3SN8A

Crystal structure of sars coronavirus main protease complexed with cm-ff-h (soaking)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
306
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Peptide aldehyde inhibitors challenge the substrate specificity of the SARS-coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 84
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3sn8A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sn8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sn8A02
2VWNA 1XVMA 2Q6FA 4I31A 3VXFH 1V2LT 3T5FH 3TPIZ 1VITF 1DS2E 2ZI2H 1TABE 3KIDU 3GDUA 4D7FA 2BZ6H 3QDZB 1TIOA 1SLWB 1S83A 1TGTA 1N6YA 1MUEB 3NUMA 3PLKA 1ZMLA 2YNBA 1FQ3A 2ZGBH 3A7XA 5CHAB 1O2YA 1FUJA 2SGQE 1KLJH 2WUBA 1RXPA 1WV7H 3BF6H 5E8EH 2FOCA 1HJ9A 4FVDA 2WPMS 1KXEA 1QJ7B 2JKHA 2TPIZ 2O8MA 2GKVE 2XNIA 1T8MA 1QA7A 2QC2A 4NGAH 3ZVEA 1P02A 2NU0E 2VIDA 3GCTF 5E2OA 1MTNC 1NY22 1GBIA 1HDTH 2AGIX 2PR3A 3F6UH 1NTPA 4X8SH 4X6OA 1TPPA 1P09A 3EYDA 3R3GB 9ESTA 1NFXA 2RCEA 4Z6AH 5E0HA 1BTWA 2F9PA 8GCHF 2G52A 1K1JA 4WF8A 2XW9A 1E34B 2AS9A 1HAZB 1V2WT 4HFPB 3A7YA 4A6LA 6ESTA 2HALA 1ARCA 1XM1A 3E0PB 4NSYA 1HJAC 2Y5HA 1O2KA 1AGJA 2W5EA 2BX3A 4BAMB 7KMEH 1BRCE 3SGBE 2Z3DA 3MU0A 1DOJA 2H1UA 3PMHB 1AUTC 1EOJA 4NZQA 1O2IA 3BTQE 4UEHH 2OC8A 2QXHA 1O2VA 1KXCA 3LOXA 2VWMA 3K65B 2BY5X 4YOJA 3CENA 1H8IH 1BUIA 1O31A 3ZZ8A 3RXPA 1IQMA 1P9SA 4YZUA 1LQEA 2XTTB 2GZ7A 2VVCA 5JYIA 1QRZA 1GJ5H 1K1OA 4CRFA 2AMPA 4X8UH 4GVUA 1H8DH 3BG4B 3W95A 1JIMA 4I8GA 1EJNA 5F8XA 4ZKNU 2PKAB 1C5ZB 3SU1A 2SNVA 2ZCLP 3LH1A 1O39A 1E0FD 4MQAA 2BY9X 1SGIB 2FP7B 2TBSA 1MU8B 3TK6A 1C1RA 1GJDB 5JBTA 4KELA 2ZHWH 5DP3A 2A4GA 1HLTH 4AG2A 2I6QA 4D76A 1A5HA 1DICA 1ZMJA 4FU8A 3VGCB 2ZDMA 1TNLA 3TGKE 1DPOA 3TH2H 4H4FA 1C5XB 4TWWA 3O8DA 1OP2A 1ABJH 1Z8IB 2ZKSA 2GX4A 2ZU1A 4NA7A 1TGNA 4ZKSU 1C2MA 3SO3A 3HKIB 1MKWK 3DFLA 3UREA 1CBWB 2FIRH 1Y3UA 1C5SA 2ZHEH 5C2ZA 1W0YH 1O3DA 1MZAA 4ASHA 1IQLA 1KXBA 2B8OH 2FI5E 2GMTC 2KAIB 3M5MA 3BIVH 1SGQE 4ABBA 2XCNA 1AE8H 1B5GH 2BY7X 2FOEA 3OX7U 1FY5A 1IQEA 3SQEE 1KXAA 1RFNA 3GCNA 2OD3B 2Z7FE 1OXGA 2NWNA 3IG6B 1A3BH 1AKSA 4I8JA 3QK1A 4AORA 5HM9A 1CVWH 2ZO3H 3JZ1B 4GCHF 4I8KA 3MU4A 5LPRA 3E3TA 5E0JA 1J14A 1GI4A 1H9HE 2Y5GA 2C3SA 1HXFH 1EB1H 1PPFE 3T28A 2A4QA 3SU5A 4OS2A 2NU3E 1K9OE 2XBVA 4E7RG 2P3UB 3OU0A 3UQVA 3BTGE 4D9RA 5GJ4B 3MTYA 3TH3H 5FPTA 4Y0YE 5EGMA 2VGCC 2HNTC 1P12E 3RU4D 3SJ8A 1BRUP 1CA8B 2BOHB 3S9AA 2UWLA 4KGAA 1HAVA 3QN7A 4NWKA 4Y79A 1ZJKA 3KCGH 1SGRE 1T7CA 1MTNB 4K8YA 2OP9A 1EX3A 5LPEA 1BMLA 2BDGA 1GI9B 1P9UA 3LT3A 1AFEH 1QJ6B 1NRPH 3QZRA 1DWEH 1SGFA 2B0FA 1ZHPA 2V3OH 4AYYB 4A1VA 1TLDA 2BVRH 3FZZA 4Y11E 4D9QA 8ESTE 5I25A 1QJ1B 1BBRK 1C1QA 4OS4A 4NIXA 1WCZA 1GVZA 1C5PA 1WQSA 2SGPE 1UTPA 1O2SA 1HJAB 5FCKA 1BMAA 1SGDE 4K3JA 2ODYB 1WQVH 2H5CA 1QBOA 1GL1A 1EZSC 5T6DA 1TB6H 2XC5A 2RA3A 2OBOA 4Y7BA 1GGDB 1TALA 1EJMA 3K6ZA 2BLWA 4ABAA 2BM2A 3EA9A 3SHAH 4ABIA 2CHAC 3RXBA 1TGSZ 3ZYEA 2RG3A 4K60A 1BBRE 3GCHC 1AVWA 1WUNH 1ZHMA 2ANWA 2Z94A 2R3UA 4WWYA 4X8TH 1OS8A 4JK6A 1ZMNA 1KTTB 1QB9A 3A8CA 3V13A 5IDKA 2ZGCA 2BD3A 5ETXA 2ZGJA 1AN1E 3AVZA 2AGGX 5F6MA 2RA0A 1QRXA 1F5RA 1GJCB 4VGCC 1GHAF 1KLIH 3GY4A 1V2JT 2XCFA 1OYTH 3M5LA 1G36A 3A88A 1EAUA 2CV3A 3SI4H 3K6YA 1LHFH 1BTHH 4INKA 3KQCA 3TJVA 2JETC 3ZZ6A 2DE8A 4JK5A 5FHTA 2FDAA 1N1LA 2VH0A 4FUFA 1XUFA 1P2IA 1UTQA 1HGTH 1O30A 1X7AC 4K8BA 1Q2WA 1YPEH 2ZTXA 3Q77A 1YCPH 8GCHG 1GHWH 4LXBH 4GAWA 3ZV8A 4Y0ZE 1HCGA 3DFJA 3A8BA 4CRBA 1NRNH 1IHTH 4OS6A 1O3KA 1P04A 1ZPBA 3FP7E 1HAHH 1TRMA 4NIYA 4B73A 3T27A 3RU4E 5JPMH 2HVXA 1BZXE 2I6SA 1TE0A 2HPQH 1F92A 4U2WA 1JRSA 1BOQA 2H5DA 4O03A 3H5CB 2G51A 2GMTB 1W10U 2FPZA 2BD7A 1V2MT 4ZXXH 1D3PB 3BIUH 1DE7H 1T31A 1C4V2 3ENSB 1D3TB 1H9IE 1O3BA 2AEIH 1ELCA 1TA6A 1OSSA 5L2YH 1DM4B 1CA0C 4IMZA 2ZPSA 1ZPCA 1A0JA 1YKTA 1RTKA 1G30B 1D4PB 4ESTE 3LPRA 2PKSC 4INLA 2VU8E 4J1YA 3QUMP 5T3HA 3RC4A 1DUEA 1SGNE 2G00A 2JH5D 1YGCH 1GMCG 4Q7XA 5J4QA 1O5FH 1DLKB 3LC3A 5EQRA 2ZFFH 2ZCHP 1UTOA 3E1XB 4OGYA 1V2NT 3ZZ5A 4WMDA 1CSOE 3ESTA 2W7UA 3TJOA 2A5AA 3NWUA 5GWZA 5E2PA 1FIZA 3PLBA 1QQUA 3GY6A 4ZHMU 5A2MH 1UJ1A 3P95A 1O2JA 1SQOA 3H7TA 1SG8B 1SFIA 2VGCB 1TFXA 1H1BA 4GSOA 1C5MD 3MI4A 5C20A 5I46H 5HYOA 4MTBA 5EQSA 1S85A 1G9IE 1S6HA 4HZHA 1GHZA 1TPAE 1IQKA 4NA9H 5JBCS 1HNEE 3F9GA 1AY6H 5A8XA 3HGNA 1MMJN 3PYHA 2UWOA 4I8HA 4JZDH 1TQ0B 1AE5A 1FIWA 1LHDH 2EA3A 2Z6BD 2FS8A 2VB0A 3S9CA 1O3EA 1V3XA 1MCVA 1PFXC 1O3HA 1CGHA 2TGPZ 1O3AA 5TCAA 3B8JA 4YM9A 4BANB 3T2NA 1HAYB 2ESTE 2HRVA 4NSVA 4E05H 2R3YA 1CHGA 4TY6A 1B7XB 1EPTA 1K21H 4ZROA 1QTFA 1RIWC 2ZHFH 1F7ZA 3UIRA 4BAOB 2PSYA 3FP8E 2QIQA 1JRTA 3GICB 2GZ8A 1DWBH 3Q00A 3UTUH 2CXVA 1KDQA 1C1OA 2ZA5A 1SLVB 1PPHE 3RMNH 1J8AA 2ZDAH 5GIBA 2WYJA 3LGUA 1EB2A 3RC6A 3RMLH 1O3OA 1JWTA 1Z6EA 1MU6B 1P2KA 1QL7A 1HJ8A 2CHAB 3KQDA 1IQJA 1L4DA 1GI8B 3GCHB 5DP5A 1ABIH 2Y80A 4ABEA 3B23B 1C2LA 1FN8A 1O5DH 3MH4A 3DT0H 5PTPA 4HGCA 2K1QA 2PSXA 4Y6DA 1G32B 3KL6A 1DANH 3CS7A 1SMFE 2QY0B 3S7KB 3U1JB 1T32A 4BAKB 4O9VA 1ZGIA 3M5OA 4WY3A 1OYQA 5JBAS 1ZRKA 2PGBB 3A7VA 1XKAC 4TPYA 3SV6A 2GCHF 3RM2H 1GI3A 2JETB 1GI0A 2OUAA 3NCLA 3LKWA 3SU6A 1EASA 2K7XA 2D8WA 1OKXA 2F91A 1ELAA 2AYWA 1HPGA 1ZSLA 2FOFA 3GYMA 1V2QT 3A83A 1XXFA 3RXQA 4ISIH 1LO6A 2FOAA 4FXGH 4XBDA 2WINI 4UFEH 2W3IA 2EI8A 4ZAEA 1E35B 1SHYA 1LKBA 1MTWA 2BXUH 1C4Y2 3PO1C 1DXWA 4BTTB 2VVUA 2BX4A 1YLCA 1G37A 4KKDA 2SGFE 3SU0A 1C1TA 1IHSH 1W2KH 1GBAA 3MU5A 3GDSA 2ZF0H 1S84A 1LQDB 1EATA 1C1VH 5K7RA 1DT2A 3H7OA 3U9AH 2J4IA 1O5AB 3SBKA 1P2NA 1XVOA 1G3EA 4XDEA 1AVXA 2Y7XA 1QY6A 3T29A 2RDLA 3ZZ4A 1MZDA 1C5WB 1GHBG 1GCTC 1ESBA 4YLUA 1ACBE 4B2BA 1CA0B 1AIXH 3GY8A 1VGCC 1O2TA 1P3EA 4ABJA 4HTCH 1C9PA 3BTKE 2XYAA 3E8LA 3TGJE 1B0FA 2NU4E 1QBNA 4YT6H 4GHQA 2PKSB 1F0RA 1BTZA 2QXJA 5ESBA 1YPJH 1ZZZA 4B75A 3F1SB 3MOCA 1O3CA 1O3NA 1GI2A 1C1NA 1P06A 5EOKA 1P2JA 1FLEE 2H9EH 2O8WA 3HATH 3Q3XA 4BNRA 1GMDF 3SQHE 4DT7B 1Z8GA 3E0NB 2ZTYA 3EA7A 4JYTA 1RD3B 1UHBB 4B1TA 1AB9C 1FY4A 3P8FA 2J95A 2W26A 3U8OH 1FNIA 3VB4A 4YLQH 2GT8A 1VCWA 4O3TA 5LPFA 2PKAA 1A61H 3MNSA 4TY7A 4RSPA 1UTKA 2Q1JA 1P3CA 5AHGH 3GDVA 3A89A 3M7TA 4JZIA 4ZKOU 1QL8A 1P03A 2J38A 2NU2E 2OC7A 3LGYA 1ELEE 3M7UA 3RXRA 1O33A 4BXSA 1MKXH 3C27B 4BXWA 3D62A 2FOGA 1DWCH 4WVPE 1SSXA 1YYY1 1HV7A 4RKJB 1XUHA 1GJ4H 2SFAA 3SORA 1P05A 2EI7A 3LGTA 5DP4A 2BHGA 2ZNKH 1YPMH 3SUDA 4LZ4B 2FO9A 6CHAC 1H4WA 1ELGA 4WXVA 3RM0H 2EI6A 4JZEH 4B71A 2OBQA 2Y81A 3EQ0H 3A7TA 1EJAA 4X6NA 1RIWB 5BRRE 4KTSA 2O8TA 1LVMA 9LPRA 1C2FA 1K1NA 6GCHF 3Q76A 3GY5A 4GLYA 4GHTA 1O5GH 3UOUA 1GJ7B 5EPYA 1ZTKA 2ZGXH 1WBGB 3F9EA 2VIPA 3LGWA 2LPRA 3QGJA 1PPCE 3RLYH 3MH7A 4ISHH 1SQAA 1F5KU 3C1KA 1DUAA 2PUQH 2KAIA 3BN9A 1PPZA 4I8LA 3TU7H 3RMOH 1LVBA 3VB7A 1A5GH 3ATLA 4OGXA 1O2PA 2P94A 2TGTA 3RXSA 2ZIQH 1TNGA 3K2UA 3FZDA 2VNTA 2EC9H 1ZOMA 3GISB 1JIRA 3SHCH 2ZU2A 1MTSA 3U8TH 5EW2H 1BITA 7ESTE 4ZMAH 2SNWA 1DLEA 4MPVA 3VEQB 3I78A 1SOTA 2G4TA 3A7WA 2G8TA 4U01A 1DY8A 1NS3A 3OYPA 3QTVH 3BTME 2BD9A 1NRSH 4WMFA 1AQ7A 1QGFA 1C1WH 3IITA 1UVTH 1Y5UT 3PTBA 5LGOA 1EZUC 1DDJA 4JMYA 4MNVA 1GI5A 1CT4E 4CBNA 3E16B 2OQ5A 5BPEA 1O38A 4YOGA 4ZHAA 1SLUB 1Y3WA 1BJUA 1QA0A 3U8RH 2GT7A 2ZDKA 1SGTA 1WU1A 1OWDA 5EQQA 3RXJA 7GCHF 4OS1A 2BB4A 5DP7A 4XSKU 2O8UA 1VJAU 2R0KA 2ILNA 1YPLH 2FS9A 1ZSKA 5JB8S 2IOTA 3TITA 1XUGA 1ELVA 2TGAA 4TYDA 1V2KT 1G2LA 3PO1B 1H9LB 2W7SA 1UK4A 4RKOB 3SN8A 1YM0A 4AGJA 1YCPM 1CQQA 4MDSA 5B6OA 1K1IA 3STIA 4XE4A 4GUXA 1XX9A 3F9FA 3IWMA 2THFB 3RP2A 3SUEA 1XUJA 4Q80A 1D3QB 2FM2A 2FMJA 3AAVA 3NK8A 3SNEA 4Z0KA 3SW2B 1LDTT 2CMYA 1NT1A 1OWHA 2PTNA 1GCTB 3MWIU 1C9TA 2BD4A 2ZC9H 1VITH 3B9FH 1VGCB 4SGBE 1UVOA 4Y76A 2G5NA 2ZG0H 1GJBB 1J17T 1AU8A 3CP7A 3PLPA 3GY2A 2DUCA 5DKMA 1VCQA 3ITIA 1HUTH 4R0IA 1V2TT 1V2RT 1YPHE 1WYKA 1DITH 1BT7A 5AFZH 1DX5M 4B74A 2FLRH 1EZQA 3NXPA 1AZ8A 3SNCA 3ZVCA 2BY8X 1GDUA 2GCHG 3KEEA 4FVBA 1AB9B 5F8ZA 1N6XA 5AF9H 4WXIA 1O5CB 2QGRA 2C8WB 2HNTF 3MNCA 3D23A 1C2JA 3M61U 3PMJA 1UVUH 4O3UA 1PQ5A 1CHOG 1WTHD 1QB1A 1CU1A 1TX7A 2UUJB 1ZGVA 5C1XA 5EPNA 3LONA 4X2WA 1QR3E 2GDEH 1CT2E 1YC0A 4F49A 1Z8JB 1ZSJA 5C1UA 1L4ZA 4LZ1H 4CH8B 1TYNA 2G55A 1MAXA 4YTAA 1A46H 3LGVA 1BTUA 2VWOA 1BMMH 3PV4A 1O34A 1LPGB 1BHXB 4ABHA 3QGNB 1TBRH 3T26A 3PM3A 2ZU3A 3FANA 3W94A 5TCCA 1K1MA 1TQ7B 1THPB 1LHEH 2YNAA 1SFQB 2WYGA 1SGPE 5A8ZA 4DVAU 2GZ9A 5ABWA 2TGDA 3BTTE 1FAKH 3LH3A 2O9QA 1BTXA 4ABGA 4DGJA 4CR5A 1Y59T 1VITG 1HYLA 2FYRA 2Z9LA 1B0EA 5EG4A 1EZXC 1J16A 1HRTH 3RXHA 1ANEA 1GHYH 2Z9GA 2HNTE 1UTMA 2Y6TA 1ETTH 1C5QA 2FWWA 5L6NH 4MNYA 4CH2B 3UR9A 2J94A 4E06H 3KF2A 1KSNA 1UK3A 2OXSA 1MKWH 3ATIA 1KLTA 2OC1A 2P3TB 4Q2KA 3RXGA 3V3MA 3MNXA 3WY8A 3GCTG 2JH6D 4X1NU 4F4OC 4IMQA 3UOPA 4I7YH 3DA9B 4D8NA 3N7OA 1EAWA 1O2OA 6LPRA 1YLDA 1O2UA 4J2YB 1YBWA 1C2KA 1AWFH 1TMBH 1FN6A 5EU8A 2H9TH 1THSH 5DO4H 2A1DB 3LJOA 3SJIA 4B2AA 2B9LA 3L6PA 2ZZUH 1OX1A 3SNBA 3HK3B 1E37B 1TAWA 1C2GA 2PV9B 3PROA 2QA9E 3U98H 3RXIA 2BDHA 1D3DB 3ODDA 3MU8A 5AVDA 1TGCA 2BQ6B 4DG4A 2FZZA 4XBBA 3FFGA 3RXKA 1O2WA 2ZFRH 3URCA 3A82A 3BEIB 2BY6X 1P11E 2FOMB 2BD2A 2FODA 4UDWH 1DVAH 2F9VA 1UCYK 3URDA 1FDPA 4X2YA 1TOCB 5GDSH 2PW8H 3L3TA 1PYTC 1JMOH 1BQYA 4XBCA 3A8AA 1Y5BT 3G01A 1C5VA 1IQIA 3TNSA 3KQBA 1Z1JA 4DJZB 1MAYA 4FUJA 4JZ1A 5F8TA 3UY9A 1O36A 1VR1H 2OLGA 3RUOA 1GBLA 2BVXH 2FESH 3UPEA 4H6SB 3ZZDA 1BRBE 5SGAE 2OC0A 2D2DA 5HGGA 1ESAA 1ORFA 1BB0B 2AFQB 1TPOA 1SGFG 3GOVB 1TNKA 3KN2A 1TNHA 2V35A 3SJ9A 3DHKH 1BBRH 3ZVFA 4BAHB 3V7TA 1AWHB 1ZJDA 2Y82A 1EQ9A 1FI8A 2F9NA 3ZZCA 5JBBS 3RXUA 1Y3XA 4INHA 2QYIA 1O2GH 4M7GA 1IQNA 2V6NA 3A86A 1WOFA 1GPZA 1IAUA 2FTLE 1V2PT 3ZVAA 3MH5A 1IQHA 2FX6A 1C2DA 1A7SA 2ZFTA 5EW1H 2TIOA 1AD8H 3P8GA 3QX5H 2C90B 3MU1A 1GMHF 1NROH 2AH4X 4MNWA 1P2MA 2XBYA 3LIWA 3LU9B 4XFQA 1P10A 1NZQH 3TK9A 3ZV9A 3RXTA 4SGAE 4K5ZA 3UWJH 1EXFA 1ESTA 3BEUA 3ZYDA 3Q3KA 4THNH 3RC5A 2D1JA 3FP6E 3BG8A 3S69A 2VIWA 3ZZ7A 1AZZA 1FJSA 3DUXH 4X1PU 1SB1H 4IN2A 4A92A 1ETSH 2A32A 1J9CH 1V2OT 4GCHG 2CF9H 4KP0A 2QF0A 2J2UA 2FI3E 4Q7YA 4FUEA 4CR9A 3T25A 1XUKA 3AW1A 1JBUH 1TNJA 4K69A 3ZVBA 3A84A 1P2QA 2GV6A 4A1TA 5C5OA 1UO6A 1UVPA 2FX4A 1T8LA 1MTVA 2F3CE 2A7HA 5FPSA 1O3JA 4Y10E 1L0ZA 1EOLA 2XWAA 4VGCB 2FTMA 4TWYA 1INCA 1ANCA 2G4UA 1WAYB 4UD9H 4IC5A 3TH4H 1NRRH 3F9HA 2P93A 3VB5A 4X8VH 1OWEA 2BXTH 1LVOA 2WPKS 1NO9H 4ISLA 2G81E 1IQFA 1O3PB 3TK5A 1SQTA 1O2RA 1O2HA 1GHVH 1ZTLA 2ZGHA 4B2CA 5GPIB 3U1IB 4X2VA 2VIVA 2ZPQA 3KHVA 1KTSB 3HGPA 5DK1A 2GVFA 2P59A 2G5VA 2STBE 1GDNA 3P17H 4AGKA 3M7QA 1UHBA 2BDIA 2UWPA 4D7GA 3V12A 1SHHB 1T8OA 3T62A 4MLFB 1BRAA 2PUXB 1ANDA 1TOMH 3A8DA 1W13U 1THRH 5DP6A 2VIQA 2BMGB 3GY7A 2Z9IA 2OINA 2ULLA 1O2NA 3GY3A 1MH0A 4IBLH 4R8TB 3SJOA 1FY8E 2BDAA 3BSQA 2GP9B 1TMUH 3P70B 3OY6U 1BTYA 1OWJA 2ZHDA 5FAHA 2H9HA 1BCUH 2P8OC 2BLOA 1GCDA 1KY9A 1C5LH 4Y8YA 1TWXB 1HIAB 3EGKH 1KYNA 3ODFA 1DSTA 2A4RA 4GPGA 3O8CA 1HAXB 2FI4E 1GI6A 1RTFB 2QN5T 2ZP0H 1CE5A 5JDUB 2C8ZB 1M9UA 2FOHA 1S5SA 3VB6A 1TX6A 1AO5A 1XMNB 1WTGH 1W11U 1GHAG 1G3DA 7LPRA 2AIPA 2Y5FA 2F9BH 3RXVA 4Y71A 8KME2 3SU2A 5EODA 1UMAH 5C1YA 1O2ZA 3AAUA 2YOLA 4JYVH 1C5UA 1GJ9B 3UWIA 4NFFA 1XKBC 4AB9A 1MD8A 1O3MA 1TONA 1MBQA 4K1TA 3O8RA 1KIGH 1GBDA 1NN6A 3VB3A 1NC6A 3OTJE 1C5NH 1A1RA 3NPSA 2QAAA 4CRCA 1QURH 2VH6A 1GBKA 1A5IA 5FBIA 1C5TA 1GVLA 4WJG2 4HI3A 5GXPA 5TJXA 2BTCE 1GJ6A 4MNXA 1Z71A 2A45B 2IPHA 5DP8A 1GHXH 2AIQA 4NIWA 4JCNA 2GGVB 4AG1A 2OCVB 1W12U 1ELTA 1MQ5A 5DPAA 5CE1A 1F2SE 1S6FA 1E36B 1PPEE 1RTLA 3HK6B 1L1JA 4IGDA 1Q31A 2ANMH 2IJOB 2BQWB 2BDCA 3SZNA 1OP0A 5J4SA 1BHXF 1UTJA 1TX8A 2R0LA 2HPPH 1ANBA 1NPMA 1ZHRA 2OQUA 1O32A 2ZU4A 1BA8B 1YF4A 2A7JA 2CF8H 2AMDA 4ABFA 1GBCA 1LPZB 1GGDC 4K1SA 2Z3EA 1C5YB 2H6MA 4CRDA 1EAIA 1P8VC 2JH0D 5A8YA 1V6DA 3FAOA 2FOBA 2BDYA 4X6MA 5FX6A 1LVYA 2PWXA 3RXEA 1C1SA 2ZDVH 1C2EA 1FPCH 2F9UA 1TGBA 3V0XA 5LH8A 1GL0E 4Y8ZA 3OY5U 3RXLA 1FONA 3QWCH 1FAXA 1SC8U 3LJJA 4XOJA 1ARBA 3SV8A 1GI1A 2QF3A 1GMCF 4X0WU 2ANYA 4X1QU 4AN7A 1K28D 3A80A 1ZTJA 1BJVA 5A0CA 1QB6A 1C5RA 1OP8A 3BEFB 1P2OA 1GBTA 3TIUA 3E91A 2CN0H 4Y7AA 3I29A 2NU1E 2ZFSA 5FPYA 4OS5A 3MYWA 2XC4A 3S7HB 1K22H 1S0QA 1P0SH 2ZFQH 4X2XA 5HXFA 2QXIA 1U6QA 4NIVA 3RXAA 2ZWLH 4UONA 4ISNA 3SU3A 4UFFH 2ZEBA 1EP5A 4H42U 1YPHC 1UTNA 3UQOA 3LC5A 2HOBA 1K1PA 5C67A 3HKJB 3OSYA 2V3HH 2BD8A 1GBHA 3BTHE 1GMHG 4YOIA 1F0SA 3P6ZB 1Z1IA 5C3NA 2CGAA 1QHRB 3CS0A 1FY1A 1DXPA 1OWKA 2QXGA 3FVFB 4FUIA 4DURA 3SUFA 1SI5H 3LGIA 2HWLB 3ZVGA 2CJIA 3SNDA 1TRYA 2AERH 4U30A 4B76A 2W3KA 1O2XA 4O97A 2HGTH 4U32A 3I77A 2O8LA 1D6RA 1HB0B 4CHAC 1O5BB 1O3IA 1OPHB 3M37A 1YCPK 1SVPA 2P8OB 2J34A 2GCTC 2B5TB 2M5TA 1FV9A 2C8XB 3VXEH 2FLBH 3P92A 1EKBB 1GJ8B 1ELFA 1YP9A 2GV7A 2WPJS 1SBWA 2A31A 2AMQA 1HBTH 4MG3A 1O2MA 4CREA 1NU9A 5DJ7A 3ZVDA 1K1LA 2R2WU 1V2UT 1F0UA 4TPIZ 1QQ4A 3D65E 1O2LA 1FY3A 1HAOH 1A2CH 5L2ZH 1GBFA 1D9IA 1C4U2 2ODQA 2Z9JA 1UK2A 3SV9A 3ATMA 3A85A 2TRMA 3SUGA 3E90B 1N8OC 1GG6C 2HLCA 5FCRA 2QCYA 3M3VA 4A7IB 2ALPA 1UTLM 2SGEE 2WV4A 2ODPA 3ELAH 3RXMA 3RXDA 2XBXA 1TMTH 1Z6JH 4WH8A 5EXLA 4AOQA 2XBWA 1RRKA 4AFZA 4DIHH 5GCHF 1L1NA 4YT7H 1Y5AT 1ETRH 1VZQH 1QNJA 4FUHA 1VCPA 3UFAA 1AKSB 2A2XH 4FUBA 1MD7A 1O3LA 2PHBA 1HAPH 3VFEA 2VJ1A 2XXLA 3ZZBA 3KNXA 6CHAB 3D49H 3TGIE 2ZQ1A 2A0QB 3TJNA 2F83A 1NFYA 1HFDA 4ISOA 2OTVA 4WH6A 3PWBA 1P57B 1QRWA 1SOZA 5G4BA 3UR6A 5C5NA 1CGJE 2AGEX 2UUKB 5AFYH 1JXPA 3A7ZA 2BD5A 2C8YB 2LNCA 4AFUA 1SLXB 3HPTB 3KGPA 1HXEH 1GHBF 2VWLA 3SGAE 5JB9S 4AFQA 3NZIA 1V2VT 5F03A 3ATKA 1G3BA 2GD4B 1GMDG 1NESE 4MVNA 1BTPA 4A1XA 1ZR0A 1HAVB 2Z3CA 3MO3A 1XUIA 3EBNA 4ZKRU 1ZLRA 1C1MA 4MPWA 1W7XH 1MTUA 2STAE 1O2QA 2ZDNA 1PPGE 3DD2H 3MNBA 1VJ9U 3EA8A 4IN1A 1LCYA 2A7CA 2Z9KA 1PYTD 5E0GA 3TLOA 3RDZA 1TRNA 4BOHA 5FX5A 4KTCA 1O35A 1ZRBA 5FBEA 2BLVA 2P95A 2VINA 1EPTC 1AUJA 3SGQE 3EE0B 3S9BA 3PWCA 2UUYA 5T6GA 4KTUA 4CRAA 1RGQA 5DG6A 2BQ7B 3SV2H 1BMNH 5FXLA 2ZECA 1GBJA 1CO7E 1WSSH 3RLWH 4Q7ZA 2A2QH 2ZCKP 4FUGA 1S0RA 1A0LA 2P16A 2FEQH 1W0ZU 2WUCA 4ZH8A 1YPGH 1IOEA 3A81A 3RXFA 3KQEA 4FUCA 1AMHA 2BVSH 2BDBA 3QTOH 3PTNA 2C4FH 1C1UH 1C2HA 1P01A 4FU9A 3PB1E 1EP6A 3P8NA 2V0BA 2ZU5A 4Y8XA 5H4IB 1DWDH 1MQ6A 6GCHG 2PTCE 1SR5C 1W7GH 1SL3A 1DY9A 3SU4A 1LMWB 5L30H 1O5EH 1PQ7A 3NKKA 3M3TA 1ID5H 1BDAA 2B7DH 1NRQH 1NU7B 1W8BH 4DY7B 3MH6A 1AFQC 1A3EH 3MHWU 4CHAB 3SNAA 3UNRA 4H6TA 1ELBA 2GTBA 1L2EA 1F5LA 3P8OA 3RMMH 4DW2U 1T8NA 3U69H 4DCDA 2GCTB 2R9PA 3MO9A 1ELDE 2SGAA 1SGCA 4ZXYH 1GJAB 1UCYE 3UNQA 3SV7A 2Q6DA 5A0BA 1A0HB 3AASA 3PMBB 4NZLA 2IN2A 2ASUB 1SPJA 2J92A 3BV9B 5CHAC 1S81A 3STJA 1QFKH 4DIIH 3SI3H 4LOYH 4ZUHA 2BZAA 1QCPA 3BTFE 1Y8TA 1C5OH 1HAGE 1JOUB 4PROA 3ZZ3A 5T6FA 1GBBA 3TNTA 1O3GA 1F0TA 2ZDLA 2ZHQH 1L1GA 7GCHG 1N8OB 1GG6B 3M35A 8LPRA 4NWLA 2XWBI 1PQAA 1TPSA 1OOKB 1FXYA 3QO6A 2ZQ2A 1PQ8A 3K9XB 1CT0E 1EUFA 5EXNA 3BTEE 1W3CA 4IW4E 4X1RU 2C93B 4NA8A 1AI8H 3F68H 4FUDA 4I33A 1NFUA 2A4OA 4WMEA 3MO6A 4NCYA 2ZTZA 4AYVB 4AB8A 4BAQB 5K0HA 3M5NA 1IQGA 1Y3VA 1PPBH 2PFEA 2ALVA 3AW0A 3LDXH 4FU7A 3R0FA 2PGQB 4I32A 4IC6A 1J15A 2FYQA 2WPIS 4AZ2B 1LPKB 2BYAX 1C1PA 1YPKH 3MMGA 5A09A 1UVSH 1TBQH 2SGDE 3TVJB 1T4VH 1QBVH 2WPLS 3BTDE 4UFDH 1NM6A 1DSUA 1DFPA 1GBEA 3UUZA 1LHCH 1GVKB 1MKXK 1LTOA 3L33A 3UNSA 4A5TS 4QT8C 1QL9A 2QV1A 2BLQA 4K1EA 4BTUB 1MCTA 2PLXA 3GYLB 4NFEA 4OS7A 4YO9A 3BG4C 2ZPRA 2F9OA 4JZFH 1G3CA 2DE9A 3A87A 4CBOA 1GDQA 3RU4T 3EAJA 1HIAA 4BTIB 1Q3XA 1SGYE 1AVGH 1ZPZA 5ESTE 1GI7B 2R2MB 1BIOA 1O37A 2Y7ZA 3ZZ9A 4IS5A 2XRCA 2D26C 3EDXB 4RN6A 4ABDA 4ZHLU 1Z8RA 3QLPH 1O3FA 3VGCC 2WV5A 1E38B 1GBMA 1XXDA 4MPUA 5EXMA 1T4UH 1FMGA 1LHGH 1KXDA 1ZYOA 1RJXB 4YESB 1FPHH 2EEKA 1G2MA 1UCYH 2ANKH 2BOKA 2VVVA 5DP9A 2VIOA 1EPTB 3PMAB 3VPKA 1W14U 3M36A 2P3FH 5IYTA 1C2IA 1TBZH 4NG9H 5GCHG 4E7NA 3TJUA 1Y3YA 1S82A 1D6WA 1CHOF 3QZQA 3JZ2B 4DOQA 3ATWA 1CGIE 3SJKA 1CBWC 2A5IA 4JYUH 4AX9H 1KDQB 2H2ZA 2J9NA 5CMXH 2UUFB 1KXFA 1TNIA 3RXCA 4MPXA 3BTWE 4AFSA 1GWAA 3Q3YA 1MBMA 1AHTH 1OWIA 2A5KA 1TA2A 3MFJA 1RS0A 2XC0A 4LK4A 4X1SU 2LIZA 1HAIH 3E6PH 5HMAA 2FXRA 2WPHS 3M3SA 1K2I1 4UE7H 1PJPA 1FZZA 1QIXB 4CRGA 5A0AE 3RXOA 4X6PA 2Q6GA 3GCOA 4K2YA 1V2ST 1SGEE 1LKAA 3S0NA 1O0DH 2GDDA 3ZZAA 5HM2A 1EAXA 3O8BA 1A4WH 4UFGH 1Z7KA 3SOSA 1NFWA 2ZFPH 1AFQB 5DGJA
chains in the Genus database with same CATH superfamily
3F2GA 2VWNA 1XVMA 2Q6FA 4I31A 3VXFH 1V2LT 3T5FH 3TPIZ 1VITF 1DS2E 2ZI2H 1TABE 3KIDU 2KCOA 3GDUA 1E1RD 4D7FA 2BZ6H 3QDZB 1TIOA 1SLWB 1S83A 1TGTA 4XD7D 1N6YA 1MUEB 3NUMA 3PLKA 1ZMLA 2YNBA 1FQ3A 2ZGBH 3A7XA 2F4LA 5CHAB 1O2YA 2WZQA 1FUJA 4AC9A 2SGQE 1KLJH 2WUBA 1RXPA 1WV7H 3BF6H 5E8EH 2FOCA 1HJ9A 4FVDA 2WPMS 1KXEA 1QJ7B 2JKHA 2TPIZ 2O8MA 2GKVE 2XNIA 1T8MA 1QA7A 2QC2A 4NGAH 3ZVEA 1P02A 2NU0E 2VIDA 3GCTF 5E2OA 1MTNC 1NY22 1GBIA 1HDTH 1E79D 2AGIX 2PR3A 3F6UH 1NTPA 4X8SH 4X6OA 1TPPA 1P09A 3EYDA 2KCYA 3R3GB 9ESTA 1NFXA 2RCEA 4Z6AH 5E0HA 1BTWA 2F9PA 8GCHF 2G52A 1K1JA 4WF8A 2XW9A 1E34B 2AS9A 1HAZB 1V2WT 4HFPB 3A7YA 4A6LA 6ESTA 2HALA 2JDID 1ARCA 3ZIAD 2XOKD 1XM1A 3E0PB 4NSYA 1HJAC 2Y5HA 1O2KA 1OHHD 1AGJA 2W5EA 2BX3A 4BAMB 7KMEH 1BRCE 3SGBE 2Z3DA 3MU0A 1DOJA 2H1UA 3PMHB 1AUTC 1EOJA 4NZQA 1O2IA 3BTQE 4UEHH 2OC8A 2QXHA 2KZ4A 1O2VA 1KXCA 3LOXA 2VWMA 3K65B 2BY5X 4YOJA 3CENA 3SYJA 1H8IH 1BUIA 1O31A 3ZZ8A 3RXPA 2HVYB 1IQMA 5DN6D 1P9SA 4YZUA 1LQEA 2XTTB 2GZ7A 2VVCA 5JYIA 1QRZA 1GJ5H 1K1OA 4CRFA 2AMPA 4X8UH 4GVUA 1H8DH 3BG4B 3W95A 1JIMA 4I8GA 1EJNA 5F8XA 4ZKNU 2PKAB 1C5ZB 5EJZA 3SU1A 2SNVA 2ZCLP 3LH1A 1O39A 1E0FD 3N99A 4MQAA 2BY9X 1SGIB 2FP7B 2TBSA 1MU8B 2J98A 3TK6A 1C1RA 1GJDB 5JBTA 4KELA 2ZHWH 5DP3A 2A4GA 1HLTH 4AG2A 2I6QA 4D76A 1A5HA 1DICA 1ZMJA 4FU8A 3VGCB 2ZDMA 1TNLA 3TGKE 1DPOA 3PV2A 3TH2H 4H4FA 1C5XB 4TWWA 3O8DA 1OP2A 1ABJH 1Z8IB 2ZKSA 2GX4A 2ZU1A 4NA7A 1TGNA 4ZKSU 1C2MA 3SO3A 3HKIB 1MKWK 1UW7A 3DFLA 3UREA 1CBWB 2FIRH 1Y3UA 1C5SA 2ZHEH 5C2ZA 5IK2D 1W0YH 1O3DA 3FOAA 1MZAA 4ASHA 1IQLA 1KXBA 3U28C 2B8OH 2FI5E 2GMTC 2KAIB 3M5MA 3BIVH 1SGQE 4ABBA 2XCNA 1AE8H 1B5GH 2BY7X 2FOEA 3OX7U 1FY5A 2QF4A 1IQEA 3SQEE 1KXAA 1RFNA 3GCNA 2JJ2D 2OD3B 2Z7FE 1OXGA 2NWNA 3OTPA 3IG6B 1A3BH 1AKSA 1YY3A 4I8JA 4RT0A 3QK1A 4AORA 5HM9A 3KQ5A 1CVWH 2ZO3H 3JZ1B 4GCHF 4I8KA 3MU4A 5LPRA 3E3TA 5E0JA 1J14A 1GI4A 1H9HE 2Y5GA 2C3SA 1HXFH 1EB1H 1PPFE 3T28A 2A4QA 3SU5A 4OS2A 2NU3E 2W6ID 1K9OE 2XBVA 4E7RG 2P3UB 2L6OA 3OU0A 3UQVA 3BTGE 4D9RA 5GJ4B 3MTYA 3TH3H 5FPTA 4Y0YE 5EGMA 2VGCC 2HNTC 1P12E 3RU4D 3SJ8A 1EFRD 1BRUP 1CA8B 5EIYA 2BOHB 3S9AA 2UWLA 4KGAA 1HAVA 3QN7A 4NWKA 4Y79A 2PP6A 1ZJKA 3KCGH 1SGRE 1T7CA 4RT1A 1MTNB 4K8YA 2OP9A 1EX3A 5LPEA 1BMLA 2BDGA 1GI9B 1P9UA 3LT3A 1AFEH 1QJ6B 1NRPH 3QZRA 1DWEH 1SGFA 2B0FA 1ZHPA 2V3OH 4AYYB 4B6EA 4A1VA 1TLDA 2BVRH 3FZZA 4Y11E 4D9QA 8ESTE 5I25A 1QJ1B 1BBRK 1C1QA 4OS4A 4NIXA 1WCZA 1GVZA 1C5PA 1WQSA 2SGPE 1UTPA 1O2SA 3NRLA 1HJAB 5FCKA 1BMAA 1SGDE 4K3JA 2ODYB 1WQVH 2H5CA 1QBOA 1GL1A 1EZSC 5T6DA 1TB6H 2W6JD 2XC5A 2RA3A 2OBOA 4Y7BA 1GGDB 1TALA 1EJMA 3K6ZA 2BLWA 4ABAA 2BM2A 3EA9A 2HLDD 3SHAH 4ABIA 2CHAC 3RXBA 1TGSZ 3ZYEA 2RG3A 4K60A 1BBRE 3GCHC 1AVWA 1WUNH 1ZHMA 2ANWA 2Z94A 4ZCNA 2R3UA 4WWYA 4X8TH 1OS8A 4JK6A 3WWBA 1ZMNA 1KTTB 1QB9A 3A8CA 5EJLA 3F3BA 3V13A 5IDKA 2ZGCA 2BD3A 3N7DA 5ETXA 2ZGJA 1AN1E 3AVZA 2AGGX 5F6MA 2RA0A 1QRXA 1F5RA 1GJCB 4VGCC 1GHAF 1KLIH 3GY4A 1V2JT 2XCFA 1OYTH 3M5LA 1G36A 2L74A 1EAUA 2CV3A 3A88A 3K6YA 3SI4H 1LHFH 1BTHH 4INKA 3KQCA 3TJVA 2JETC 3ZZ6A 2DE8A 5CDFE 4JK5A 5FHTA 2FDAA 1N1LA 5C0UA 2VH0A 4FUFA 1XUFA 1P2IA 1UTQA 1HGTH 1O30A 1X7AC 4K8BA 1Q2WA 1YPEH 2ZTXA 3Q77A 1YCPH 8GCHG 1GHWH 4LXBH 4GAWA 3ZV8A 4Y0ZE 1HCGA 3DFJA 2KM0A 3A8BA 4CRBA 1NRNH 3UB0A 1IHTH 4OS6A 1O3KA 1P04A 1ZPBA 3FP7E 1HAHH 1TRMA 5C0TA 4NIYA 4B73A 3T27A 3RU4E 5KGOA 5JPMH 2HVXA 1BZXE 2I6SA 1TE0A 2HPQH 1F92A 4U2WA 1JRSA 1BOQA 2H5DA 4O03A 3H5CB 2G51A 2EQNA 2GMTB 1W10U 2FPZA 2BD7A 1V2MT 2CK3D 1BMFD 4ZXXH 1D3PB 3BIUH 1DE7H 1T31A 1C4V2 3ENSB 1D3TB 1H9IE 1O3BA 2AEIH 1ELCA 1TA6A 1OSSA 5L2YH 1DM4B 1CA0C 4IMZA 2ZPSA 3F0OA 1ZPCA 1W0JD 1A0JA 3F0PA 1YKTA 1RTKA 1G30B 1D4PB 4ESTE 3LPRA 2KCAA 2PKSC 4INLA 2VU8E 4J1YA 3QUMP 5T3HA 3RC4A 1DUEA 1SGNE 2G00A 2JH5D 1YGCH 1GMCG 4Q7XA 5J4QA 1O5FH 1DLKB 3LC3A 5EQRA 2ZFFH 2ZCHP 1UTOA 3E1XB 4OGYA 1V2NT 3ZZ5A 4WMDA 1CSOE 3ESTA 2W7UA 3TJOA 2A5AA 3NWUA 5GWZA 5E2PA 1FIZA 3PLBA 1QQUA 3GY6A 4ZHMU 3PV5A 5A2MH 1UJ1A 3P95A 1O2JA 1SQOA 3H7TA 1SG8B 1SFIA 2VGCB 1TFXA 1H1BA 4GSOA 1C5MD 3MI4A 5C20A 5I46H 5HYOA 4MTBA 5EQSA 1S85A 1G9IE 1S6HA 4HZHA 1GHZA 1TPAE 1IQKA 4NA9H 5JBCS 1HNEE 3F9GA 1AY6H 5A8XA 3HGNA 1MMJN 3PYHA 2UWOA 4I8HA 4JZDH 1TQ0B 1AE5A 1FIWA 1LHDH 2EA3A 2Z6BD 2FS8A 2VB0A 3S9CA 1O3EA 1V3XA 1MCVA 1PFXC 1O3HA 1CGHA 2TGPZ 1O3AA 5TCAA 3B8JA 4YM9A 4BANB 3T2NA 1HAYB 2ESTE 2HRVA 4NSVA 4E05H 4F48B 2R3YA 1CHGA 4TY6A 1B7XB 1EPTA 2AHME 1K21H 4ZROA 1QTFA 1RIWC 2ZHFH 1F7ZA 3UIRA 4BAOB 2PSYA 3FP8E 2QIQA 1JRTA 5C17A 3GICB 2GZ8A 1DWBH 3Q00A 3UTUH 2CXVA 1KDQA 3FKSD 1C1OA 2ZA5A 1SLVB 1PPHE 3RMNH 1J8AA 2ZDAH 5GIBA 2WYJA 3LGUA 1EB2A 3RC6A 3RMLH 1O3OA 1JWTA 1Z6EA 1MU6B 1P2KA 1QL7A 1HJ8A 3FO8D 2CHAB 3KQDA 1IQJA 1L4DA 1GI8B 3GCHB 5DP5A 1ABIH 2Y80A 4ABEA 3B23B 5F53A 1C2LA 1FN8A 1O5DH 3MH4A 3DT0H 5PTPA 4HGCA 2K1QA 2PSXA 4Y6DA 1G32B 3KL6A 1DANH 3CS7A 1SMFE 2QY0B 3S7KB 3U1JB 1T32A 4BAKB 4O9VA 1ZGIA 3M5OA 4WY3A 1OYQA 2QE7D 5JBAS 1ZRKA 2PGBB 3A7VA 1XKAC 4TPYA 3SV6A 2GCHF 3RM2H 1GI3A 2JETB 1GI0A 2OUAA 3NCLA 3LKWA 3SU6A 1EASA 2K7XA 2D8WA 1OKXA 2F91A 1ELAA 2AYWA 1HPGA 1ZSLA 2FOFA 3GYMA 1V2QT 3A83A 1SKYE 1XXFA 3RXQA 4ISIH 1LO6A 2FOAA 4FXGH 4XBDA 2WINI 4UFEH 2W3IA 2EI8A 4ZAEA 1E35B 1SHYA 1YWUA 1LKBA 1MTWA 2BXUH 1C4Y2 3PO1C 1DXWA 4BTTB 2VVUA 2BX4A 1YLCA 1G37A 4KKDA 2SGFE 3SU0A 1C1TA 1IHSH 1W2KH 2K8IA 4FOUC 1GBAA 3MU5A 3GDSA 2ZF0H 1S84A 1LQDB 1EATA 1C1VH 5K7RA 1DT2A 3H7OA 3U9AH 2J4IA 1O5AB 3SBKA 1P2NA 1XVOA 1G3EA 4XDEA 1AVXA 2Y7XA 1QY6A 3T29A 2RDLA 3ZZ4A 1MZDA 1C5WB 1GHBG 1GCTC 1ESBA 4YLUA 1ACBE 4XRNA 4B2BA 1CA0B 1AIXH 3GY8A 1VGCC 1O2TA 1P3EA 4ABJA 4HTCH 1C9PA 3BTKE 2XYAA 3E8LA 3TGJE 1B0FA 2NU4E 1QBNA 4YT6H 4GHQA 2PKSB 1F0RA 1BTZA 2QXJA 5ESBA 1YPJH 1ZZZA 4B75A 3F1SB 3MOCA 1O3CA 1O3NA 1GI2A 1C1NA 1P06A 5EOKA 5CHBA 1P2JA 1FLEE 2H9EH 2O8WA 3HATH 3Q3XA 4BNRA 4FETA 1GMDF 3SQHE 4DT7B 1Z8GA 3E0NB 2ZTYA 3EA7A 4JYTA 1RD3B 1UHBB 4B1TA 1AB9C 1FY4A 3P8FA 2J95A 2W26A 3U8OH 1VKYA 1FNIA 3VB4A 4YLQH 2GT8A 1QZ8A 1VCWA 4O3TA 5LPFA 2PKAA 1A61H 3MNSA 4TY7A 4RSPA 1UTKA 2Q1JA 1P3CA 5AHGH 3GDVA 3A89A 3M7TA 4JZIA 4ZKOU 1QL8A 1P03A 2J38A 2NU2E 2OC7A 3LGYA 1ELEE 3M7UA 3RXRA 1O33A 4BXSA 1MKXH 3C27B 4BXWA 3D62A 2FOGA 1DWCH 4WVPE 1SSXA 3OEHD 1YYY1 1HV7A 4RKJB 1XUHA 1GJ4H 2IJD1 2SFAA 3SORA 1P05A 3AK5A 2EI7A 3LGTA 5DP4A 2BHGA 2ZNKH 1YPMH 3SUDA 4LZ4B 2FO9A 6CHAC 1H4WA 1ELGA 4WXVA 3RM0H 2EI6A 4JZEH 4B71A 2OBQA 2Y81A 1H8HD 5EJ1A 3EQ0H 3A7TA 1EJAA 4X6NA 1RIWB 5BRRE 4KTSA 2O8TA 1LVMA 9LPRA 1C2FA 3MQKC 1K1NA 6GCHF 3Q76A 3GY5A 4GLYA 4GHTA 1O5GH 3UOUA 1GJ7B 5EPYA 2K0QA 1ZTKA 2ZGXH 1WBGB 3F9EA 2VIPA 3LGWA 2LPRA 3QGJA 1PPCE 1H8ED 3RLYH 3MH7A 4ISHH 1SQAA 1F5KU 3C1KA 1DUAA 2PUQH 2KAIA 3BN9A 1PPZA 4I8LA 3TU7H 3RMOH 1LVBA 3VB7A 1A5GH 3ATLA 4OGXA 1O2PA 2P94A 2TGTA 3RXSA 2ZIQH 1TNGA 3K2UA 3FZDA 2VNTA 2EC9H 1ZOMA 3GISB 1JIRA 3SHCH 2ZU2A 1MTSA 3U8TH 5EW2H 1BITA 7ESTE 4ZMAH 2SNWA 1DLEA 4MPVA 3VEQB 3I78A 1SOTA 2G4TA 3A7WA 2G8TA 4U01A 1DY8A 1NS3A 3OYPA 3QTVH 3BTME 2BD9A 3OEED 1NRSH 4WMFA 1AQ7A 1QGFA 1C1WH 3IITA 1UVTH 1Y5UT 3PTBA 5LGOA 1EZUC 1DDJA 4JMYA 4MNVA 1GI5A 1CT4E 4CBNA 3E16B 2OQ5A 5BPEA 1O38A 4YOGA 4ZHAA 1SLUB 1Y3WA 1BJUA 1QA0A 3U8RH 2GT7A 2ZDKA 1SGTA 1WU1A 1OWDA 5EQQA 3RXJA 7GCHF 4OS1A 2BB4A 5DP7A 1COWD 4XSKU 2O8UA 1VJAU 2R0KA 2ILNA 3DCLA 1YPLH 2FS9A 1ZSKA 5JB8S 2IOTA 5KEDA 3TITA 1XUGA 1ELVA 2TGAA 4TYDA 1V2KT 1G2LA 3PO1B 1H9LB 2W7SA 1KMHB 1UK4A 4RKOB 3SN8A 1YM0A 4ACAA 4AGJA 1YCPM 1CQQA 4MDSA 5B6OA 1K1IA 4M9FA 3STIA 4XE4A 3OAAD 4GUXA 1XX9A 3F9FA 3IWMA 2THFB 3RP2A 3SUEA 1XUJA 4Q80A 1D3QB 2FM2A 2FMJA 3AAVA 3NK8A 3SNEA 4Z0KA 3SW2B 1LDTT 2CMYA 1NT1A 1OWHA 2PTNA 1GCTB 3MWIU 1C9TA 2BD4A 2ZC9H 1VITH 3B9FH 1VGCB 2J98B 1UVOA 4SGBE 4Y76A 2G5NA 2ZG0H 1GJBB 1J17T 1AU8A 3CP7A 3PLPA 3GY2A 2DUCA 5DKMA 1VCQA 3ITIA 1HUTH 4R0IA 1V2TT 1V2RT 1YPHE 3DSGA 1WYKA 1DITH 1BT7A 5AFZH 1DX5M 4B74A 2FLRH 1EZQA 3NXPA 1AZ8A 3SNCA 3ZVCA 2BY8X 1GDUA 2GCHG 3KEEA 4FVBA 1AB9B 5F8ZA 1N6XA 5AF9H 2KCPA 1O5CB 4WXIA 2QGRA 2VBCA 2C8WB 2HNTF 3MNCA 3D23A 1C2JA 3M61U 3PMJA 1UVUH 4O3UA 1PQ5A 2JJ1D 1CHOG 2M2AA 1WTHD 1QB1A 1CU1A 1TX7A 2UUJB 1ZGVA 5C1XA 5EPNA 3LONA 4X2WA 1QR3E 2GDEH 1CT2E 1YC0A 3F2FA 4F49A 1Z8JB 1ZSJA 5C1UA 1L4ZA 4LZ1H 4CH8B 1TYNA 2G55A 1MAXA 4YTAA 1A46H 3LGVA 1BTUA 2VWOA 1BMMH 3PV4A 1O34A 1LPGB 1BHXB 4ABHA 3QGNB 1TBRH 3T26A 3PM3A 2ZU3A 3FANA 3W94A 5TCCA 1K1MA 1TQ7B 2JIZD 5GNDA 1THPB 1LHEH 2J97A 1WXRA 2YNAA 1SFQB 2WYGA 1SGPE 5A8ZA 4DVAU 2GZ9A 5ABWA 2TGDA 3BTTE 1FAKH 3LH3A 2O9QA 1BTXA 1SQRA 4ABGA 4DGJA 4CR5A 1Y59T 1VITG 1HYLA 2FYRA 2Z9LA 1B0EA 5HIYA 5EG4A 1EZXC 1J16A 1HRTH 3RXHA 1ANEA 1GHYH 2Z9GA 2HNTE 1UTMA 2Y6TA 1ETTH 1C5QA 2FWWA 5L6NH 4MNYA 4CH2B 3UR9A 2J94A 4E06H 3KF2A 2WV9A 1KSNA 4OM9A 1UK3A 2WHXA 2OXSA 1MKWH 3ATIA 2QF5A 1KLTA 2OC1A 2P3TB 4Q2KA 3RXGA 3V3MA 3MNXA 3WY8A 3GCTG 2JH6D 4X1NU 4F4OC 4IMQA 3UOPA 4I7YH 3DA9B 4D8NA 3N7OA 1EAWA 1O2OA 6LPRA 1YLDA 1O2UA 4J2YB 1YBWA 1C2KA 1AWFH 1TMBH 1FN6A 5EU8A 2H9TH 1THSH 5DO4H 2A1DB 3LJOA 3SJIA 4B2AA 2KFWA 2B9LA 3L6PA 2ZZUH 5DSFA 1OX1A 3SNBA 3HK3B 1E37B 1TAWA 1C2GA 2PV9B 3PROA 2QA9E 3U98H 3RXIA 2BDHA 1D3DB 3ODDA 3MU8A 5AVDA 1TGCA 2BQ6B 4DG4A 2FZZA 4XBBA 3FFGA 3RXKA 1O2WA 2ZFRH 3URCA 3A82A 3BEIB 2BY6X 1P11E 2FOMB 2BD2A 2FODA 4UDWH 1DVAH 2F9VA 1UCYK 3URDA 2GJGA 1FDPA 4X2YA 1TOCB 5GDSH 2PW8H 3L3TA 1PYTC 1JMOH 1BQYA 4XBCA 3A8AA 1Y5BT 3G01A 1C5VA 1IQIA 3TNSA 3KQBA 1Z1JA 4DJZB 1MAYA 2F43B 4FUJA 4JZ1A 5F8TA 3UY9A 1O36A 1VR1H 2OLGA 3RUOA 3N7EA 1GBLA 2BVXH 2J5UA 2FESH 3UPEA 4H6SB 3ZZDA 1BRBE 5SGAE 4B6FA 2OC0A 2D2DA 2V3MA 5HGGA 1ESAA 1ORFA 1BB0B 2AFQB 3GS9A 1TPOA 1SGFG 3GOVB 1TNKA 3KN2A 1TNHA 2V35A 3SJ9A 3DHKH 1BBRH 3ZVFA 4BAHB 3V7TA 1AWHB 1ZJDA 2Y82A 1EQ9A 1FI8A 2F9NA 3ZZCA 5JBBS 3RXUA 1Y3XA 4INHA 2QYIA 4TT3D 1O2GH 4M7GA 1IQNA 2V6NA 3A86A 1WOFA 1GPZA 1IAUA 2FTLE 1V2PT 3ZVAA 3MH5A 1IQHA 2FX6A 1C2DA 1A7SA 2ZFTA 5EW1H 2TIOA 1AD8H 3P8GA 3QX5H 2C90B 3MU1A 1GMHF 1NROH 2AH4X 4MNWA 1P2MA 2XBYA 3LIWA 3LU9B 4XFQA 1P10A 1NZQH 3TK9A 3ZV9A 3RXTA 4SGAE 3CNRA 4K5ZA 3UWJH 1EXFA 1ESTA 3BEUA 3ZYDA 3Q3KA 4THNH 3RC5A 2D1JA 3FP6E 3BG8A 3S69A 5KECA 2VIWA 3ZZ7A 1AZZA 1FJSA 3DUXH 4X1PU 1SB1H 4IN2A 4A92A 1ETSH 2A32A 1J9CH 1V2OT 4GCHG 2CF9H 4KP0A 2QF0A 2J2UA 2FI3E 4Q7YA 4FUEA 4CR9A 3T25A 1XUKA 3AW1A 1JBUH 1TNJA 4K69A 3ZVBA 3A84A 1P2QA 2GV6A 3W1EA 4A1TA 5C5OA 3DSOA 1UO6A 1UVPA 2FX4A 1T8LA 1MTVA 2F3CE 2A7HA 5FPSA 1O3JA 4Y10E 1L0ZA 1EOLA 2XWAA 4VGCB 2FTMA 4TWYA 1INCA 1ANCA 2G4UA 1WAYB 4UD9H 4IC5A 3TH4H 1NRRH 3F9HA 2P93A 3VB5A 4X8VH 1OWEA 2BXTH 1LVOA 2WPKS 1NO9H 4ISLA 2G81E 1IQFA 1O3PB 3TK5A 1SQTA 1O2RA 1O2HA 1GHVH 1ZTLA 2ZGHA 4B2CA 5GPIB 3U1IB 4X2VA 2VIVA 2ZPQA 3KHVA 1KTSB 3HGPA 5DK1A 2GVFA 2P59A 2G5VA 2STBE 1GDNA 2YMSC 3P17H 4AGKA 3M7QA 1UHBA 2BDIA 2UWPA 4D7GA 3V12A 1SHHB 1T8OA 3T62A 4MLFB 4DT4A 1BRAA 2PUXB 1ANDA 1TOMH 3A8DA 1W13U 1THRH 5DP6A 2VIQA 2BMGB 3GY7A 2Z9IA 2OINA 2ULLA 1O2NA 3GY3A 1MH0A 4IBLH 4R8TB 3SJOA 1FY8E 2BDAA 3BSQA 2GP9B 1TMUH 3P70B 3OY6U 1BTYA 1OWJA 2ZHDA 5FAHA 2H9HA 1BCUH 2P8OC 2BLOA 1GCDA 1KY9A 3KYFA 1C5LH 4Y8YA 1TWXB 1HIAB 3EGKH 1KYNA 3ODFA 1DSTA 2A4RA 4GPGA 3O8CA 1HAXB 2FI4E 2KR7A 1GI6A 1RTFB 2QN5T 2ZP0H 1CE5A 5JDUB 2C8ZB 1M9UA 2FOHA 1S5SA 3VB6A 1TX6A 1AO5A 1XMNB 1WTGH 1W11U 1GHAG 1G3DA 7LPRA 2RDEA 2AIPA 2Y5FA 2F9BH 3RXVA 4Y71A 8KME2 3SU2A 5EODA 1UMAH 5C1YA 1O2ZA 3AAUA 2YOLA 4JYVH 1C5UA 1GJ9B 3UWIA 4NFFA 1XKBC 4AB9A 1MD8A 1O3MA 1TONA 1MBQA 4K1TA 3O8RA 3SZEA 1KIGH 3H09A 1GBDA 1NN6A 3VB3A 1NC6A 3OTJE 3PRDA 4TSFD 1C5NH 1A1RA 1E1QD 3NPSA 3UAIC 2QAAA 4CRCA 1QURH 2VH6A 1GBKA 1A5IA 5FBIA 1C5TA 1GVLA 4WJG2 4HI3A 5GXPA 5TJXA 2BTCE 1GJ6A 4MNXA 1Z71A 2A45B 2IPHA 5DP8A 1GHXH 2AIQA 4NIWA 4JCNA 2GGVB 4AG1A 2OCVB 1W12U 1ELTA 1MQ5A 5DPAA 5CE1A 1F2SE 3VG8A 1S6FA 1E36B 1PPEE 1RTLA 3HK6B 1L1JA 4IGDA 1Q31A 2ANMH 2IJOB 2BQWB 2BDCA 3SZNA 1OP0A 5J4SA 2EY4C 1BHXF 1UTJA 1TX8A 2R0LA 2HPPH 1ANBA 1NPMA 1ZHRA 1K0HA 2OQUA 1O32A 2ZU4A 1BA8B 1YF4A 2A7JA 2CF8H 2AMDA 4ABFA 1GBCA 1LPZB 1GGDC 4K1SA 2Z3EA 1C5YB 2H6MA 4CRDA 1EAIA 1P8VC 2JH0D 5A8YA 1V6DA 3FAOA 2FOBA 2BDYA 3WWFA 4X6MA 5FX6A 1LVYA 2PWXA 3RXEA 1C1SA 2ZDVH 1C2EA 1FPCH 2F9UA 1TGBA 3V0XA 2XNDD 5LH8A 1GL0E 4Y8ZA 3OY5U 3RXLA 1FONA 3QWCH 1FAXA 1SC8U 3LJJA 4XOJA 1ARBA 3SV8A 1GI1A 2QF3A 1GMCF 4X0WU 2ANYA 4X1QU 4AN7A 1K28D 3A80A 1ZTJA 5HKKD 1BJVA 5A0CA 1QB6A 1C5RA 1OP8A 3BEFB 1P2OA 1GBTA 5T1VA 3TIUA 3E91A 2CN0H 4Y7AA 3I29A 2NU1E 2ZFSA 5FPYA 4OS5A 3MYWA 2XC4A 3S7HB 1K22H 1S0QA 1P0SH 2ZFQH 4X2XA 5HXFA 2QXIA 1U6QA 4NIVA 3RXAA 2ZWLH 4UONA 4ISNA 3SU3A 4UFFH 2ZEBA 1EP5A 4H42U 3WW7A 1YPHC 1UTNA 3UQOA 3LC5A 2HOBA 1K1PA 5C67A 3HKJB 3OSYA 2YMSB 2V3HH 2BD8A 1GBHA 1W0KD 3BTHE 1GMHG 4YOIA 1F0SA 3P6ZB 1Z1IA 5C3NA 2CGAA 1QHRB 3CS0A 3KYGA 1FY1A 1DXPA 4P02A 1OWKA 2QXGA 3FVFB 4FUIA 4DURA 3SUFA 1SI5H 3LGIA 2HWLB 3ZVGA 2CJIA 3SNDA 1TRYA 2AERH 2V7QD 4U30A 4B76A 2W3KA 1O2XA 4O97A 2HGTH 4U32A 3I77A 2O8LA 1D6RA 1HB0B 4CHAC 1O5BB 1O3IA 1OPHB 3M37A 1YCPK 2RFKC 1SVPA 2P8OB 2J34A 2GCTC 2B5TB 2M5TA 1FV9A 2C8XB 3VXEH 2FLBH 3P92A 1EKBB 1GJ8B 1ELFA 1YP9A 4Q4LA 2GV7A 2WPJS 1SBWA 2LP6A 2A31A 5FL7D 2AMQA 1HBTH 4MG3A 1O2MA 4CREA 1NU9A 5DJ7A 3ZVDA 1K1LA 2R2WU 1V2UT 1F0UA 4TPIZ 1QQ4A 3D65E 1O2LA 1FY3A 1HAOH 1A2CH 5L2ZH 1GBFA 1D9IA 1C4U2 2ODQA 2Z9JA 1UK2A 3SV9A 3ATMA 3A85A 2TRMA 3SUGA 4ACBA 3E90B 1N8OC 1GG6C 2HLCA 5FCRA 2QCYA 3M3VA 4A7IB 2ALPA 1UTLM 2SGEE 2WV4A 2ODPA 3ELAH 3RXMA 3RXDA 2XBXA 1TMTH 1Z6JH 4WH8A 5EXLA 4AOQA 2XBWA 1RRKA 4AFZA 4DIHH 5GCHF 1L1NA 4YT7H 1Y5AT 1ETRH 1VZQH 1QNJA 4FUHA 1VCPA 3FN8A 3UFAA 1AKSB 2A2XH 4FUBA 1MD7A 1O3LA 2PHBA 1HAPH 3VFEA 5HIZA 2WPDD 2VJ1A 2XXLA 3ZZBA 3KNXA 6CHAB 3D49H 3TGIE 2ZQ1A 2A0QB 3TJNA 2F83A 1NFYA 1HFDA 4ISOA 2OTVA 4WH6A 3PWBA 1P57B 1QRWA 1SOZA 5G4BA 3UR6A 5C5NA 1CGJE 2AGEX 2UUKB 5AFYH 1JXPA 3A7ZA 2BD5A 2C8YB 2LNCA 4AFUA 1SLXB 3HPTB 3KGPA 1HXEH 1GHBF 2VWLA 3SGAE 5JB9S 2OK5A 4AFQA 3NZIA 1V2VT 5F03A 3ATKA 1G3BA 2GD4B 1GMDG 1NESE 4MVNA 1BTPA 4A1XA 1ZR0A 1HAVB 2Z3CA 3MO3A 1XUIA 3EBNA 4ZKRU 1ZLRA 1C1MA 4MPWA 1FX0B 1W7XH 1MTUA 2STAE 1O2QA 2ZDNA 1PPGE 3DD2H 3MNBA 1VJ9U 4Z1MD 3EA8A 4IN1A 1LCYA 4RI0A 2A7CA 2Z9KA 1PYTD 5E0GA 3TLOA 3RDZA 4ASUD 1TRNA 4BOHA 5FX5A 4KTCA 4F55A 1O35A 1ZRBA 5FBEA 2BLVA 2P95A 2VINA 1EPTC 1AUJA 3SGQE 3EE0B 3S9BA 3PWCA 2UUYA 5T6GA 4KTUA 4CRAA 1RGQA 5DG6A 2BQ7B 3SV2H 1BMNH 5FXLA 2ZECA 1GBJA 5B6LA 1CO7E 1WSSH 3F2HA 3RLWH 4Q7ZA 2A2QH 2ZCKP 4FUGA 1S0RA 1A0LA 2P16A 2FEQH 1W0ZU 2WUCA 4ZH8A 1YPGH 1IOEA 3A81A 3RXFA 3KQEA 4FUCA 1AMHA 2BVSH 2BDBA 3QTOH 3PTNA 2C4FH 1C1UH 1C2HA 1P01A 3OFND 3PB1E 4FU9A 1EP6A 3P8NA 2V0BA 2ZU5A 4Y8XA 5H4IB 1DWDH 1MQ6A 6GCHG 2PTCE 1SR5C 1W7GH 1SL3A 1DY9A 3SU4A 1LMWB 5L30H 1O5EH 1PQ7A 3NKKA 3M3TA 1ID5H 1BDAA 2B7DH 1NRQH 1NU7B 1W8BH 4DY7B 3MH6A 1AFQC 1A3EH 3MHWU 4CHAB 3SNAA 3UNRA 4H6TA 1ELBA 2GTBA 1L2EA 1F5LA 3P8OA 3RMMH 4DW2U 1T8NA 3U69H 4DCDA 2GCTB 2R9PA 3MO9A 1S6LA 1ELDE 2SGAA 1SGCA 4ZXYH 2KX4A 1GJAB 1UCYE 3UNQA 3SV7A 2Q6DA 2IPQX 5A0BA 1A0HB 3AASA 3PMBB 4NZLA 2IN2A 2ASUB 1SPJA 2J92A 3BV9B 5CHAC 1S81A 3STJA 1QFKH 4DIIH 3SI3H 4LOYH 4ZUHA 2BZAA 1QCPA 3BTFE 1Y8TA 1C5OH 1HAGE 3OE7D 1JOUB 4PROA 3ZZ3A 5T6FA 1GBBA 3TNTA 2WSSD 1O3GA 1F0TA 2ZDLA 2ZHQH 1L1GA 7GCHG 1N8OB 1GG6B 1NBMD 3M35A 8LPRA 4NWLA 2XWBI 4I86A 1PQAA 1TPSA 1OOKB 1WDIA 1FXYA 3QO6A 2ZQ2A 1PQ8A 3K9XB 1CT0E 1EUFA 5EXNA 4Q63A 3BTEE 1W3CA 4IW4E 4X1RU 2C93B 4NA8A 1AI8H 3F68H 4FUDA 4I33A 1NFUA 2A4OA 4WMEA 3MO6A 4NCYA 2ZTZA 4AYVB 4AB8A 4BAQB 5K0HA 3M5NA 1IQGA 1Y3VA 1PPBH 2PFEA 2ALVA 3AW0A 3LDXH 4FU7A 3R0FA 2PGQB 4I32A 4IC6A 1J15A 2FYQA 2WPIS 4AZ2B 1LPKB 2BYAX 1C1PA 1YPKH 3MMGA 5A09A 1UVSH 1TBQH 2SGDE 3TVJB 1T4VH 1QBVH 2WPLS 3BTDE 4UFDH 2YMSD 1NM6A 1DSUA 1YLNA 1DFPA 1GBEA 3UUZA 1LHCH 1GVKB 1MKXK 1LTOA 3L33A 3EE7A 3UNSA 4A5TS 4QT8C 1QL9A 2QV1A 2BLQA 4K1EA 4BTUB 1MCTA 2PLXA 3GYLB 4NFEA 4OS7A 4YO9A 3BG4C 2ZPRA 2F9OA 4JZFH 1G3CA 2DE9A 3A87A 4CBOA 1GDQA 3RU4T 3EAJA 1HIAA 4BTIB 1Q3XA 1SGYE 1AVGH 1ZPZA 5ESTE 1GI7B 2R2MB 1BIOA 1O37A 2Y7ZA 3ZZ9A 3PRBA 2XRCA 4IS5A 3DSPA 2D26C 3EDXB 4RN6A 4ABDA 4ZHLU 1Z8RA 3QLPH 1MABB 1O3FA 3VGCC 2WV5A 1E38B 1GBMA 1XXDA 4MPUA 5EXMA 5C94A 1T4UH 1FMGA 1LHGH 1KXDA 1ZYOA 1RJXB 4YESB 1FPHH 2EEKA 1G2MA 1UCYH 2ANKH 2BOKA 2VVVA 5DP9A 2VIOA 1EPTB 3PMAB 3VPKA 1W14U 3M36A 2P3FH 5IYTA 1C2IA 1TBZH 4NG9H 5GCHG 4E7NA 3TJUA 1Y3YA 1S82A 1D6WA 1CHOF 3QZQA 3JZ2B 4DOQA 3ATWA 1CGIE 3SJKA 1CBWC 2A5IA 4JYUH 4AX9H 1KDQB 2H2ZA 2J9NA 4P00A 5CMXH 2UUFB 1KXFA 4HG6A 1TNIA 3RXCA 4MPXA 3BTWE 4AFSA 1GWAA 3Q3YA 1MBMA 1AHTH 1OWIA 2A5KA 1TA2A 3MFJA 1RS0A 2XC0A 4LK4A 4X1SU 2LIZA 1HAIH 3E6PH 5HMAA 2FXRA 2WPHS 4YXWD 3M3SA 1K2I1 4UE7H 1NBME 1PJPA 1FZZA 1QIXB 4CRGA 5A0AE 3RXOA 4X6PA 2Q6GA 3GCOA 4K2YA 1V2ST 1SGEE 1LKAA 3S0NA 1O0DH 2GDDA 3ZZAA 5HM2A 1EAXA 3O8BA 1A4WH 4UFGH 1Z7KA 3SOSA 1NFWA 2ZFPH 1AFQB 2LELA 5DGJA
chains in the Genus database with same CATH topology
2VWNA 1XVMA 2Q6FA 4I31A 3VXFH 1V2LT 3T5FH 3TPIZ 1VITF 1DS2E 2ZI2H 1TABE 3KIDU 3GDUA 4D7FA 2BZ6H 3QDZB 1TIOA 1SLWB 1S83A 1TGTA 1N6YA 1MUEB 3NUMA 3PLKA 1ZMLA 2YNBA 1FQ3A 2ZGBH 3A7XA 5CHAB 1O2YA 1FUJA 2SGQE 1KLJH 2WUBA 1RXPA 1WV7H 3BF6H 5E8EH 2FOCA 1HJ9A 4FVDA 2WPMS 1KXEA 1QJ7B 2JKHA 2TPIZ 2O8MA 2GKVE 2XNIA 1T8MA 1QA7A 2QC2A 4NGAH 3ZVEA 1P02A 2NU0E 2VIDA 3GCTF 5E2OA 1MTNC 1NY22 1GBIA 1HDTH 2AGIX 2PR3A 3F6UH 1NTPA 4X8SH 4X6OA 1TPPA 1P09A 3EYDA 3R3GB 9ESTA 1NFXA 2RCEA 4Z6AH 5E0HA 1BTWA 2F9PA 8GCHF 2G52A 1K1JA 4WF8A 2XW9A 1E34B 2AS9A 1HAZB 1V2WT 4HFPB 3A7YA 4A6LA 6ESTA 2HALA 1ARCA 1XM1A 3E0PB 4NSYA 1HJAC 2Y5HA 1O2KA 1AGJA 2W5EA 2BX3A 4BAMB 7KMEH 1BRCE 3SGBE 2Z3DA 3MU0A 1DOJA 2H1UA 3PMHB 1AUTC 1EOJA 4NZQA 1O2IA 3BTQE 4UEHH 2OC8A 2QXHA 1O2VA 1KXCA 3LOXA 2VWMA 3K65B 2BY5X 4YOJA 3CENA 1H8IH 1BUIA 1O31A 3ZZ8A 3RXPA 1IQMA 1P9SA 4YZUA 1LQEA 2XTTB 2GZ7A 2VVCA 5JYIA 1QRZA 1GJ5H 1K1OA 4CRFA 2AMPA 4X8UH 4GVUA 1H8DH 3BG4B 3W95A 1JIMA 4I8GA 1EJNA 5F8XA 4ZKNU 2PKAB 1C5ZB 3SU1A 2SNVA 2ZCLP 3LH1A 1O39A 1E0FD 4MQAA 2BY9X 1SGIB 2FP7B 2TBSA 1MU8B 3TK6A 1C1RA 1GJDB 5JBTA 4KELA 2ZHWH 5DP3A 2A4GA 1HLTH 4AG2A 2I6QA 4D76A 1A5HA 1DICA 1ZMJA 4FU8A 3VGCB 2ZDMA 1TNLA 3TGKE 1DPOA 3TH2H 4H4FA 1C5XB 4TWWA 3O8DA 1OP2A 1ABJH 1Z8IB 2ZKSA 2GX4A 2ZU1A 4NA7A 1TGNA 4ZKSU 1C2MA 3SO3A 3HKIB 1MKWK 3DFLA 3UREA 1CBWB 2FIRH 1Y3UA 1C5SA 2ZHEH 5C2ZA 1W0YH 1O3DA 1MZAA 4ASHA 1IQLA 1KXBA 2B8OH 2FI5E 2GMTC 2KAIB 3M5MA 3BIVH 1SGQE 4ABBA 2XCNA 1AE8H 1B5GH 2BY7X 2FOEA 3OX7U 1FY5A 1IQEA 3SQEE 1KXAA 1RFNA 3GCNA 2OD3B 2Z7FE 1OXGA 2NWNA 3IG6B 1A3BH 1AKSA 4I8JA 3QK1A 4AORA 5HM9A 1CVWH 2ZO3H 3JZ1B 4GCHF 4I8KA 3MU4A 5LPRA 3E3TA 5E0JA 1J14A 1GI4A 1H9HE 2Y5GA 2C3SA 1HXFH 1EB1H 1PPFE 3T28A 2A4QA 3SU5A 4OS2A 2NU3E 1K9OE 2XBVA 4E7RG 2P3UB 3OU0A 3UQVA 3BTGE 4D9RA 5GJ4B 3MTYA 3TH3H 5FPTA 4Y0YE 5EGMA 2VGCC 2HNTC 1P12E 3RU4D 3SJ8A 1BRUP 1CA8B 2BOHB 3S9AA 2UWLA 4KGAA 1HAVA 3QN7A 4NWKA 4Y79A 1ZJKA 3KCGH 1SGRE 1T7CA 1MTNB 4K8YA 2OP9A 1EX3A 5LPEA 1BMLA 2BDGA 1GI9B 1P9UA 3LT3A 1AFEH 1QJ6B 1NRPH 3QZRA 1DWEH 1SGFA 2B0FA 1ZHPA 2V3OH 4AYYB 4A1VA 1TLDA 2BVRH 3FZZA 4Y11E 4D9QA 8ESTE 5I25A 1QJ1B 1BBRK 1C1QA 4OS4A 4NIXA 1WCZA 1GVZA 1C5PA 1WQSA 2SGPE 1UTPA 1O2SA 1HJAB 5FCKA 1BMAA 1SGDE 4K3JA 2ODYB 1WQVH 2H5CA 1QBOA 1GL1A 1EZSC 5T6DA 1TB6H 2XC5A 2RA3A 2OBOA 4Y7BA 1GGDB 1TALA 1EJMA 3K6ZA 2BLWA 4ABAA 2BM2A 3EA9A 3SHAH 4ABIA 2CHAC 3RXBA 1TGSZ 3ZYEA 2RG3A 4K60A 1BBRE 3GCHC 1AVWA 1WUNH 1ZHMA 2ANWA 2Z94A 2R3UA 4WWYA 4X8TH 1OS8A 4JK6A 1ZMNA 1KTTB 1QB9A 3A8CA 3V13A 5IDKA 2ZGCA 2BD3A 5ETXA 2ZGJA 1AN1E 3AVZA 2AGGX 5F6MA 2RA0A 1QRXA 1F5RA 1GJCB 4VGCC 1GHAF 1KLIH 3GY4A 1V2JT 2XCFA 1OYTH 3M5LA 1G36A 3A88A 1EAUA 2CV3A 3SI4H 3K6YA 1LHFH 1BTHH 4INKA 3KQCA 3TJVA 2JETC 3ZZ6A 2DE8A 4JK5A 5FHTA 2FDAA 1N1LA 2VH0A 4FUFA 1XUFA 1P2IA 1UTQA 1HGTH 1O30A 1X7AC 4K8BA 1Q2WA 1YPEH 2ZTXA 3Q77A 1YCPH 8GCHG 1GHWH 4LXBH 4GAWA 3ZV8A 4Y0ZE 1HCGA 3DFJA 3A8BA 4CRBA 1NRNH 1IHTH 4OS6A 1O3KA 1P04A 1ZPBA 3FP7E 1HAHH 1TRMA 4NIYA 4B73A 3T27A 3RU4E 5JPMH 2HVXA 1BZXE 2I6SA 1TE0A 2HPQH 1F92A 4U2WA 1JRSA 1BOQA 2H5DA 4O03A 3H5CB 2G51A 2GMTB 1W10U 2FPZA 2BD7A 1V2MT 4ZXXH 1D3PB 3BIUH 1DE7H 1T31A 1C4V2 3ENSB 1D3TB 1H9IE 1O3BA 2AEIH 1ELCA 1TA6A 1OSSA 5L2YH 1DM4B 1CA0C 4IMZA 2ZPSA 1ZPCA 1A0JA 1YKTA 1RTKA 1G30B 1D4PB 4ESTE 3LPRA 2PKSC 4INLA 2VU8E 4J1YA 3QUMP 5T3HA 3RC4A 1DUEA 1SGNE 2G00A 2JH5D 1YGCH 1GMCG 4Q7XA 5J4QA 1O5FH 1DLKB 3LC3A 5EQRA 2ZFFH 2ZCHP 1UTOA 3E1XB 4OGYA 1V2NT 3ZZ5A 4WMDA 1CSOE 3ESTA 2W7UA 3TJOA 2A5AA 3NWUA 5GWZA 5E2PA 1FIZA 3PLBA 1QQUA 3GY6A 4ZHMU 5A2MH 1UJ1A 3P95A 1O2JA 1SQOA 3H7TA 1SG8B 1SFIA 2VGCB 1TFXA 1H1BA 4GSOA 1C5MD 3MI4A 5C20A 5I46H 5HYOA 4MTBA 5EQSA 1S85A 1G9IE 1S6HA 4HZHA 1GHZA 1TPAE 1IQKA 4NA9H 5JBCS 1HNEE 3F9GA 1AY6H 5A8XA 3HGNA 1MMJN 3PYHA 2UWOA 4I8HA 4JZDH 1TQ0B 1AE5A 1FIWA 1LHDH 2EA3A 2Z6BD 2FS8A 2VB0A 3S9CA 1O3EA 1V3XA 1MCVA 1PFXC 1O3HA 1CGHA 2TGPZ 1O3AA 5TCAA 3B8JA 4YM9A 4BANB 3T2NA 1HAYB 2ESTE 2HRVA 4NSVA 4E05H 2R3YA 1CHGA 4TY6A 1B7XB 1EPTA 1K21H 4ZROA 1QTFA 1RIWC 2ZHFH 1F7ZA 3UIRA 4BAOB 2PSYA 3FP8E 2QIQA 1JRTA 3GICB 2GZ8A 1DWBH 3Q00A 3UTUH 2CXVA 1KDQA 1C1OA 2ZA5A 1SLVB 1PPHE 3RMNH 1J8AA 2ZDAH 5GIBA 2WYJA 3LGUA 1EB2A 3RC6A 3RMLH 1O3OA 1JWTA 1Z6EA 1MU6B 1P2KA 1QL7A 1HJ8A 2CHAB 3KQDA 1IQJA 1L4DA 1GI8B 3GCHB 5DP5A 1ABIH 2Y80A 4ABEA 3B23B 1C2LA 1FN8A 1O5DH 3MH4A 3DT0H 5PTPA 4HGCA 2K1QA 2PSXA 4Y6DA 1G32B 3KL6A 1DANH 3CS7A 1SMFE 2QY0B 3S7KB 3U1JB 1T32A 4BAKB 4O9VA 1ZGIA 3M5OA 4WY3A 1OYQA 5JBAS 1ZRKA 2PGBB 3A7VA 1XKAC 4TPYA 3SV6A 2GCHF 3RM2H 1GI3A 2JETB 1GI0A 2OUAA 3NCLA 3LKWA 3SU6A 1EASA 2K7XA 2D8WA 1OKXA 2F91A 1ELAA 2AYWA 1HPGA 1ZSLA 2FOFA 3GYMA 1V2QT 3A83A 1XXFA 3RXQA 4ISIH 1LO6A 2FOAA 4FXGH 4XBDA 2WINI 4UFEH 2W3IA 2EI8A 4ZAEA 1E35B 1SHYA 1LKBA 1MTWA 2BXUH 1C4Y2 3PO1C 1DXWA 4BTTB 2VVUA 2BX4A 1YLCA 1G37A 4KKDA 2SGFE 3SU0A 1C1TA 1IHSH 1W2KH 1GBAA 3MU5A 3GDSA 2ZF0H 1S84A 1LQDB 1EATA 1C1VH 5K7RA 1DT2A 3H7OA 3U9AH 2J4IA 1O5AB 3SBKA 1P2NA 1XVOA 1G3EA 4XDEA 1AVXA 2Y7XA 1QY6A 3T29A 2RDLA 3ZZ4A 1MZDA 1C5WB 1GHBG 1GCTC 1ESBA 4YLUA 1ACBE 4B2BA 1CA0B 1AIXH 3GY8A 1VGCC 1O2TA 1P3EA 4ABJA 4HTCH 1C9PA 3BTKE 2XYAA 3E8LA 3TGJE 1B0FA 2NU4E 1QBNA 4YT6H 4GHQA 2PKSB 1F0RA 1BTZA 2QXJA 5ESBA 1YPJH 1ZZZA 4B75A 3F1SB 3MOCA 1O3CA 1O3NA 1GI2A 1C1NA 1P06A 5EOKA 1P2JA 1FLEE 2H9EH 2O8WA 3HATH 3Q3XA 4BNRA 1GMDF 3SQHE 4DT7B 1Z8GA 3E0NB 2ZTYA 3EA7A 4JYTA 1RD3B 1UHBB 4B1TA 1AB9C 1FY4A 3P8FA 2J95A 2W26A 3U8OH 1FNIA 3VB4A 4YLQH 2GT8A 1VCWA 4O3TA 5LPFA 2PKAA 1A61H 3MNSA 4TY7A 4RSPA 1UTKA 2Q1JA 1P3CA 5AHGH 3GDVA 3A89A 3M7TA 4JZIA 4ZKOU 1QL8A 1P03A 2J38A 2NU2E 2OC7A 3LGYA 1ELEE 3M7UA 3RXRA 1O33A 4BXSA 1MKXH 3C27B 4BXWA 3D62A 2FOGA 1DWCH 4WVPE 1SSXA 1YYY1 1HV7A 4RKJB 1XUHA 1GJ4H 2SFAA 3SORA 1P05A 2EI7A 3LGTA 5DP4A 2BHGA 2ZNKH 1YPMH 3SUDA 4LZ4B 2FO9A 6CHAC 1H4WA 1ELGA 4WXVA 3RM0H 2EI6A 4JZEH 4B71A 2OBQA 2Y81A 3EQ0H 3A7TA 1EJAA 4X6NA 1RIWB 5BRRE 4KTSA 2O8TA 1LVMA 9LPRA 1C2FA 1K1NA 6GCHF 3Q76A 3GY5A 4GLYA 4GHTA 1O5GH 3UOUA 1GJ7B 5EPYA 1ZTKA 2ZGXH 1WBGB 3F9EA 2VIPA 3LGWA 2LPRA 3QGJA 1PPCE 3RLYH 3MH7A 4ISHH 1SQAA 1F5KU 3C1KA 1DUAA 2PUQH 2KAIA 3BN9A 1PPZA 4I8LA 3TU7H 3RMOH 1LVBA 3VB7A 1A5GH 3ATLA 4OGXA 1O2PA 2P94A 2TGTA 3RXSA 2ZIQH 1TNGA 3K2UA 3FZDA 2VNTA 2EC9H 1ZOMA 3GISB 1JIRA 3SHCH 2ZU2A 1MTSA 3U8TH 5EW2H 1BITA 7ESTE 4ZMAH 2SNWA 1DLEA 4MPVA 3VEQB 3I78A 1SOTA 2G4TA 3A7WA 2G8TA 4U01A 1DY8A 1NS3A 3OYPA 3QTVH 3BTME 2BD9A 1NRSH 4WMFA 1AQ7A 1QGFA 1C1WH 3IITA 1UVTH 1Y5UT 3PTBA 5LGOA 1EZUC 1DDJA 4JMYA 4MNVA 1GI5A 1CT4E 4CBNA 3E16B 2OQ5A 5BPEA 1O38A 4YOGA 4ZHAA 1SLUB 1Y3WA 1BJUA 1QA0A 3U8RH 2GT7A 2ZDKA 1SGTA 1WU1A 1OWDA 5EQQA 3RXJA 7GCHF 4OS1A 2BB4A 5DP7A 4XSKU 2O8UA 1VJAU 2R0KA 2ILNA 1YPLH 2FS9A 1ZSKA 5JB8S 2IOTA 3TITA 1XUGA 1ELVA 2TGAA 4TYDA 1V2KT 1G2LA 3PO1B 1H9LB 2W7SA 1UK4A 4RKOB 3SN8A 1YM0A 4AGJA 1YCPM 1CQQA 4MDSA 5B6OA 1K1IA 3STIA 4XE4A 4GUXA 1XX9A 3F9FA 3IWMA 2THFB 3RP2A 3SUEA 1XUJA 4Q80A 1D3QB 2FM2A 2FMJA 3AAVA 3NK8A 3SNEA 4Z0KA 3SW2B 1LDTT 2CMYA 1NT1A 1OWHA 2PTNA 1GCTB 3MWIU 1C9TA 2BD4A 2ZC9H 1VITH 3B9FH 1VGCB 4SGBE 1UVOA 4Y76A 2G5NA 2ZG0H 1GJBB 1J17T 1AU8A 3CP7A 3PLPA 3GY2A 2DUCA 5DKMA 1VCQA 3ITIA 1HUTH 4R0IA 1V2TT 1V2RT 1YPHE 1WYKA 1DITH 1BT7A 5AFZH 1DX5M 4B74A 2FLRH 1EZQA 3NXPA 1AZ8A 3SNCA 3ZVCA 2BY8X 1GDUA 2GCHG 3KEEA 4FVBA 1AB9B 5F8ZA 1N6XA 5AF9H 4WXIA 1O5CB 2QGRA 2C8WB 2HNTF 3MNCA 3D23A 1C2JA 3M61U 3PMJA 1UVUH 4O3UA 1PQ5A 1CHOG 1WTHD 1QB1A 1CU1A 1TX7A 2UUJB 1ZGVA 5C1XA 5EPNA 3LONA 4X2WA 1QR3E 2GDEH 1CT2E 1YC0A 4F49A 1Z8JB 1ZSJA 5C1UA 1L4ZA 4LZ1H 4CH8B 1TYNA 2G55A 1MAXA 4YTAA 1A46H 3LGVA 1BTUA 2VWOA 1BMMH 3PV4A 1O34A 1LPGB 1BHXB 4ABHA 3QGNB 1TBRH 3T26A 3PM3A 2ZU3A 3FANA 3W94A 5TCCA 1K1MA 1TQ7B 1THPB 1LHEH 2YNAA 1SFQB 2WYGA 1SGPE 5A8ZA 4DVAU 2GZ9A 5ABWA 2TGDA 3BTTE 1FAKH 3LH3A 2O9QA 1BTXA 4ABGA 4DGJA 4CR5A 1Y59T 1VITG 1HYLA 2FYRA 2Z9LA 1B0EA 5EG4A 1EZXC 1J16A 1HRTH