA 5F12A 4BGUA 4DNQA 2W2NA 1YRWA 4TS9A 3ANLA 2D59A 4MDYA 3L93A 3MRXA 1VOTA 1ZMXA 4Q4CA 4G65A 4Q9LA 4N01A 2NVUA 4Y2VA 4QNMA 2VJOA 1ZJWA 5FO0A 1OXSC 3ZKAA 3VQTA 4E2WA 3M1IA 2Q0XA 4WN9B 5LLDA 3MT8A 3EMDA 1CZHA 4HDMB 4OBEA 4AO6A 3GAFA 1HG1A 3OZCA 1U3FA 1DFIA 4YMUA 3DLCA 5CFMA 1ISHA 1LPPA 4JLDA 1DG9A 1WUJS 5ICCA 4NEHB 5L9AA 2JJYA 3OIFA 2W2QA 3SZGA 1EZ4A 5FOSA 4LF8B 1RLTA 3DB2A 3PUXA 5IVKA 2FPRA 3A58B 3MJRA 1BHSA 5BQOA 4Z4HA 2OCXA 3BD8A 1RQXA 2OZEA 3KKOA 4PLYA 5NLLA 2AYZA 1PWEA 3HA2A 1YTUA 2MIIA 4QDOA 1N92A 3R9WA 5JZVA 3A4YA 3UJNA 3B5JA 3BH0A 3C6XA 2B0JA 2G77B 2LXNA 4CM7A 3I2FA 2AC4A 4UQLA 2IZZA 1ATZA 3ZLJA 1TC2A 1B14A 2IYTA 1T8RA 2VPIA 2A3RA 3FCCA 1BVYF 1NJ5A 4OIMA 2B3TA 4Q21A 1GQOA 4Z1MD 1HQCA 3LFTA 4G0XA 4EAQA 5CMLA 4G1BA 3HO6A 2GVZC 4FYIA 2GARA 4HDKB 4RPGA 3VVMA 5B2FA 4RTMA 4MYCA 4UZEA 1Z38A 1Y4ZA 3CUKA 4MCHA 4QC2A 3UKJA 3G5UA 3U60B 2JNWA 1OZGA 1XN1A 4JNKA 2H8GA 3SNHA 4HLCA 2RGUA 2BGKA 3ZOKA 1UMBB 4B71A 5CB0A 2QR3A 3K1YA 3FCXA 2BMWA 4CODB 1IEWA 4XGIA 3E58A 4UMFA 2IZ1A 5D3KA 1WVIA 5LP6C 1WUYA 2ZJ7A 4WASA 7AT1A 3J80A 4FZVA 5A0TA 1QAQA 1JQKA 3DTVD 3GLUA 3JQ8B 2OV6A 1QQTA 5C7LO 5JLJA 4RK6A 2WWGA 1MC8A 4FILA 4PZPA 4ZOEA 1LC0A 2R6CA 1P4HA 4YB8A 5BSTA 4AJJA 2VNAA 3U7JA 2J5QA 2Z5LA 3GZNB 3REFA 3T7TA 2ZIGA 5I4BA 3PYLA 1RFGE 3EG5A 5E6SA 4GW3A 2X5XA 3SJ7A 2DKOA 5CB4B 1Z5VA 3FCUB 4AZ3B 4CFYA 3BGWA 5HKBA 4OSPA 1E92A 1C9EA 2N1MA 2ZUTA 3KKQA 5IYZF 5JS8A 4CIWA 3IERA 3FB4A 2NAFA 1BCSA 2DETA 3LVQE 1NMYA 2J0UA 1GIAA 3V46A 5PNTA 1L8LA 1KEEB 2JEZA 2CHQA 5JDIC 2GAIA 3JD3A 3CMMA 3SOPA 3TR5A 3V5NA 1PDWA 3BRCA 3ZI4A 4XW2A 3HWSA 3BCUA 3U49A 2YMLA 1Z5UA 3FCSB 5AOCA 1T0IA 3DPSA 1IZ7A 1GPAA 1YVRA 4YWHA 2EHDA 1TL7C 3T9FA 3WKCA 3ZD6A 2FK7A 2J3EA 1EJBA 3EZ6A 3TTTA 3NHSA 1TJPB 3ZJ4A 1T8YA 1P3JA 3MUNA 1V9SA 1G2IA 3H4MA 3OTGA 4KLAA 5IANA 5CIYA 3UC5A 4WFQA 3QFFA 3EGIA 3UY4A 1KI1A 3BL5A 4I99A 2X13A 2FOXA 3GT0A 3L77A 4PF1A 1RAHA 5HRUA 2QWXA 1D04A 1G0OA 3AOGA 2IYEA 2J3DA 3KT0A 4IH9A 4D8YA 2PN1A 3STUA 2COUA 2KMLA 4Q24A 4IP0A 3A4NA 4P36A 2H1IA 2IXGA 4LJ9A 4F56A 3KQWA 3P0IA 1GY8A 2V9PA 1TI7A 2ZRBA 3OCZA 2PWAA 4P81A 2E5WA 4BUJA 1A97A 4N3NA 2H1VA 1DQYA 4JK3A 5CA1A 1BYUA 1C4KA 1I80A 2BTQA 1O54A 2G09A 1MX9A 2IZOA 4JCOA 4RF5A 1A2BA 3CWZA 4CV1A 3B13B 3AP1A 4YPFA 3TZBA 1QYVA 1J9GA 4WEOA 1YRHA 3R74A 3FFXA 3FWNA 5AJXA 1RRGA 5AXCA 4HATA 4XQGA 4R1OA 5EFOA 4AUKA 5EXXA 2XCRB 1DIHA 1XZBA 4AKGA 2VCYA 3RIGA 1JEJA 3ICVA 4JB2A 1XOIA 2GVDC 4D7AA 4A2WA 3U4MA 1FU4A 4GG1A 3N3AC 4LV6A 3WS7A 3ZLUA 1L7QA 4Y1GA 2XUJA 1PW7A 4C3VA 4LHEA 2A30A 1FFAA 1WF3A 3DD5A 2IHTA 4ASUA 5FH9A 1MB4A 4CZ2A 3DD1A 1O6BA 4FQ7A 1IXSB 2NU8A 3EWIA 5KMGB 3VH3A 3OQVA 3WX0A 1EUCB 4W82A 5IW8A 3B51X 2WUFA 1EBUA 1CY4A 1L7XA 2RAVA 4N8EA 1BVUA 1VLMA 4FE4A 5AM1A 4WXHA 2CW5A 3OJLA 4MWOA 1PBTA 3OTIA 3WL8A 1CR6A 1QTIA 2BHNA 5EIWA 2BEUB 4CTKA 1M0SA 3IMFA 3PHJA 5L3RA 1I3NA 3HKCB 3INNA 1TVCA 3NIBA 2WJGA 3PPVA 2Q9CA 1ETUA 3IJEB 1A4RA 3N3BC 4B3GA 1I4EB 5IABA 2HRZA 3BMXA 1Y8QB 1B93A 3TNDA 5IFLA 4BMCA 5HX7A 1XEWX 1D6MA 3UA4A 4F6CA 1CG6A 5CFPA 5U9CA 4PSKA 2HK6A 1DEHA 4MQ4A 5KYGA 1GGJA 2R6GA 3EXEA 2NZYA 4HHEA 1LQTA 4JOSA 3HU3A 4X6YA 4ZYLA 1HNNA 5ISMA 4D4MA 4YIHA 4UE3S 4O2RA 4DLSA 4OTZA 4QPDA 1C0IA 1TA9A 4X1KA 1EDBA 4OFZA 5HG0A 4CI9A 4MRMA 2X5JO 2NYRA 5A3RA 1YQXA 4CMAA 1XP8A 1X1QA 3S81A 1VMIA 3WL7A 4D98A 3LQYA 3M2TA 1EFKA 1PJAA 2PJZA 3BMQA 3D8SA 2XJ4A 4LSZA 3FZNA 4OAPA 3VNRA 4CNQA 4YUYA 4LJ5A 2WU3A 4P7GA 2P5UA 1JXOA 2VTKA 1JMVA 3BAZA 4GMDA 3TZCA 5B2EA 3ITNA 4NENB 3I12A 2ZBPA 13PKA 3ESXA 4IQ8A 2W2VA 4Q4LA 4WH0A 5KTOA 1E62A 3B3JA 3JAKB 1UZUA 4A0FA 2PWZA 3SWWA 3QVOA 1YONA 2A9PA 2QI9C 2H4FA 2G9UA 1ZQ9A 3KFXA 3LWDA 5LYJA 2A58A 1DX6A 4CLRA 4HWOA 5CT5A 4RMHA 4WL0A 4M37A 4PYLA 3NJ4A 3W5IA 3EMBA 4U7DA 1XR3A 2Z6VA 2UZ4A 4NYIQ 5IF9A 1OWNA 3KQNA 2C07A 4QXRA 3PUKA 5E4YA 2D0OB 3WLIA 5KYWB 1MQAA 1NRJB 2HAEA 1R9NA 4XQ0A 3ZVNA 2SHKA 1N2CB 4JJ6A 3EW7A 4BFZA 1NUUA 1EKXA 1GEGA 16PKA 2R6AA 2GXUA 3RYCA 1JIIA 2EFEB 4GZLA 4TGLA 5JNTA 4FFOA 5SZJA 2XX3A 4KITB 1J5PA 2AVNA 2XNJA 1FBNA 2IPLA 3O26A 4F2PA 2CUZA 3A31A 4CLXA 1JEDA 2ZTHA 1BE0A 2G4LA 4JXJA 4LX0A 3KOUA 3SBXA 2C3MA 1ZM3A 1IJFA 2EJWA 4Q9KA 4ZQBA 5IAJA 3F8WA 4ZVRA 2W6ID 5D00A 4H0FA 2G9ZA 6GPBA 4W1PA 4UM5A 3A2MA 1HC7A 2JAWA 2NVOA 3GLKA 4PX3A 4LNAA 4TUYF 4EJFA 1ULBA 2P1RA 1SU8A 3HBJA 3X1DA 2XUFA 5LMCA 4P38A 3ZLVA 3TNYA 2HTEA 3FHOA 4BFCA 1YFZA 3E3AA 4KBFA 4HVAA 1VQ1A 3KQYA 4DWWA 3K1ZA 5C5EA 1KEEA 1PGQA 3RF7A 1QHHB 2QW0X 3ZDXB 2WT8A 4GKKB 3SE7A 2EKBA 5KMGA 1JDVA 5ALUA 3ADDA 2GCPA 4HH0A 1SVIA 2BFEA 4RYLA 4G0QA 4Y2YA 2JIQA 4CG2A 5K6TA 2X8JB 3AETB 4XFKA 1YFLA 4HC4A 1WSWA 5E4TA 4AP6A 2ZSBA 2NPIA 3M6WA 4LYHA 3KDPA 3PRHA 3X1YA 1ATIA 2V9CA 2WFLB 4PEVA 2XMBA 3NW9A 1TA4A 3E27A 2JD1A 1X87A 2H4WA 1BH2A 4LY0A 4OQDA 3T4PA 3NHMA 2UZAA 1KYQA 3VMMA 2MYNA 1C7QA 2P6UA 5IJWA 3GEMA 3SD7A 2VRCA 4N9QA 2CCKA 1CF2O 2G1JA 1F3OA 1K5DA 1Z88A 2QAGC 1T3TA 4NOMA 4EDHA 1M2VB 5I7UA 1T2UA 5L4NA 1NW9B 1WZCA 2RJOA 1U80A 3TUZC 2IT1A 2BKLA 3EDMA 3EY9A 4AY5A 3PGMA 3O21A 5IULC 3G2OA 1X7XA 4URUR 4F45A 1LDGA 4WKBA 3S0JA 2J0VA 4PG6A 1NDQA 5IM4A 4H1VA 1MAWA 2SKEA 2J41A 1Z68A 2VUTA 4ZAGA 3Q8LA 1FS4A 1Y8AA 2I80A 3OAAD 5T7BA 1XYVA 3NEAA 3HU1A 4U5QA 1M7HA 1JT2A 2D3TA 1M8PA 1ZUNA 4FN4A 4ND2A 4W8HA 4A2PA 1A9OA 1JG6A 3PZBA 1KYIA 1ADYA 4B7ZA 1ZAKA 3MS4A 2PCLA 3WWDA 5E9JA 1MRNA 4J1TC 3V4FA 4H7DA 1TOAA 4R2KA 3BGSA 5D86A 5CHYA 1U3VA 3JQ7A 3ER8A 2JANA 2WTEA 4HNAA 1PJTA 2GETA 2PGDA 3E7PA 4PZ9A 1T4MA 4RGQA 3WLPA 1Z4KA 3RS9A 2VYNA 2X8AA 1TQDA 1P0CA 1EQUA 4K9LA 4NC9A 2PLNA 4CHGA 4F04A 2DM6A 3GRUA 3L6RA 2GZRA 4K26A 4M53A 3RROA 3VMFA 3EF3A 3IHLA 2FUNB 3TEJA 4KR7A 4QRHA 1PT7A 3A9VA 3W4IA 1XAGA 4HN2A 2ZJ2A 3D6HA 4KLRA 4ZYXA 2LW7A 1H22A 5DN9A 3F78A 1VDMA 4KGXA 4ESVA 3FVRA 4EJSB 2IYOA 4L74A 1PX2A 2J6IA 2W6QA 2ZIZA 3IODA 1WXDA 1G5PA 3CBQA 5CLFA 5K8CA 2CXOA 3SIPA 1B8VA 1XXLA 1CX9B 4HQNA 2I2AA 4NBLA 3UGKA 4M9RA 4K6HA 4AWBA 5BR4A 1OB5A 1JFLA 5F78A 5LZ9A 4UVEA 1ZP6A 3Q3VA 2YXPX 1YZVA 1T26A 2ETVA 4LQLA 3DBHA 4KYUA 3Q41A 3OD1A 1PLJA 2AGVA 1M8KA 1H2WA 2QDKA 1X1CA 5IAOA 1S2NA 1BXGA 1UXHA 2RGDA 2WOJA 1E2IA 3Q3CA 3OLYA 5TGDA 1KOLA 2X9NA 3M6UA 4JA0A 4Z4GA 1Y8ZA 2EDAA 2IYYA 4HAWA 4IMJB 1U7HA 4QFMA 5E4JA 4LSGA 3RREA 1CUJA 4QRIA 421PA 4LFCB 4YACA 2BR3A 1OX4A 2QPLA 2RJNA 4GDMA 3V8RA 3H9JA 4LYJA 2WWVD 3U3DA 2FCRA 4KPYA 1JA1A 3MB5A 1K5PA 2ZIEA 4OL0A 1Z5ZA 2F3SA 2PL3A 4FYKA 3ZY3A 2GEKA 4PYQA 1KDZA 4OL9A 2QUAA 4BO7A 2I4OA 3IE2A 3S2IA 4BDTA 2B4TO 2OA0A 3GG9A 1TZMA 3E15A 3KG2A 4BP3A 3NBQA 4BVLA 2ILVA 3U4GA 2HCBA 4ZO9A 3VU1A 4F9GA 4DB2A 1S2LA 2WU8A 1ULHA 3NHJA 5CIWA 3B53X 2HLNA 3H13A 3M9XA 2G4CA 1C0EA 1QIMA 2HA7A 1JBQA 1UDRA 4O2AA 3WKEA 3EUEA 2X3YA 3ICEA 2DPMA 2PKRA 5EUCA 3SC3A 1LQ2A 3O8BA 3OPQA 4CKYA 2NVWA 1T34A 1UFRA 2F4NA 4B6OA 2B2XA 5EFZA 4BU0A 3AR3A 1CSEE 3TLZA 2XKBA 4TRNA 3G7NA 3LQ1A 3RF6A 5LMZA 5C51B 2W0MA 4CEHB 2GBGA 3W7BA 1TM1E 4YK7A 4AJIA 4AQDA 8AT1A 2Q2VA 1NMXA 4P3OA 3HVHA 3O3CA 4QT4A 2BI4A 2GGSA 4L22A 3KV1A 2D7JA 2ZRPA 4UU1A 2HNKA 1ISIA 3DLAA 3QYPA 4ZALA 1D5CA 2WIKA 4EWLA 3DWIA 4YT5A 1C29B 2BHTA 2BR4A 2ZS8A 5AW1A 5ALEA 4KVZA 3PWSA 4W63A 1TYEB 2ID8A 3ZU4A 1L5RA 1BRMA 1LGYA 1E59A 3T1VA 5K05A 2QVYX 1USGA 2ZBDA 1XXHB 3I6MA 4P93A 2VDLB 5K8UA 1XNGA 1II8B 1KPIA 3Q3EA 4XCVA 4JJAA 5DB4A 3PTAA 3EZYA 3VKHA 3U3KA 1PEKE 3HBLA 4JI0B 1P4GA 1UK7A 4RS3A 1M6EX 3DXFA 2PGOA 1J5XA 4L8LA 3QA3E 4OJTA 3OF3A 1Y5IA 1OHHA 1PL8A 2FK8A 2HU2A 4W5QA 4QWWA 4EVSA 4MDFA 1Q3HA 3ONDA 1K98A 3U7QA 2BZGA 4YT2A 4LRQA 4X1IB 3LIPA 4DMHA 1MR3F 3EASA 4BAUA 3QVJA 1VL1A 2G63A 4YRLA 2V7EA 3E3NA 3L79A 2X86A 4DV7B 2R2GA 1HTWA 2RHOA 1I4OA 1DOAA 3FW1A 3G1WA 3EIUA 3KQMA 5CA1B 1E6EA 1OH8A 3NO4A 4MRMB 3OWHA 4OXIA 1G4HA 2R66A 2HRCA 2WR8A 4JQOA 1NASA 3ADBA 1Y3IA 2Y93A 2C2KA 2CB0A 3O94A 5FFMA 2FN4A 4R83A 5EKSA 2BTEA 2YYZA 4GRAA 4P35A 1TK9A 2JARA 1U2GC 3KXLA 4GRDA 5I45A 4D4KA 2XZOA 4UAVA 2YN0A 3OOWA 4RABA 1N32B 5JCOA 5JLAA 2Z8YM 4K05A 1NV9A 3SDBA 2FZ4A 3AL2A 3JQFA 3IP5A 1TJ4A 4BE4A 5M3BA 2BM0A 2BV3A 2CNDA 1I8TA 3RSHA 5JJBA 1NG1A 1CJBA 2REQB 2GFIA 1C3JA 1J6UA 3BREA 4HMOA 4ZAWA 1UC4B 4CG0A 1N7IA 1PR9A 4N18A 2WIJA 4NEGA 1Z22A 3FDZA 1O95D 1HSZA 1TZKA 3A14A 4OCZA 3DFUA 2GO1A 1ETHA 2PT9A 1OI2A 3TMYA 3JZMA 4J0GA 2GFQA 1QO0D 1C7RA 1U2DA 5AI9A 3QKTA 2DC1A 2FLKA 2ZRJA 1US8B 3RQIA 3GLIA 1SZPA 4XDYA 4XQEA 4XX1A 2C0PA 3P20A 3IUNA 3RC7A 5J43A 2R8YA 4EZBA 5JV5A 4KREA 4U6QA 2BP7A 2VZEA 1JECA 4UHKA 1VTKA 4ND8A 4AF8A 1Y3AA 4D9GA 3OCXA 4OKIA 3AP2A 4KRYA 5G40A 4E1AA 1JJVA 3L7YA 4MUJA 2Y4NA 5K4GA 1KXZA 1B00A 1KJYA 2IYNA 2H85A 4H31A 2NSJA 1E1DA 3PFBA 3PFIA 3AFHA 3UMCA 1G55A 1XNRB 1L5MA 1P6QA 2SCUA 4GWLA 4RFVA 1RAEA 2O1XA 5GAJA 2BL4A 5TS2A 3TCKA 3TQSA 3F6SA 5KUTA 4UBIA 3ST7A 3UCFA 3LZCA 1ODJA 1BEEA 1RXYA 4W5TA 1WOYA 5CT8A 5ALFA 1J2TA 5DNWA 2HZBA 3BULA 1JFFB 3C3JA 3OJFA 3P45A 2Y1WA 4KMSA 4MICA 4F8YA 2QROA 2D5IA 4L16A 3AVOA 3NJ8A 3TJMA 5JVDF 4AJ9A 5AJYA 1J2YA 2C9DA 4OF4A 4XPIB 2I8LA 3GGJA 4OHUA 4WCFA 4CQNA 3ED5A 2HBZA 3TQQA 3GT7A 2C88A 5E7JA 1L4GA 1RJWA 3W2IA 5TX7A 3KJHA 2YHSA 4N5LA 4ZVOA 4DWOA 3COYA 2FKNA 3P0FA 1BFUA 4EJ6A 4KPFC 4ZDWA 3B5IA 4C07A 1RQ7A 1AKEA 4HDOB 4M8LA 2BSQA 1T9CA 2C7QA 3G1TA 2YQZA 4ZJZA 2BEJA 1UKBA 4OYRA 2LKDA 3LBNA 5L7TA 4V1CB 1KSJA 2HF8A 2C4TA 5KWVA 3FMFA 2P35A 5TMEA 1P0QA 2IYVA 1GTMA 3QVUA 4C7OB 1KY2A 2XITA 4FFMA 5JQWA 1KDRA 1IVYA 4YJDA 2HJ9A 2PRJA 3GLHB 3LP6A 1QH0A 3E82A 2YJ5A 5BNFA 3CJRA 3VJLA 4OB7A 1P0MA 3I9V1 5ALRA 1D4ZA 2EHJA 4E5MA 1A9PA 5AKYA 3X1JA 1K7YA 3QKRB 2WJVA 3LCRA 1ZO8A 1WZNA 5B2ZA 2H08A 3M7IA 3R6TA 3KEFA 4YJGA 3D7SA 2JHPA 2J3JA 5JYCA 2KJQA 2PGJA 4HWKA 4OEHA 1JZTA 4HFJA 1WUHS 2AN1A 4DS3A 2WA2A 2WJHA 3SC6A 1IY0A 2BRUA 2YWDA 3BH7A 3QE3A 3MHTA 2HO4A 2AX4A 4N0EA 4PBTA 3G17A 1YDWA 4PZYA 1G6Q1 2ZQYA 2VA8A 2PD4A 1F4PA 3COWA 1CETA 2JRLA 4NPAA 5EG5A 2I6TA 3IE0A 3JYHA 4RA6A 3V9PA 4LK3A 5JJKA 1MVOA 4MUEA 2I3GA 4CF6A 1N5DA 2I8CA 3KAJA 5BSFA 2XZLA 2CK3D 1GG5A 2HCRA 3LT0A 3M5WA 3Q2IA 4X1KB 2TMKA 3VPSA 4EPVA 3JWGA 3VR3A 4EKGA 3NXKA 3JQ8A 3TUJC 2ST1A 3E4CA 4MR9A 4UW9A 5FWYA 4KE9A 2AZMA 1IAVA 3GUHA 3B2QA 1UDAA 3S2UA 4XYBA 3VNAA 4CCYB 4LOHA 4HI0E 1P0PA 3WC4A 1ULTA 5JTTA 2Q5LA 3MAJA 4N1AA 2PH3A 3SIRA 1AKVA 2VA9A 4QE3A 3VOSA 2NXEA 4A82A 1A4XA 2DH6A 2X9VA 3G89A 3R5KA 3SXJA 3TNJA 3OPXA 3PLNA 3JYQA 1ZVJA 3IT3A 2GRUA 4GPTA 1L5NA 4JI5B 5C1BA 2VL7A 3IURA 4B46A 1R16A 3F7NA 4DBVO 1MOPA 4ZRDA 4WESB 4OG2A 3D6AA 1D09A 1U04A 2QSZA 2JLUA 1A8QA 3QKIA 2VOJA 4MVJH 3T3OA 4PC6A 1O96A 2SBTA 2QN7A 3ETEA 5TNXA 3ZZ1A 2P5SA 4G0MA 1UOEA 4LF4B 1IM5A 3I52A 1ZGBA 4A36A 2PRSA 5F77A 1EWRA 1XMVA 4YDSA 2CL6X 5DCUA 1QFJA 1RQ2A 3ZCTA 2ZT5A 4IV8A 4RMJA 1VE5A 3LW8A 1NVUQ 3TOVA 3PUWA 3QLTA 4LK2A 1XN4A 1OBHA 3F5DA 1XRPA 1IN1A 3HDHA 4BJHB 3RV3A 1DTWB 1OUMA 3M1LA 3NT5A 4PZLA 3IP9A 1XZJA 3N7AA 4L0MA 4EB3A 4LV5B 2ETXA 3COSA 1ZEMA 1TC1A 1ZCJA 4D3YA 4Y6QA 1QK3A 5ALJA 3C45A 5IJ9B 2FWIA 3OFNA 4OOFA 3TLMA 3BVPA 1JUDA 1Q6ZA 2JZOA 1K8YB 3GJYA 2WB2A 3FFTA 1SCJA 2UZ1B 3HB5X 4P2BA 2ACEA 2C8JA 3S8MA 3UMMA 1J24A 4BEJA 3JQ9A 1C50A 3T95A 4MQMA 4C6TB 2J9ZB 4BEVA 5JCZA 3OO0A 4HDRB 1NBHA 1RU3A 1V25A 1JQJC 2DBQA 1AZLA 1XLWA 3IAEA 2IEGA 1J1ZA 3Q15C 4GEGA 4PIPA 4DQUA 2PXCA 2B4KA 1SZDA 2PLAA 1RXUA 2ZE8A 4JKIA 3SHQA 3SN6A 4REQB 2WP8J 3CN7A 1YS6A 1KMCA 2D8AA 2XOKD 2Q45A 5AKGA 5DNEA 5DTQA 1TCUA 3H6KA 2DE0X 4DN6A 4Q6BA 1TAGA 3QFRA 3HKEA 4U2BA 2Z6QA 4KGVA 1XAJA 1YS9A 2GERA 1QGZA 1V0JA 3FNGA 2JJ2D 4AVYA 4DSAA 1RAAA 4M22A 2EDCA 3G9TA 3NVMB 3EX7C 3WGKA 3O9ZA 3Q9NA 2YJNA 3OF2A 4BKRA 2ZYWX 3PEWA 1DU4A 3VDQA 2RGRA 3LVBA 3VPHA 4D46A 2P11A 2HQOA 1WCWA 2Q1SA 1AVTA 2B8TA 4KKXB 5TPZD 2J5RA 3LP5A 4TTPA 5EXDA 1TIPA 2NYUA 3ILYA 2QGNA 4GVLA 1PNOA 4M9CA 4ABYA 3PNQA 4E31A 1E1LA 1CVLA 3OZAA 1UK8A 2ZYVX 1AMOA 4LKOA 4XD2A 1QIHA 4AMBA 1ZD4A 3PQ5A 2BCJQ 1S4QA 1UJ2A 1NE2A 3ZY5A 3S40A 3DEAA 1UWKA 1XVVA 3S4YA 2MR5A 1CJCA 1ISSA 4H7EA 4TMWA 3VR6D 1A5AB 4MVYA 1QYRA 1O89A 3DAPA 4IHAA 4HBZA 1U7DA 4E3WA 4WBNF 4Y2SA 4A2QA 4P6VF 3A32A 1NI4B 3FVTA 3R3VA 3UAWA 3G5MA 4QT0A 1RZUA 4MCIA 4UAUA 1T29A 2LUOA 1P0IA 221PA 1PTJA 4Q12A 3W5VA 1GYQA 4WOBA 4E6EA 2PUAA 2NMVA 1OLSB 3ITEA 1M2OA 3FB1A 3PJGA 3ZUPA 2XR1A 1SXHA 3RVJA 4Q7EA 5LNK6 1KQGA 3GGCA 5EJMA 3IQFA 2QKYA 1SC6A 1GV0A 3IUMA 1YDGA 2GDZA 1I24A 1YMUA 2P3LA 4MQUA 3LE8A 4CWAA 3OE7D 4R8LA 3X1ZA 2XYGA 2GILA 2ZSEA 1M1NB 1M0WA 3WJ7A 4XSHA 2PS1A 2AEEA 4DUZB 4NOKA 4IUYA 2WSBA 1PQUA 5FX2A 5DGIA 1U2ZA 4CQJA 3WAJA 2O3QA 1F8GA 1NM5A 5AM4A 5G0VA 2WD7B 3DE3X 3SHWA 1O96B 4IIEA 4CMIA 1ECJA 4TSRA 4M0MA 5K0TA 4I2VA 2VZLA 4NY1A 4U7JA 3O4JA 1TTHA 2HHCA 1NE7A 3AOEC 3ZJUA 4LF7B 3CXUA 4EB6A 5FWXB 4Q5IA 1Y9JA 2AUMA 4QVGA 4E1BA 3HKCA 1PL0A 3FYUA 2R4QA 4H4EA 4DNXA 2GPWA 4GF5A 3D6UA 1D1QA 4JC8A 3HP7A 3IPRA 3BEDA 1EK2A 5I8PA 3LGSA 1KMMA 1U3GA 5KU7A 3PC2A 4BY9E 3H5NA 1XU9A 6YASA 1Y3FE 1M8FA 4Q66C 8MHTA 3K9BA 4Y8VA 2IA5A 3KT6A 4K6MA 4F6RB 2IBTA 5ELXA 3E9YA 3L7MA 2NTJA 4KDEA 2RHLA 4HDSA 1X7DA 1ZNYA 3QF4A 5JSYA 3LHDA 5L4SA 4JA2A 2FN9A 2ZE5A 2YKGA 4X1YA 2V1XA 1QAOA 4KQGA 4C0XA 1UT6A 4A91A 3SGLA 2QMHA 2W6JD 1U28C 1NULA 1YQUA 2RHGB 3KVVA 2YXDA 3FUTA 4IXMA 4HVLA 2ZT8A 2BGNA 4NKRA 1EP9A 3HEAA 4FCWA 1MO4A 3H16A 1VI5A 3AVQA 2RHHA 3OX3A 4NF2A 1AM4D 4HN4B 2N9UA 4OK5A 1K6MA 3C8ZA 3RC1A 4AY2A 2XAAA 3A9SA 3IOEA 1RVV1 3IHWA 4TMXA 3ICQB 5KNCH 1VHJA 2YVUA 5LU9A 3NALA 2M6KA 4KQCA 4PTZA 3RU9A 4MVJI 2ZPTX 2FPSA 1PG2A 1ZK4A 1Z6YA 3B48A 4ZCQA 1A7JA 2VHJA 1IZ9A 3ZY4A 4AKIA 3B6MA 3M6VA 4FYHA 4UXHA 4I1IA 3R3XA 3VDMA 3ZXSA 2C4KA 1Z0KA 3FX2A 1T0JB 3FAZA 3MCAA 3ZE0B 5BORA 4WOJA 2O2JA 3GP3A 1X1RA 3ZKWB 4CM1A 4X93A 5LB2A 1R8SA 2QTVB 3SQNA 2NSHA 2HDNB 1PLLA 2WWTA 4IQGA 3PNSA 1QRAA 4KWEA 3S55A 3SKVA 1VBFA 1NBEA 3PQ4A 1B42A 4V3CA 4ZQIA 3S2YA 3GLGE 2EZTA 3E05A 5P8WA 4DDHA 2V9ZA 4J07A 2XOXA 3JYOA 5C53B 3BZUA 1HETA 2YTZA 1WB4A 3W05A 1I3LA 2W0SA 4E5VA 4JV5B 4NMWA 3WKDA 4F71A 2TMGA 4A26A 1QIDA 3KO8A 1U81A 2FW8A 4X92A 3CEPB 1R0WA 1HE5A 4J8PA 5AOBA 1DXOA 4MMXB 3AHIA 1GPWB 4UM7A 1O57A 4J29A 5A0FA 3S2SA 3CR7A 4U4AA 2IUSA 1UK6A 2A6PA 3OJCA 4P32A 3RVKA 3E81A 5A9SB 1BS1A 2ZW9A 3G2MA 4LYDA 5F1KA 1OR8A 4DYVA 1OH7A 4OMFG 2PXXA 3UAVA 1X9HA 4CM9A 3QLEA 4PAWA 3Q0EA 1N5OX 3T7KA 4IGEA 5K0NA 3RVBA 1FMJA 2LD4A 1EFRD 2XGSA 5IMSA 3LUGA 2P6RA 4XTCS 3SU8A 2DBZA 3IMCA 3F1LA 2OTCA 3D2AA 1QMPA 5L7YA 2VDNB 5KVAA 4Y7DA 1GQFA 3OX1A 4B4OA 2O2IA 2P69A 2ZK7A 4M8SA 3PXUA 1OTYA 3C5HA 2XVMA 1XD2A 3HZRA 5TVGA 3TBFA 4B3TB 3RG2A 2CT8A 1T8TA 5ESRA 3SXUB 4C04A 1ORTA 1GRCA 4IKOA 2IXAA 4CQLB 5D5QA 4MO2A 5AHKA 4C7JA 1XMQB 1TCBA 2B9EA 2NV6A 3PLRA 1L9XA 1NW6A 3DULA 4Z3DA 3QLUC 1N4AA 4DLTA 2PSHA 3E6AA 2ZRLA 3RSOA 5A02A 2I4MA 3R7SA 1OKKD 4RBNA 4H1HA 1IJEA 3QX9A 2HWYA 1QIEA 2GXSA 3LYLA 3F0TA 5K2MA 2IEYA 3KD2A 4C2BA 3EAQA 4KVAA 4YV1A 2OCDA 4NJEA 4UCFA 3EQZA 4BBPA 3OMLA 4EG6A 2XVAA 3EPRA 3MPOA 3MYRA 4LHYA 2P30A 3AW9A 5K7SA 1CUVA 3QI7A 3QNMA 1K27A 3PDHA 1R66A 2C2WA 2CLMB 2X1MA 3NANA 3L4BC 1P44A 2H65A 5FLEX 3HYRA 1JLMA 4BGEA 1EFVB 4TZ6A 3F97A 3AR6A 1N1DA 1EM6A 1DRVA 2EEPA 1AQYA 1BDJA 2W71A 2XVXA 2XWSA 3DCIA 4OXNA 4PAGA 1OZHA 3WL4A 1J2RA 4OLBA 1PT5A 4EEZA 1ZR2A 1XLTA 1MC5A 4MRAA 1U9IA 4IDFA 2PFKA 3NYRA 3QYJA 1QRDA 2CVPA 4CM6A 4CF5A 1Y4DE 3UXMA 2J09A 1JH8A 2QG9A 1V3QE 2RH5A 3AF1A 4Y2XA 2OSVA 1Z16A 3B1KA 3MPUA 4EGQA 4MP8A 1CE8B 1K7CA 2P6PA 1QGED 3K4PA 3GCXA 4KKVA 3R8CA 2BY4A 5BSHA 4KSCA 1JSCA 4QUGA 2RFLA 2OM2A 3ZLTA 3JAWA 5IYZA 1QORA 4BV2A 3G88A 1Z47A 5F7JA 2JHFA 4FDAA 1BJKA 4JFRA 4B3HA 4YY3B 1RLIA 1JFSA 4MGKR 2Y3IA 3CLTD 3COZA 1W4RA 1Z2OX 3ZQUA 4CTOA 4JBIA 3KR2A 5LDGA 5JC1A 1VLQA 3JQRA 2QN8A 5TQ0B 3OOYA 1L8QA 2J6CA 3HCPA 3HHEA 4KPUA 4NHEA 4LJ4A 2GDJA 2K7ZA 2YWHA 3ZHXA 3FMIA 2YV2A 3LF2A 2JZNA 2Z08A 1D1PA 1QWSA 2E89A 5K6AA 2PMEA 4MA4A 4ZCIA 4JT8A 1LRJA 2NADA 4LWQA 3Q7TA 5H4HA 4KFSA 1N8TA 3VSBA 1A8SA 4G1FA 1RM3A 4WBXC 3C6ZA 1YBHA 2IYQA 3TM5A 2WTNA 1WXHA 3HV0A 4GMGA 4UU7A 1F9EA 1MJFA 3AVYA 1YQQA 1ZVMA 3PFNA 1C0LA 4WERA 5IAGA 1PWZA 2GZDA 2HY7A 5HKLA 5I9LA 1ZIDA 4WFIA 3G59A 4JP1A 4Q0MA 1ZONA 2XUZA 3U48A 3ASYA 3DDCA 3A4TA 3HN7A 1P1CA 1T3HA 3RRYA 3VAZA 1W4ZA 1RZ3A 3EY4A 2AK2A 2O0HA 3O2QB 4G37A 1JHAA 1OBCA 5BSVA 1NQOA 2HB6A 2A5GA 3C3YA 3JCZA 5CYOA 3DZCA 3AJ9A 3AT1A 3IEXA 3QUTA 5BQPA 4JS0A 2ZIUB 3EXG2 1JTEA 4JC0A 3IHTA 4PGHA 5EMHA 3WRYC 3I9MA 2VWPA 4JODA 4XCQA 3NGMA 2H2IA 3FLMA 2FSGA 4EBBA 4IDEA 2VF8A 1QQ7A 4IR7A 1V41E 3C15C 3K9WA 4ZI2A 4R16A 1ODFA 2IPXA 4WNCA 5B55A 5JECA 4LRXA 3T12A 3GH3A 3UHAA 3I72A 1KK1A 5CDTA 4KQ6A 2R1UA 1XZ8A 2XMQA 3NEPX 3QK7A 1I1QB 1KKUA 2JGNA 4JWTA 2F3PA 4XWOA 3VYUB 5FPSA 3ZDQA 1CQWA 3W5HA 2TYSB 3FDZB 1M7GA 4KWTA 4XSGA 1SK8A 4X24A 4YMIA 4EMUA 1T5LA 4JZKA 3DTNA 3HRIA 3A4VA 3UJ3X 4AK9A 3T5BA 1ZIPA 1KNXA 1XNHA 3RVMA 3WE7A 4ZHQB 2XF2A 4IOKA 4BV3A 1KERA 2KM1A 2EWMA 1GU0A 1U8ZA 3IESA 4XLLA 3VC2A 5JFOA 3E8MA 1VSTA 3IUQA 5BMOA 4QM7A 1LPNA 5DDIP 1LK5A 2J3LA 3PC6A 3NI2A 1WZIA 5CW1A 3D2BA 5JE8A 4J7XA 4MTCA 4NBWA 5FWYB 2WOOA 3H1AA 2QIOA 3LC7O 3R0QA 3VR4D 4BVFA 3ZQJA 1NQWA 1A9ZA 1RTTA 2J5BA 3AFOA 3W3ZB 3QLVC 3R0IA 2XZPA 2WYOA 5CLIA 3EIHA 3F1KA 2ZRCA 4TYPA 1G7RA 5DNVA 3SM3A 1EDOA 3AR5A 1U0GA 3MYYA 3MUOA 3PHIA 4YRPA 3TM4A 4RA6B 1KK3A 1TYAE 2AQIA 3AY7A 4V0RA 2X2OA 1TO1E 2FQWA 1TAHA 1QG4A 2PUFA 3OZXA 1Z4IA 1CVIA 4BQEA 1NMZA 1V11A 5G02A 5AJWA 1DWUA 3ZW8A 3Q11A 2HQBA 5FPQA 1IDN1 5JAZA 1LDEA 1QP4A 2PSJA 2J3IA 3GDFA 4QQNA 5DNDA 3DDHA 1UP6A 3VDNB 1NVVR 1Z2EA 2L2QA 4RTQA 5KNDA 1DARA 5FIUA 1J09A 3NR2A 3BL6A 1P4RA 3GA5A 1RYEA 2QAJA 4M54A 3PNYA 3UKOA 4U8HA 1NF3A 2ZYHA 3NWPA 3K1TA 1IWBB 3F9IA 3Q7PA 3D7LA 5E7MA 1CKEA 3VHXB 2EL9A 3IO5A 4ARBA 1O4WA 3ASUA 1G8PA 4ZXFA 4DJAA 4MQEA 3V97A 5J59A 3RLFA 4OJMX 1XRSB 2X1VA 4KXUA 2JGJA 4FMDB 3PQ2A 4RK5A 2Y0EA 2IV3A 3KUCA 1FMLA 3LX4A 3ENNA 1SO8A 1HI9A 1KEZA 3WTCA 5IRCD 1RRFA 3LLCA 2PO5A 5ICMA 3SPXA 4F4UA 1P6XA 2P4EA 3V4RA 3JD0A 3C3WA 1Y1LA 2EFJA 1IHUA 2P8SA 5ESWA 1NBME 4AMYA 3IOBA 2N3ZA 3DVAB 1W5BA 2GJAA 2PUBA 4BXOB 2WFMA 2GZ3A 2HJRA 2WIAA 3CUWA 4ZO6A 5G0TA 1NLUA 3GYBA 3H7AA 4G9BA 3WWPA 5B57C 3STWA 2GHIA 3FFBA 4R1PA 1JHPA 5JQGA 1J70A 4TRJA 1GTSA 2O54A 4MPTA 3A6JA 5C4IA 3FVWA 4XVQA 1XCBA 3QFSA 2HUPA 2I7XA 3ZW9A 1ODCA 5DX8A 2QZ4A 2QZJA 1Q6YA 3MGBA 3SVLA 4ZYYA 3P9XA 1LLCA 3ELWA 3QBEA 4ZVVA 5JPCA 1ZUHA 1ECBA 1NPTO 2ZAOA 2BGGA 1N7HA 4Q3KA 4ZYTA 2CFCA 3MGGA 5ES3A 2Y92A 3W1WA 4M7PA 5ALHA 5DTMA 4NCHA 1L4NA 5LQSA 3RBXA 5JMTA 2G80A 1QH9A 1CPYA 2GEBA 4FX2A 2QG6A 4RZIA 5AW3A 1KY3A 5JC8A 3KLNA 2VJAA 3RWOA 1ADBA 5T4BA 1W0JD 3OY7A 1Q11A 5TS3A 4E15A 2ZB7A 4JXXA 1NBWB 4OFWA 5JNVA 2JCBA 4C1BA 4YN3A 3U7FB 1KMNA 2ZWOA 2QL9A 3L6EA 3QPVA 4WFKA 5FJJA 4Z1OA 4R7GA 3FVVA 3BE4A 3PSAA 3DMGA 4FSDA 4A03A 3D8HA 2ZRMA 3L0PA 4Y1FA 3UENA 1UPUA 4QJ5A 1FFDA 4E88A 2WM8A 4LQCA 5I5GA 2UU9B 3LY9A 3L6UA 2ZBUA 4NNOA 4JJGA 4EY3A 4FQ8A 1ZGGA 2V7WA 3B3FA 3L7JA 4A8JC 4OB8A 7ADHA 3VISA 5F4BA 1LZLA 3W2GA 4IXTA 3WP1B 3MTEA 2I6GA 1G0NA 1U8CB 1EDEA 1EHYA 5CDSA 1SHJA 4LZWA 2D74A 2Z9DA 3TRKA 3VTZA 4U0KA 1KJWA 4S05A 1KORA 3EBOA 3INYA 4EKIA 3PDWA 2YS6A 1XA0A 2JCXA 4ZQCB 2W2KA 4BCDA 1AA6A 1U63A 2ZVDA 1XZNA 4LOIA 2RC6A 1U0OC 2O6HA 2VLIA 3KZXA 3DP7A 4MR7A 3VHXA 1ISGA 4O2AF 1CUCA 1JEQA 3IO3A 4DQKA 3SEZA 1P3Y1 1E1QD 4MUMA 2VHYA 2CXTA 3AIOA 4CT5A 1YQWA 4DARA 4KQEA 2G04A 1BDMA 1DEOA 1F60A 3B2NA 2DTDA 3OU2A 3O8NA 3WK6A 3CVXA 1XPOA 1BMDA 1HGXA 1M2OB 3NBFA 3NRCA 2W6JA 4N4AA 5KTRA 4K1LA 5J4HA 1WDKA 4OGGA 1Q0TA 1SEVA 4MROA 3ZD8A 3CCFA 4M21A 1T5SA 1O58A 4RHUA 1EHIA 2DY0A 3PNOA 1Q91A 5LQNA