3SO3A

Structures of fab-protease complexes reveal a highly specific non-canonical mechanism of inhibition.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
241
structure length
240
Chain Sequence
VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPISLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEDGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A reverse binding motif that contributes to specific protease inhibition by antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Suppressor of tumorigenicity 14 protein
total genus 56
structure length 240
sequence length 241
ec nomenclature ec 3.4.21.109: Matriptase.
pdb deposition date 2011-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3so3A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3so3A01
1ZSJA 1EX3A 1D4PB 4NIWA 1BMNH 1O2HA 4MNVA 3TJNA 1IQGA 2FOGA 1O5BB 2VH6A 1SB1H 5EQSA 1A0HB 8GCHG 4I7YH 3MO9A 1P2OA 2F9VA 2A32A 3MI4A 3EDXB 1EZUC 4FUHA 4MPUA 1W2KH 2XC5A 4WY3A 2FEQH 1NFXA 1F0RA 4O03A 1C4U2 3H7OA 3S9AA 4CRDA 2FODA 2GCHF 3PV4A 5A0BA 5K0HA 1H8IH 1C2DA 2FYQA 3O8DA 1EZSC 1CA0C 1Y8TA 4MDSA 2G51A 3L6PA 3QTOH 2GGVB 4AYYB 4MPVA 3RXOA 1L1GA 2ZHQH 1O2OA 3KF2A 1C5ZB 1NT1A 1AZ8A 5E0GA 4BNRA 5DP3A 1K1OA 2VWMA 2ZZUH 3UUZA 1XKAC 3GCTG 1V2PT 3RXPA 3TH2H 5IDKA 1LKBA 4FUGA 2NU4E 4ZROA 1CGHA 2G4UA 1DDJA 3EAJA 2FESH 1EOJA 1V6DA 1FY5A 1BTWA 4FUFA 5T6FA 5GIBA 5EW1H 1D3DB 3GCHC 4OS7A 2BXUH 1QA7A 1A46H 3BTTE 3GY8A 1YC0A 1Q31A 1P2NA 1SOTA 3LKWA 4B2AA 1JWTA 2R3YA 1GMDF 1EPTC 2HNTE 2ZGBH 1MCTA 2STAE 1K1PA 1ANCA 1CQQA 1O3KA 2QA9E 2PFEA 2SGPE 1GBJA 3E1XB 1OYQA 2C8ZB 2GCTC 5LPFA 5C1XA 1F92A 4IMZA 3ZVDA 5JBTA 2HWLB 2CF8H 2OC1A 3BIUH 2PLXA 1FAKH 3SU0A 3S0NA 2ANWA 3SI3H 1GVZA 1SSXA 1OWKA 2O8LA 3MNBA 1JIMA 1O2PA 3OY6U 3GY2A 1Z8RA 3M37A 4JZ1A 1HXEH 3VPKA 2EC9H 2ZP0H 2O8MA 2VVCA 3TK6A 3A8AA 1WUNH 3SNBA 2TPIZ 3FVFB 1UTNA 4KELA 3FANA 4NA9H 1DITH 3C27B 3SHCH 1GGDB 5G4BA 1QQUA 3RXBA 1EJAA 2P93A 3RXSA 5EXLA 1FUJA 4XBDA 2IPHA 4YLQH 1CVWH 1GI8B 3D65E 1IQMA 1ZHRA 4DJZB 3RMMH 4BAOB 2ZC9H 3SV2H 1H1BA 1WBGB 3M5OA 3UFAA 3BSQA 1GJDB 1TX6A 3KIDU 1AD8H 4DIIH 2OC8A 1UCYK 2B7DH 1PPGE 1WQVH 1TNJA 1BTYA 4FU7A 1HBTH 5I25A 4OS2A 2GZ8A 1Y3UA 2HALA 1TPSA 1QHRB 3BG8A 1SLVB 4Y7AA 1GJCB 1C5QA 2FLBH 4YLUA 1O2IA 1UCYE 4F4OC 2SNVA 3HPTB 4MPWA 3T2NA 3RP2A 1KXDA 2V6NA 1K21H 1Y5AT 3OY5U 3ITIA 1RS0A 1DANH 4WMDA 2EI8A 2RG3A 1LTOA 2B9LA 3VEQB 1J17T 5E0HA 1MTWA 1C9PA 2SFAA 2XYAA 5E2OA 2BHGA 4HI3A 1TRYA 4DCDA 3LPRA 1MD8A 4Y71A 4YOJA 3GOVB 4O97A 3QN7A 2BY6X 2ZU5A 2Y81A 4DG4A 1AVXA 1GBTA 5PTPA 2Z3EA 1ZGVA 5EGMA 1PPFE 1YKTA 4B2CA 3UNRA 1TMBH 1HYLA 3LU9B 1AHTH 1AWFH 1AVGH 1P01A 4E06H 3MH4A 1DXWA 1TGTA 2W7UA 4I8LA 2GMTB 2GT8A 1P2MA 1PPCE 5ABWA 1W12U 2BYAX 3BTWE 1EKBB 2FTMA 4B1TA 3A8CA 3FZDA 3SUDA 2PR3A 5L2ZH 2ZWLH 1SGNE 7KMEH 2EI6A 1Y59T 3A86A 3MO6A 1NS3A 1YPLH 2Z9GA 2BD7A 1HPGA 3E16B 3TIUA 1EPTA 3L3TA 2C4FH 4FU9A 1JMOH 2ZFFH 3ZZAA 2W3IA 1CT4E 1UJ1A 2SGFE 1WV7H 2FOEA 2P8OC 4CR5A 1GI4A 2Y5GA 3KQDA 1O2KA 4DVAU 4Z6AH 2WPHS 1SQOA 2ANKH 3GYLB 2FMJA 3ZZBA 1UVSH 2BQWB 1EQ9A 3SUGA 1NFWA 3HGNA 3SQEE 1EOLA 1UTLM 2PTNA 2W5EA 2ZPRA 1B5GH 1XMNB 1T8MA 4ZHLU 1F0UA 5JB8S 3F9GA 4TWYA 2BLQA 1NZQH 4THNH 1GI7B 3ZZCA 1GL0E 4X2XA 1KDQA 1SC8U 3SGBE 1KY9A 1XUHA 3BEUA 4K1SA 2VIQA 1TE0A 1AIXH 3DFLA 3RXVA 1YPKH 3TJVA 3T27A 3F1SB 1VCWA 3MWIU 1RXPA 2ASUB 1GI1A 3ATWA 5A8ZA 1FIZA 3A7YA 2H6MA 1NRQH 3RU4E 8KME2 1CHOG 1Z1IA 3FZZA 4MNYA 5EPYA 1Q3XA 2O9QA 5GXPA 5DO4H 4KKDA 3BTQE 1GCDA 3MOCA 3S69A 4FUCA 3SUFA 1NO9H 1ZPBA 4IGDA 1AVWA 3BTHE 2CV3A 1MTVA 1A0LA 3SORA 1UCYH 3MU1A 1N1LA 2BVXH 4NCYA 7ESTE 1Q2WA 1VITG 3GISB 3S7KB 1S81A 2ZU3A 4OGYA 1W8BH 1LHFH 2QYIA 1C5VA 1AI8H 1TX8A 2ZTYA 3A89A 2JH6D 1EB1H 4Y0YE 2FOHA 3KQCA 1Z8IB 2VNTA 1A5HA 3UQOA 1UTMA 3GICB 2OLGA 1LPGB 1QL7A 4FVBA 1XVMA 2ZQ2A 1GJBB 4H6SB 3V0XA 2CGAA 1C1PA 4WXIA 5DK1A 1BZXE 1QR3E 2ZCKP 3A7WA 4LZ4B 3GY3A 1GG6B 2OBOA 3LGVA 1AKSB 3MH5A 1CT2E 2BLVA 5LH8A 1SLUB 4ZKNU 1UVOA 2Y5FA 2F9OA 2TBSA 1THRH 5A8XA 2BD2A 1W0YH 2FI4E 1BA8B 1Y5BT 1P11E 4MPXA 1NM6A 4DW2U 1F5RA 1YPHE 4O3UA 3TITA 2VIDA 6CHAC 1DY9A 3BTKE 1GHBF 2HPQH 1EAIA 2R3UA 3BTFE 1IQFA 2P94A 2CHAB 1YBWA 1GI0A 1GL1A 1D9IA 4UDWH 1O5CB 3OTJE 5TCCA 4LXBH 2BLOA 4DT7B 3M61U 1RIWC 2XCFA 3MHWU 1PYTD 1QTFA 3DD2H 3EQ0H 1QB9A 1Z8GA 2Z9JA 1K1LA 3ESTA 1W10U 5DP7A 4BAMB 1P8VC 3BTEE 4MNWA 1CHOF 4CH2B 1TQ0B 4BXWA 2BTCE 1L1JA 4D76A 3BIVH 1HNEE 1QURH 5TJXA 1HJAC 2Y7XA 3E91A 4FXGH 1SQTA 1FY8E 1G3BA 1P3EA 3QZRA 2VIPA 2AFQB 2AMQA 1MD7A 4BTUB 1K1MA 1AGJA 1DFPA 3RC6A 2Z9KA 4NWLA 1FPCH 1IHSH 4OGXA 1GMHG 4GCHG 4NIXA 4TPYA 2ZA5A 2ALPA 1RTKA 2A4RA 2AH4X 3ZVAA 5JYIA 3A7XA 3BTDE 1KXCA 3LJOA 1IOEA 5DJ7A 5FCRA 2AMPA 4ABAA 3UR6A 2HVXA 1QCPA 2HLCA 1SFIA 1UO6A 4Y8XA 2ODYB 5T3HA 1CGIE 2XXLA 3M3SA 3RMNH 2QXIA 3ODFA 4IC5A 5L30H 1ZTLA 1C1TA 2GD4B 1TRNA 1Z71A 3LGWA 1T32A 3QGNB 5CE1A 1EASA 2HOBA 1TRMA 2GCTB 1ESAA 1MTNC 1ESTA 2ZGXH 3RXHA 1BBRH 4CRBA 2P59A 1LVYA 1G2MA 3LOXA 4X1SU 1GBAA 1AFQB 6ESTA 4X8UH 1E34B 2XBWA 3H5CB 2F9UA 1HLTH 1ELTA 3A7ZA 1C1SA 2BMGB 2ZDLA 3SU3A 3SUEA 1V2TT 1ELEE 3HKJB 4JMYA 1QY6A 4AB9A 4ABFA 4WWYA 3A8DA 3O8RA 2WUBA 1SGDE 2CJIA 2FZZA 2J34A 3E8LA 2AS9A 1EUFA 3BEIB 1O2NA 3TGJE 2C8WB 2BM2A 1AWHB 2ZTZA 3QUMP 3PLBA 1DM4B 4U2WA 1GBCA 2AERH 1SGQE 3TVJB 2VJ1A 3MO3A 2G5VA 1M9UA 1P04A 1OWIA 3RLYH 1ZRBA 2R9PA 1P2JA 1FI8A 1Y3WA 3SW2B 1GBFA 2A2QH 1OWJA 4K5ZA 4IN2A 3UOUA 4AFQA 1GDQA 1GBDA 4TPIZ 1LPZB 1KLIH 4LZ1H 2PHBA 9ESTA 3URCA 2C90B 1O3DA 4MNXA 1GPZA 2QXJA 2FIRH 1S84A 4NSVA 1GMCG 1QGFA 2H1UA 1G37A 1NRPH 1GMCF 1L0ZA 1GHBG 3GCNA 1O2LA 4CR9A 2Q6FA 3T62A 3HK3B 1C4V2 1A5IA 3RXQA 4FUIA 1O3GA 4JZDH 1GI9B 3W95A 1A5GH 1C2EA 2VWNA 2F3CE 1NY22 3ENSB 1NN6A 4CHAB 4JCNA 4A92A 3CENA 1UTKA 1IQLA 3C1KA 1CE5A 2CXVA 4Z0KA 2KAIB 4IS5A 1ZTJA 3L33A 2IJOB 4ISIH 3SJIA 1MBMA 3EGKH 2AGIX 3GDSA 5EPNA 1ZRKA 5AVDA 2XC4A 1HAGE 1FN8A 4ZAEA 5GJ4B 1O2GH 3CP7A 2Z3CA 3MFJA 1K1NA 3K9XB 1HJ8A 1EAUA 3NWUA 1O2WA 2ZDNA 2VGCB 1F2SE 2XNIA 2ANYA 1XXDA 4JZFH 4RKOB 1QNJA 5CHAB 1J8AA 3RM2H 1DICA 2FI5E 4ZKOU 3GCTF 1YCPK 1HAZB 1GVLA 1QL8A 4TWWA 1GHAG 5DG6A 3M3VA 4K3JA 5F8TA 1KXAA 1DOJA 4IW4E 1TA2A 3R3GB 4HFPB 2PKAB 1HFDA 1K2I1 1O2JA 1GBMA 1THPB 3SNEA 4INLA 2TGAA 1NU7B 4B71A 1NPMA 3KHVA 1E37B 3EA9A 1GHXH 2UWOA 2ZCHP 2W7SA 5A2MH 1AO5A 2Q6DA 5F03A 1UK2A 3RXUA 4CBNA 3VB5A 2ANMH 1PPHE 4UEHH 1P09A 5GCHG 1P03A 4FUDA 1BJVA 3TH3H 2ZKSA 2J92A 1OOKB 5DP5A 2BD3A 5F8XA 1O2XA 2ZO3H 2BY5X 3Q00A 3D62A 4AORA 2C8YB 2A5AA 5FPYA 1TOMH 2I6QA 4MG3A 2RA0A 1PPBH 3GDUA 2JH0D 1GCTB 2VVVA 5T6DA 2ZGJA 2G81E 1ELFA 2BXTH 1E35B 3I29A 1QBVH 2ZHFH 5HM9A 3NUMA 4J2YB 3FP7E 1SL3A 2FLRH 4NZLA 1S83A 1VGCC 1UHBB 1OP2A 4K2YA 5IYTA 5T6GA 3MYWA 1JRSA 1J14A 4KTCA 3P8NA 1Z1JA 2C3SA 3GY7A 4MLFB 1NRSH 4FUJA 1LVOA 2WYJA 5EOKA 1O3LA 1OSSA 3U69H 1FY1A 2CF9H 5C1UA 7GCHG 3A7TA 3QZQA 4Y11E 4JYVH 3LH1A 3SQHE 4IC6A 2Z3DA 1C2LA 1T4VH 4X6OA 1OYTH 2KAIA 4Y0ZE 2QC2A 1QRWA 4PROA 1ARBA 1G3EA 2UWLA 4BTTB 1XUJA 4AFZA 4BAKB 3D23A 5ESTE 3ZVFA 1S85A 1AU8A 2EA3A 2ZGHA 1TPAE 1O31A 1GHVH 5C2ZA 1FNIA 2J95A 1A61H 1GBHA 1B0EA 1ID5H 1HV7A 3SV6A 1L4DA 1W14U 3LT3A 4UFDH 1HGTH 4CH8B 4ABJA 5FPSA 2JETC 1O3HA 1C1WH 1QBNA 2ZFTA 3URDA 1O3JA 3SBKA 2AEIH 2WPLS 2F91A 5A09A 1G3CA 2A7HA 1UVTH 3GY4A 4ZHAA 5EU8A 4AZ2B 1P9SA 1CA8B 3ATIA 3F9HA 1NROH 2QV1A 1RD3B 5EW2H 1QJ6B 1SPJA 6CHAB 1C2IA 2BOHB 1XXFA 2BB4A 2GX4A 2TRMA 3SU4A 2D8WA 4FUBA 2FX6A 3A82A 1KXFA 1T8OA 1SMFE 2P16A 2VWLA 1O39A 1Y3VA 3SJ8A 3E90B 4Q2KA 1SGTA 1MTUA 3UIRA 1ZMNA 3HATH 1A4WH 3LDXH 4GHQA 1GHZA 3BTGE 1KIGH 5HMAA 3K6YA 1EJMA 2ZU2A 2G8TA 4X2VA 5HM2A 2FS8A 4INHA 3M7TA 1YCPH 2PW8H 3WY8A 4GSOA 2WPJS 3KQEA 1QJ1B 1MZAA 2ZPSA 5EODA 3VXEH 1O3IA 2G4TA 4A1XA 1BQYA 1TOCB 4A7IB 2OQUA 3UWJH 3FP6E 3NKKA 1LPKB 2SNWA 3S9CA 3VGCC 2PGBB 1AFQC 3LGYA 1SGEE 1O2UA 2A4QA 1ETTH 1LQDB 1SI5H 3BTME 3SV7A 2Z6BD 4E05H 2G5NA 2H9HA 1BHXF 4O3TA 1O32A 4U01A 1SGYE 7GCHF 2D26C 3QDZB 5HXFA 2BDYA 5B6OA 1SGFA 4U30A 5C67A 1S6FA 1V2MT 1YPEH 4AYVB 1GBLA 2AYWA 1TMTH 3QK1A 4X1RU 1YLCA 2BDIA 4X8SH 1QIXB 1V2LT 1NESE 3BN9A 1ZJKA 3IG6B 1KLJH 1IQHA 2AGGX 3V12A 1DPOA 1OPHB 3VB4A 2PWXA 1HAVA 4K1EA 2BX3A 5AFYH 3NK8A 4AGKA 2RA3A 3FAOA 4R0IA 1V2VT 2XBYA 1TAWA 1ZSKA 4I8JA 2PGQB 3ZZ3A 1W0ZU 3NXPA 1EZQA 4ZXYH 1OX1A 4YM9A 4YZUA 5DKMA 2XCNA 3P6ZB 1V3XA 4X2WA 3UWIA 1S6HA 1U6QA 3OX7U 3Q77A 1K9OE 3AW0A 1D3TB 1BOQA 2R2WU 2XWAA 1B0FA 1C5LH 1AB9C 1TYNA 1G2LA 3U8RH 3STJA 2BDHA 3F9EA 1MMJN 2ZDAH 1BRAA 1FN6A 1C5UA 3MU4A 1O0DH 2C93B 1NU9A 1N6XA 1VITF 2BVSH 4XFQA 3UREA 1SR5C 4AB8A 1YPMH 4WMFA 2ZFSA 3A84A 3TJUA 2VU8E 3NZIA 3N7OA 4ABEA 3T26A 3BEFB 3M5LA 5DPAA 5CMXH 2O8TA 3AW1A 2J94A 1ZYOA 2Y7ZA 2ZDKA 1NC6A 3SGAE 2GMTC 1E38B 1DWDH 4QT8C 5FX6A 1CGJE 3V7TA 2XRCA 2GZ7A 4A5TS 4CREA 4NG9H 5FXLA 1HAYB 1DUEA 1RTFB 3LIWA 1YPGH 4JYTA 3ZVGA 1UK4A 2ZFPH 3H7TA 1ACBE 5GWZA 2YNBA 4TY7A 3A87A 3SJOA 3MU5A 3ZZ5A 3U98H 1O3OA 3A7VA 1HB0B 4RSPA 4WH6A 1KDQB 1WCZA 4DY7B 2NWNA 5FX5A 4BOHA 1H9HE 1O5AB 4BAHB 4X8TH 3SNDA 3PMHB 3SNCA 2ZDVH 1VJ9U 2BDGA 3ZZ7A 4DGJA 4Q7ZA 4ISLA 3BF6H 2YNAA 2H9EH 1ETRH 4XBBA 2R2MB 4FUEA 5GDSH 2H5DA 4OS4A 2ZG0H 4AN7A 4DOQA 5FCKA 3ZZ9A 3SNAA 2BQ7B 4AOQA 1WOFA 1BB0B 3GY5A 5EQQA 1PQAA 1C5RA 1UTJA 2HPPH 3SOSA 3SV8A 1C4Y2 3DUXH 1ARCA 1P0SH 2FOAA 3I78A 3RXKA 1PPEE 1TGNA 1MH0A 1GJ5H 3KQBA 1QFKH 4BTIB 4XOJA 1C2KA 1LVBA 1PQ5A 3RC5A 1ELGA 1MKXK 2BY8X 1DY8A 1O2ZA 1XKBC 1ABIH 4KP0A 1CHGA 1C1OA 1O2SA 2A45B 1H8DH 2HNTC 3LC3A 3NPSA 1NFUA 4VGCC 2Q6GA 1KLTA 1O38A 2ZU1A 5FBIA 2ZIQH 1TFXA 3P92A 3F9FA 1WTGH 3TLOA 2WINI 1ESBA 1GCTC 1ANDA 1FAXA 1GHWH 1DSUA 1HCGA 2PUXB 1L4ZA 2OXSA 1C1NA 4GPGA 4DIHH 3SU1A 4INKA 2GV7A 5SGAE 1QRXA 2PKAA 4OS6A 1Y3YA 1GI2A 4ISHH 1QA0A 3AVZA 3UTUH 1K22H 3PMBB 1V2QT 3RMOH 5DP9A 1SGFG 1ANBA 4NIVA 2H5CA 1HAPH 4CRGA 2GCHG 4AG1A 3GY6A 1TABE 4YO9A 3UNSA 3QWCH 3ZV8A 3T28A 1MU6B 5E0JA 5CHAC 1SQAA 1ZMLA 3RXIA 2UUFB 3ZVEA 4D7GA 1RIWB 4X6NA 2VVUA 3SHAH 1OXGA 2G55A 1XUFA 1FPHH 2OC0A 2SGQE 1JBUH 2OP9A 3PM3A 3PLKA 3KGPA 1LHDH 4MQAA 4K1TA 3M7QA 2BOKA 2GZ9A 1S0QA 1RGQA 3E6PH 1C1UH 2BY9X 5C5NA 1HJAB 4X0WU 1BRBE 1EP5A 2ODPA 1HIAA 2Y82A 1QQ4A 2UWPA 3AAUA 1S82A 2Z9LA 4ISNA 1O2YA 2CMYA 2ILNA 1V2OT 1ZGIA 3BG4B 4GAWA 1MAXA 8GCHF 1GG6C 2CHAC 4B75A 1LDTT 1YYY1 4A6LA 2FXRA 4NGAH 2BX4A 2NU1E 1AE8H 1G9IE 1XX9A 2A7CA 2VINA 2QN5T 2QAAA 2V3OH 5K7RA 3P95A 3LH3A 2GTBA 1TA6A 1K1IA 3ZVCA 2PTCE 1W13U 4Q80A 4AG2A 1KYNA 1MUEB 3RXCA 2ZNKH 1BTXA 1D3QB 2BVRH 1G30B 1WQSA 1OWEA 1BMLA 2RDLA 3E3TA 1BMMH 9LPRA 5E2PA 3MH7A 3VB3A 5JPMH 1FDPA 2BZ6H 2O8UA 1GBBA 1SG8B 3TNTA 4E7NA 1UK3A 1CBWB 1G36A 4ASHA 4XE4A 2A2XH 1AUTC 1YM0A 3PB1E 1QJ7B 1GWAA 1C1MA 2HNTF 2I6SA 2ZFQH 1LKAA 5AFZH 2J4IA 2ZHWH 2AMDA 2Y80A 1BT7A 1C5YB 2B0FA 2XTTB 4FU8A 1J9CH 1MKWH 3QTVH 3QX5H 1O5DH 1P2KA 1D6RA 1Y3XA 4A1TA 5DP4A 2GV6A 1O5GH 1DSTA 1PQ8A 3HKIB 2GDDA 3OU0A 3SU2A 1UTQA 2SGEE 2PUQH 1O3EA 4ZUHA 2Z7FE 3SJ9A 1QBOA 1MZDA 4SGBE 1ZLRA 1SGIB 4Y8ZA 1TNLA 4TYDA 1EP6A 4UD9H 1V2RT 2A1DB 2FTLE 1C5PA 4BANB 1AE5A 1FMGA 1PYTC 1ZZZA 1HJ9A 4AFUA 1MBQA 1TPPA 2STBE 3EA7A 1ZHMA 3CS0A 4YTAA 4CBOA 5C3NA 1P57B 4NA7A 5L6NH 1X7AC 5FHTA 3LGUA 1E0FD 4K69A 1GJ7B 2VIOA 1GMDG 5I46H 1HXFH 1P10A 1O2RA 3ATMA 5A8YA 2A7JA 3MNSA 4D7FA 4XBCA 2Z9IA 1DUAA 2A4GA 3S7HB 1P02A 1WTHD 2WYGA 3MNXA 1O2VA 2Z94A 4ABGA 2QXGA 1XUGA 4X1PU 3EA8A 2P3TB 2FDAA 2W3KA 1BTHH 3BV9B 1BTUA 1KSNA 2QF3A 1AFEH 3F68H 5LPRA 4MTBA 4KTSA 5JB9S 3PLPA 1ZR0A 1KTTB 2ZU4A 5JBCS 2ESTE 2Q1JA 2ZDMA 2BD4A 1O3FA 1OS8A 3M36A 1FLEE 1ELVA 4I8KA 1SGRE 3M7UA 1A3EH 5A0AE 4Y8YA 4JZIA 3HGPA 1P05A 4ZH8A 4YESB 6LPRA 3RLWH 1QB1A 4JYUH 2WPKS 1S5SA 1UTOA 2FWWA 3KEEA 1ZPZA 8LPRA 3RXFA 5FPTA 3VB6A 2HRVA 2VIWA 1GVKB 1MTSA 3P17H 2UUKB 3KCGH 1O3NA 2J2UA 1F5LA 1PPZA 3VB7A 4UE7H 4Q7YA 1VJAU 4YT7H 1O3PB 2D2DA 2F9NA 4Q7XA 2ZI2H 2UUYA 3LONA 4F49A 5DP8A 1LHCH 1JXPA 5TCAA 6GCHF 4MVNA 1SOZA 3U9AH 1TQ7B 1DX5M 1MCVA 4X6MA 3UPEA 4CRAA 3QGJA 2QGRA 1ORFA 1VCPA 5LPEA 3RXGA 4U32A 4XDEA 2PSXA 1ZOMA 3TPIZ 2FO9A 1F0SA 5C1YA 3RDZA 2A5KA 1EATA 1T31A 1XUIA 3LGIA 3TK5A 2AGEX 4ZHMU 1ZHPA 2V35A 1BIOA 1XM1A 1YF4A 1INCA 1LCYA 3SN8A 3DFJA 4R8TB 4H4FA 4JZEH 4WJG2 1C1QA 2K1QA 1ABJH 1L1NA 3STIA 3TU7H 1A2CH 1YP9A 1IHTH 3W94A 1GDNA 1RTLA 5EXNA 1LMWB 1P06A 4K8BA 4ZKSU 3UOPA 1ANEA 1FZZA 4NZQA 1F7ZA 1YPHC 3Q3YA 1ZPCA 1ELCA 5ESBA 3RXDA 3AAVA 3TGIE 1O33A 1VZQH 1WSSH 1LVMA 5EQRA 1C5TA 1NFYA 2FP7B 4VGCB 1TBRH 2P3UB 1V2UT 4UONA 1Z6EA 3MU0A 2ZECA 1BJUA 3TGKE 1T8NA 1GJ4H 4LOYH 1UTPA 2A31A 3RU4T 1JRTA 1Z8JB 2THFB 2ZF0H 2JH5D 1GI3A 1WU1A 1GBKA 1BUIA 1GBIA 3VFEA 2PSYA 2NU2E 1SLWB 1C9TA 1SLXB 4Y10E 2OCVB 5C20A 1V2ST 2FI3E 4BAQB 1OP0A 4K8YA 3M5NA 1MAYA 1LHEH 4X6PA 1W7XH 3ZYEA 5L2YH 2VH0A 3FP8E 1DXPA 3GYMA 3DT0H 5BRRE 4K60A 2ALVA 3E0NB 4O9VA 4AGJA 1GDUA 3EE0B 2XC0A 3K2UA 3QO6A 1DE7H 1KXEA 1YGCH 4OS5A 5EG4A 1DT2A 1FV9A 1C2FA 3FFGA 3TH4H 1JIRA 2A0QB 1AMHA 5F6MA 2ZHDA 5DGJA 1CT0E 2XWBI 1CA0B 3PMJA 3U1JB 3JZ2B 5BPEA 2Y6TA 5AF9H 3M3TA 1HAHH 1MU8B 2DUCA 3A88A 2FOBA 2BD8A 2W26A 3A8BA 1V2JT 2VGCC 1CBWC 1UVUH 2G52A 1EAWA 1O2MA 3P70B 2ZQ1A 1SGCA 1V2KT 5GCHF 1IQEA 4ABHA 1H9LB 3B8JA 1AKSA 1ETSH 1BBRK 1TBZH 1Z7KA 2FOCA 2TGPZ 4ABDA 1A0JA 3ODDA 3OYPA 4CHAC 3R0FA 4TY6A 3D49H 2D1JA 2F9BH 4D9QA 3ZYDA 1AUJA 2BLWA 2SGDE 4WXVA 3RXEA 1ELAA 4I32A 1C5OH 4Y79A 3U1IB 3SGQE 4ESTE 1UMAH 1JOUB 7LPRA 3SU6A 1O5FH 3RXAA 2OD3B 1FXYA 3MH6A 1DVAH 1TLDA 3UY9A 2BQ6B 1ZJDA 4I31A 3U8OH 1DWBH 4GVUA 4RKJB 1ELDE 1BDAA 2CN0H 2FS9A 4ABBA 1GI5A 3PO1C 1TB6H 1K28D 3S9BA 4NFFA 2IOTA 3Q76A 2F83A 4WF8A 2AIPA 3HK6B 4HTCH 1PQ7A 2WV5A 4E7RG 5JDUB 5JBBS 1C5NH 1P2IA 2ULLA 2PKSB 2Y5HA 3QLPH 2LNCA 1Z6JH 1RJXB 4DURA 3A83A 1DWEH 1L2EA 2BDAA 3LGTA 1KXBA 4M7GA 3M5MA 4Y7BA 3UQVA 1KTSB 1IAUA 4YOIA 3G01A 1OP8A 1XUKA 2XW9A 1VCQA 1LO6A 3P8GA 2NU3E 1O2QA 1MKXH 1ELBA 1V2NT 4B2BA 5ETXA 4B76A 2EI7A 3PWCA 3GCOA 2OINA 3PYHA 3TJOA 3LJJA 2WPMS 1C2GA 4NA8A 1IQNA 1GHYH 1GJ6A 3B9FH 3SI4H 4Y6DA 1FY4A 2OBQA 1FONA 4JK6A 2OUAA 4D9RA 1N8OC 4D8NA 1BHXB 1TWXB 2G00A 5J4SA 4NIYA 1GMHF 1OWHA 2ODQA 4GCHF 1IQIA 3T25A 1F5KU 2ZHEH 1MTNB 4X1QU 1EPTB 1SGPE 3NCLA 4NSYA 2FYRA 5HYOA 1VR1H 2O8WA 3V3MA 3RXRA 1B7XB 1TNGA 5F8ZA 4UFEH 3B23B 4AX9H 2M5TA 1T7CA 1G3DA 3K6ZA 3CS7A 2FPZA 2QXHA 3GCHB 5E8EH 4KGAA 2B8OH 3JZ1B 4Y76A 3PTBA 1Y5UT 3MU8A 3ELAH 1O3AA 3O8BA 2DE9A 2ZPQA 2OTVA 1BRUP 1FJSA 1O3CA 1BMAA 1SVPA 3RM0H 1OWDA 2V3HH 1PFXC 2P3FH 4X2YA 2BDCA 1UVPA 3PO1B 3A85A 1MQ5A 1AQ7A 1NRRH 3ZZ8A 1F0TA 1TMUH 2UUJB 1SHYA 1BBRE 5HGGA 1O3BA 3A81A 2GP9B 4KTUA 4YT6H 1J16A 1OKXA 1A7SA 1AN1E 1C2JA 2OQ5A 4IMQA 3RC4A 4IN1A 3V13A 2P8OB 3KNXA 1EAXA 1W7GH 1V2WT 3SO3A 1HDTH 2PV9B 1C5SA 1ZTKA 1G32B 2YOLA 3AASA 3P8FA 4I8GA 5H4IB 1T8LA 5LGOA 1ZMJA 1YPJH 2H9TH 4NWKA 4H42U 2ZFRH 1LHGH 2WUCA 4RN6A 1DS2E 2FX4A 3IWMA 2IN2A 2A5IA 3MTYA 5FBEA 1CSOE 2TGTA 1FIWA 1P12E 1BRCE 3ZVBA 3F6UH 4B73A 3SZNA 2ZGCA 3UNQA 2BD9A 3BG4C 1QB6A 1C1VH 1TBQH 3P8OA 2WPIS 1BTZA 3SJKA 1NTPA 3OSYA 2BY7X 1QL9A 1BTPA 1C5MD 1GJAB 2JETB 1FY3A 1EXFA 4WH8A 5A0CA 1D6WA 1E36B 3DHKH 2BD5A 2DE8A 3ZV9A 1P2QA 3PROA 4JK5A 3RXMA 3GDVA 1AY6H 1EJNA 1WYKA 2AIQA 1HAVB 5AHGH 2XBVA 3UR9A 1SHHB 1O3MA 2FM2A 1EZXC 1S0RA 1K1JA 1PJPA 1RRKA 3PWBA 1O34A 1W11U 1TNIA 1YCPM 1P9UA 3T29A 2J9NA 1VGCB 1O35A 5EXMA 2XBXA 1P3CA 1YLDA 2QCYA 2VB0A 2BDBA 2ZEBA 2NU0E 4X8VH 1EB2A 2HGTH 1THSH 2OC7A 1H4WA 3DA9B 4IBLH 4LK4A 4I33A 1SBWA 4GLYA 3RXLA 1O2TA 1TGSZ 1AB9B 1W3CA 4I8HA 4OS1A 3ATKA 1RFNA 2GDEH 3U8TH 3I77A 1NRNH 4ZKRU 1IQJA 3RMLH 1DLEA 1FQ3A 1MKWK 2R0KA 5C5OA 2VIVA 4HGCA 1SFQB 1GJ9B 1GI6A 3Q3XA 1D3PB 4X1NU 2LPRA 4A1VA 1N6YA 2A4OA 2JKHA 3SU5A 2TGDA 2TIOA 2EEKA 1LQEA 2SGAA 4HZHA 2QF0A 1C5WB 2C8XB 1HRTH 1IQKA 1WAYB 3Q3KA 2VWOA 1BITA 1A3BH 4FVDA 2FOMB 3K65B 1GGDC 3T5FH 1C2HA 4ZXXH 2J38A 1T4UH 1TGBA 3SV9A 2FOFA 4ABIA 1HAIH 1C2MA 1TNHA 2RCEA 1BCUH 1GJ8B 3KL6A 2ZCLP 1TX7A 3EYDA 3RXTA 1CU1A 5J4QA 1DWCH 1N8OB 5GPIB 4WVPE 6GCHG 3A80A 1C1RA 4AFSA 1HUTH 1HAXB 3PMAB 3ATLA 2V0BA 3LC5A 3ZZ4A 4ISOA 1J15A 1TNKA 4BXSA 3O8CA 2R0LA 1GBEA 1CO7E 3KN2A 1QRZA 2QY0B 1ZSLA 4XSKU 1GHAF 1O36A 1VITH 3ZZ6A 1TONA 1TPOA 3RUOA 3VGCB 2WV4A 3PTNA 3VXFH 2B5TB 2H2ZA 3MNCA 1H9IE 4ZMAH 1HAOH 2GT7A 2GVFA 1TGCA 2P95A 5DP6A 4H6TA 4CRCA 3M35A 4J1YA 1C5XB 1HIAB 1O30A 3IITA 1TALA 3TNSA 2QIQA 2PKSC 3TK9A 2GKVE 4YOGA 1DLKB 1AZZA 2BZAA 2ZTXA 4UFFH 1MQ6A 1O5EH 4NFEA 3ZZDA 1A1RA 4UFGH 4GUXA 4SGAE 1XVOA 2F9PA 8ESTE 3MMGA 4B74A 1TIOA 5JBAS 4CRFA 1UHBA 4WMEA 4GHTA 3RU4D 1O37A 3E0PB 3RXJA 5FAHA
chains in the Genus database with same CATH superfamily
1ZSJA 1EX3A 1D4PB 4NIWA 1BMNH 1O2HA 4MNVA 4OM9A 3TJNA 1IQGA 2FOGA 1O5BB 2VH6A 1SB1H 5EQSA 1A0HB 8GCHG 4I7YH 3MO9A 1P2OA 2F9VA 2A32A 3MI4A 3EDXB 1EZUC 4FUHA 2F43B 4MPUA 1W2KH 2XC5A 4WY3A 2FEQH 1NFXA 1F0RA 4O03A 1C4U2 3H7OA 3S9AA 4CRDA 2FODA 2XOKD 2GCHF 3PV4A 5A0BA 5K0HA 1H8IH 1C2DA 2FYQA 3O8DA 1EZSC 1CA0C 1Y8TA 4MDSA 2G51A 3L6PA 3QTOH 2GGVB 4AYYB 4MPVA 3RXOA 1L1GA 2ZHQH 1O2OA 3KF2A 1C5ZB 1NT1A 1AZ8A 5E0GA 4BNRA 2W6ID 5DP3A 1K1OA 3UB0A 2VWMA 2ZZUH 3UUZA 1XKAC 3GCTG 1V2PT 1H8ED 3RXPA 3TH2H 5IDKA 1LKBA 4FUGA 2NU4E 4ZROA 3CNRA 1CGHA 2G4UA 1DDJA 3EAJA 2FESH 1EOJA 1V6DA 1FY5A 1BTWA 4FUFA 5T6FA 5GIBA 5EW1H 1D3DB 3GCHC 4OS7A 2BXUH 1QA7A 1A46H 3BTTE 3GY8A 1YC0A 1Q31A 1P2NA 1SOTA 3LKWA 4B2AA 1JWTA 2R3YA 1GMDF 1EPTC 2HNTE 2ZGBH 1MCTA 2STAE 4RT0A 1K1PA 5C0UA 1ANCA 1CQQA 1O3KA 2QA9E 2PFEA 2SGPE 1GBJA 3E1XB 1OYQA 2C8ZB 2GCTC 5LPFA 5C1XA 1F92A 4IMZA 3ZVDA 5JBTA 2HWLB 2CF8H 2KFWA 2OC1A 3BIUH 2PLXA 1FAKH 3SU0A 3S0NA 2ANWA 3DCLA 3SI3H 1GVZA 1SSXA 1OWKA 2O8LA 2YMSD 3MNBA 1JIMA 1O2PA 3OY6U 3GY2A 1Z8RA 3M37A 4JZ1A 1HXEH 3VPKA 2EC9H 2ZP0H 2O8MA 2VVCA 3TK6A 3A8AA 5F53A 1WUNH 3SNBA 2TPIZ 2W6JD 3FVFB 1UTNA 4KELA 3FANA 4NA9H 1DITH 1EFRD 3C27B 3SHCH 1GGDB 5G4BA 1QQUA 3RXBA 1EJAA 2P93A 5C94A 3RXSA 5HKKD 5EXLA 1FUJA 4XBDA 2IPHA 4YLQH 1CVWH 1GI8B 3D65E 1IQMA 1ZHRA 4DJZB 3RMMH 4BAOB 2ZC9H 3SV2H 1H1BA 1WBGB 3M5OA 2PP6A 3UFAA 3BSQA 3OEED 1GJDB 1TX6A 3KIDU 1AD8H 4DIIH 2OC8A 1UCYK 2B7DH 1PPGE 1WQVH 1TNJA 1BTYA 3W1EA 4FU7A 1HBTH 5I25A 4OS2A 2GZ8A 1Y3UA 3ZIAD 2HALA 1TPSA 1KMHB 1QHRB 3BG8A 1SLVB 4Y7AA 1GJCB 1C5QA 2FLBH 4YLUA 1O2IA 1UCYE 4F4OC 2SNVA 3HPTB 4MPWA 3T2NA 3RP2A 1KXDA 1W0KD 2V6NA 1K21H 1Y5AT 3OY5U 3ITIA 1RS0A 1DANH 4WMDA 2EI8A 2RG3A 1LTOA 2B9LA 2LELA 3VEQB 1J17T 5E0HA 1MTWA 1C9PA 4Z1MD 2SFAA 2XYAA 5E2OA 2BHGA 4HI3A 1TRYA 4DCDA 3LPRA 1MD8A 4Y71A 4YOJA 3GOVB 4O97A 3QN7A 2BY6X 2ZU5A 2Y81A 4DG4A 1AVXA 1GBTA 5PTPA 2Z3EA 1ZGVA 5EGMA 1PPFE 1YKTA 4B2CA 3UNRA 1TMBH 1HYLA 3LU9B 1AHTH 1AWFH 1AVGH 1P01A 4E06H 3MH4A 1DXWA 1TGTA 3PV5A 2W7UA 4I8LA 2GMTB 2GT8A 1P2MA 1PPCE 3WW7A 5IK2D 5ABWA 1W12U 2L74A 2BYAX 3BTWE 1EKBB 2FTMA 4B1TA 5CDFE 3A8CA 3FZDA 3N99A 2YMSC 3SUDA 2PR3A 5L2ZH 2ZWLH 1SGNE 7KMEH 2EI6A 1Y59T 3A86A 3MO6A 1NS3A 1YPLH 2Z9GA 2BD7A 1HPGA 4ZCNA 2WHXA 3E16B 3TIUA 1EPTA 3L3TA 2C4FH 4FU9A 1JMOH 2ZFFH 3ZZAA 2W3IA 1CT4E 1UJ1A 2SGFE 1WV7H 2FOEA 2P8OC 4CR5A 1GI4A 2Y5GA 3KQDA 1O2KA 4DVAU 4Z6AH 2WPHS 1SQOA 2ANKH 2KCPA 2FMJA 3GYLB 3FN8A 3ZZBA 1UVSH 2BQWB 3AK5A 5FL7D 1EQ9A 3SUGA 1NFWA 3HGNA 3SQEE 1EOLA 1UTLM 2PTNA 2W5EA 2ZPRA 1B5GH 1XMNB 1WXRA 1T8MA 4ZHLU 3FO8D 1F0UA 5JB8S 3F9GA 4TWYA 1FX0B 2BLQA 1NZQH 4THNH 1GI7B 3ZZCA 1GL0E 4X2XA 1KDQA 1SC8U 3SGBE 1KY9A 1XUHA 3BEUA 4K1SA 2VIQA 1E1QD 1TE0A 1AIXH 3DFLA 3RXVA 1YPKH 3TJVA 3T27A 3F1SB 1VCWA 3MWIU 1RXPA 2ASUB 3WWFA 1GI1A 3ATWA 5A8ZA 1FIZA 3A7YA 2H6MA 1NRQH 3RU4E 8KME2 1CHOG 1Z1IA 3FZZA 4MNYA 5EPYA 1Q3XA 2O9QA 5GXPA 5DO4H 4KKDA 3BTQE 1GCDA 3MOCA 3S69A 4YXWD 4FUCA 3SUFA 1NO9H 1ZPBA 4IGDA 3F3BA 1AVWA 3BTHE 2CV3A 1MTVA 1A0LA 3SORA 1UCYH 3MU1A 1N1LA 2BVXH 4NCYA 7ESTE 1Q2WA 1VITG 3GISB 3S7KB 1S81A 2ZU3A 4OGYA 1W8BH 1LHFH 2QYIA 1C5VA 1AI8H 1TX8A 2ZTYA 3A89A 3F2HA 2JH6D 1EB1H 4Y0YE 2FOHA 3KQCA 1Z8IB 2VNTA 1A5HA 3UQOA 1UTMA 3GICB 2OLGA 1LPGB 1QL7A 4FVBA 1XVMA 2ZQ2A 1GJBB 4H6SB 3V0XA 2CGAA 2LP6A 1C1PA 4WXIA 5KECA 5DK1A 1BZXE 1QR3E 2ZCKP 3A7WA 4LZ4B 3GY3A 1GG6B 2OBOA 3LGVA 1AKSB 3MH5A 1CT2E 3FOAA 2BLVA 5LH8A 1SLUB 4ZKNU 1UVOA 2Y5FA 2F9OA 2TBSA 1THRH 5A8XA 2BD2A 1W0YH 2FI4E 1BA8B 1Y5BT 4ASUD 1P11E 4MPXA 1NM6A 4DW2U 1F5RA 1YPHE 4O3UA 3TITA 2VIDA 6CHAC 1DY9A 3BTKE 1GHBF 2HPQH 1EAIA 2R3UA 3BTFE 1IQFA 2P94A 2CHAB 1YBWA 1GI0A 1GL1A 1D9IA 4UDWH 1O5CB 3OTJE 5TCCA 4LXBH 2BLOA 4DT7B 3M61U 1RIWC 2XCFA 3MHWU 1PYTD 1QTFA 3DD2H 3EQ0H 1QB9A 1Z8GA 2Z9JA 1K1LA 3ESTA 1W10U 5DP7A 4BAMB 1P8VC 3BTEE 4MNWA 1CHOF 4CH2B 1TQ0B 4BXWA 2BTCE 1L1JA 4D76A 3BIVH 1HNEE 1QURH 5TJXA 1HJAC 2Y7XA 3E91A 4FXGH 1SQTA 1FY8E 1G3BA 1P3EA 3QZRA 3VG8A 2VIPA 2AFQB 2AMQA 1MD7A 4BTUB 1K1MA 1AGJA 1DFPA 3RC6A 2Z9KA 4NWLA 1FPCH 1IHSH 4OGXA 1GMHG 4GCHG 4NIXA 4TPYA 1K0HA 2ZA5A 2ALPA 2KX4A 1RTKA 2A4RA 2AH4X 3ZVAA 5JYIA 3A7XA 3BTDE 1KXCA 3LJOA 1IOEA 5DJ7A 5FCRA 2AMPA 4ABAA 3UR6A 2HVXA 1QCPA 2HLCA 5HIZA 1SFIA 1UO6A 4Y8XA 2ODYB 5T3HA 1CGIE 2XXLA 3F2GA 3M3SA 3RMNH 2QXIA 3ODFA 4IC5A 5L30H 1ZTLA 1C1TA 2GD4B 1TRNA 1Z71A 3LGWA 1T32A 3QGNB 5CE1A 1EASA 2HOBA 2KCAA 1TRMA 2GCTB 1ESAA 1MTNC 1ESTA 4B6EA 2ZGXH 3RXHA 1BBRH 4CRBA 2P59A 1LVYA 1G2MA 3LOXA 4X1SU 1GBAA 1AFQB 6ESTA 4X8UH 1E34B 2XBWA 3H5CB 2F9UA 1HLTH 1ELTA 3A7ZA 1C1SA 2BMGB 2ZDLA 3SU3A 3SUEA 1V2TT 1ELEE 3HKJB 4JMYA 1QY6A 4AB9A 5KGOA 4ABFA 4WWYA 3A8DA 3O8RA 2WUBA 1COWD 1SGDE 2CJIA 2FZZA 2J34A 3E8LA 4I86A 2AS9A 1EUFA 2HVYB 3BEIB 1O2NA 3TGJE 2C8WB 2BM2A 1AWHB 2ZTZA 3QUMP 3PLBA 1DM4B 4U2WA 1GBCA 2AERH 1SGQE 3TVJB 2VJ1A 3KYGA 3MO3A 2G5VA 1M9UA 1P04A 1OWIA 3RLYH 1ZRBA 2R9PA 1P2JA 1FI8A 1Y3WA 3SW2B 1GBFA 2A2QH 3H09A 5KEDA 1OWJA 4K5ZA 4IN2A 4Q63A 3UOUA 4AFQA 1GDQA 1GBDA 4TPIZ 1LPZB 1KLIH 3NRLA 4LZ1H 2PHBA 9ESTA 3URCA 2C90B 1O3DA 4MNXA 1GPZA 2QXJA 2FIRH 1S84A 4NSVA 1GMCG 1QGFA 2H1UA 1G37A 1NRPH 1GMCF 1L0ZA 1GHBG 3GCNA 1O2LA 4CR9A 2Q6FA 3T62A 3HK3B 1C4V2 1A5IA 3RXQA 4FUIA 1O3GA 4JZDH 1GI9B 3W95A 1A5GH 1C2EA 2VWNA 2F3CE 5DN6D 1NY22 3ENSB 1NN6A 4CHAB 4JCNA 4A92A 3CENA 1UTKA 1IQLA 3C1KA 1CE5A 2CXVA 4Z0KA 2KAIB 4IS5A 1ZTJA 3L33A 2IJOB 4ISIH 3SJIA 2J5UA 1MBMA 3EGKH 2AGIX 3GDSA 5EPNA 1ZRKA 5AVDA 2XC4A 4ACAA 4XRNA 1HAGE 1FN8A 4ZAEA 5GJ4B 1O2GH 3DSPA 3CP7A 2Z3CA 3MFJA 1K1NA 3K9XB 1HJ8A 1EAUA 3NWUA 1O2WA 2ZDNA 2VGCB 1F2SE 2XNIA 2ANYA 1XXDA 4JZFH 4RKOB 1QNJA 5CHAB 4AC9A 1J8AA 3RM2H 1DICA 2FI5E 4ZKOU 3GCTF 1YCPK 1HAZB 1GVLA 1QL8A 4TWWA 1GHAG 5DG6A 3M3VA 2J98A 4K3JA 5F8TA 1KXAA 1DOJA 4IW4E 1TA2A 3R3GB 4HFPB 1OHHD 2PKAB 1HFDA 1K2I1 1O2JA 1GBMA 1THPB 3SNEA 4INLA 2TGAA 1NU7B 4B71A 1NPMA 3KHVA 1E37B 3EA9A 1GHXH 2UWOA 2ZCHP 2W7SA 5A2MH 1AO5A 2Q6DA 5F03A 1UK2A 3RXUA 4CBNA 3VB5A 2ANMH 1PPHE 4UEHH 1P09A 5GCHG 1P03A 4FUDA 1BJVA 3TH3H 2ZKSA 2J92A 1OOKB 5DP5A 2BD3A 2KR7A 1O2XA 5F8XA 2ZO3H 2BY5X 3Q00A 3D62A 4AORA 2C8YB 2A5AA 5FPYA 1W0JD 1TOMH 2I6QA 4MG3A 2RA0A 1PPBH 3GDUA 2JH0D 1GCTB 2VVVA 5T6DA 2ZGJA 2G81E 2KCOA 1ELFA 2BXTH 1E35B 3I29A 1QBVH 2ZHFH 5HM9A 3NUMA 1YLNA 4J2YB 2M2AA 3FP7E 1SL3A 2FLRH 4NZLA 1S83A 1VGCC 1UHBB 1OP2A 4K2YA 5IYTA 5T6GA 3MYWA 1JRSA 1J14A 4KTCA 3P8NA 1Z1JA 2C3SA 3GY7A 4MLFB 1NRSH 4FUJA 1LVOA 5EJZA 5C17A 2WYJA 5EOKA 1O3LA 1OSSA 3U69H 1FY1A 2CF9H 5C1UA 7GCHG 3A7TA 3QZQA 4Y11E 4JYVH 3LH1A 3SQHE 4IC6A 2Z3DA 1C2LA 1T4VH 4X6OA 1OYTH 2KAIA 4Y0ZE 2QC2A 1QRWA 4PROA 1ARBA 1G3EA 2UWLA 4BTTB 2KM0A 1XUJA 4AFZA 4BAKB 3D23A 5ESTE 3ZVFA 1S85A 1AU8A 2EA3A 2ZGHA 1TPAE 1O31A 1GHVH 5C2ZA 1FNIA 2J95A 1A61H 1GBHA 1B0EA 1ID5H 1HV7A 3SV6A 1L4DA 1W14U 3LT3A 4UFDH 1HGTH 2L6OA 4CH8B 4ABJA 5FPSA 2JETC 1O3HA 1C1WH 1QBNA 2ZFTA 3URDA 4M9FA 1O3JA 3SBKA 2AEIH 2WPLS 2F91A 5A09A 1G3CA 2A7HA 1UVTH 3GY4A 4ZHAA 5EU8A 4AZ2B 1P9SA 1CA8B 3ATIA 3F9HA 1NROH 2QV1A 1RD3B 5EW2H 1QJ6B 1SPJA 6CHAB 1C2IA 2BOHB 1XXFA 2BB4A 2GX4A 2TRMA 3SU4A 2D8WA 4FUBA 1NBME 2FX6A 3A82A 1KXFA 1T8OA 1SMFE 2P16A 2VWLA 1O39A 1Y3VA 3SJ8A 3E90B 4Q2KA 1SGTA 1MTUA 3UIRA 1ZMNA 3HATH 1A4WH 3LDXH 4GHQA 1GHZA 3BTGE 1KIGH 5HMAA 3K6YA 1EJMA 2ZU2A 2G8TA 4X2VA 5HM2A 2FS8A 4INHA 3M7TA 1YCPH 2PW8H 3WY8A 4GSOA 2WPJS 3KQEA 2RDEA 1QJ1B 1MZAA 2ZPSA 5EODA 3VXEH 1H8HD 1O3IA 2G4TA 4A1XA 1BQYA 1TOCB 4A7IB 2OQUA 3UWJH 3FP6E 3NKKA 1LPKB 2SNWA 3S9CA 3SZEA 2PGBB 1AFQC 3LGYA 3VGCC 1SGEE 5B6LA 1O2UA 2A4QA 1ETTH 1LQDB 1SI5H 3BTME 3SV7A 2Z6BD 4E05H 2G5NA 2H9HA 3F0OA 1BHXF 4O3TA 1O32A 4U01A 1SGYE 7GCHF 2D26C 3QDZB 5HXFA 2BDYA 5B6OA 1SGFA 4U30A 5C67A 1S6FA 1V2MT 1YPEH 4AYVB 1GBLA 4RI0A 2AYWA 1TMTH 3QK1A 4X1RU 1YLCA 2BDIA 2WPDD 4X8SH 3PRDA 1QIXB 2KZ4A 1V2LT 1MABB 1NESE 3BN9A 1ZJKA 3IG6B 1KLJH 1IQHA 3OTPA 2AGGX 3V12A 1DPOA 4HG6A 1OPHB 3VB4A 2PWXA 1HAVA 4K1EA 2BX3A 5AFYH 3NK8A 4AGKA 2RA3A 3FAOA 4R0IA 1V2VT 2XBYA 5HIYA 1TAWA 1ZSKA 4I8JA 5C0TA 2PGQB 1E1RD 3ZZ3A 1W0ZU 3NXPA 2OK5A 1EZQA 4ZXYH 1OX1A 4YM9A 2CK3D 4YZUA 5DKMA 2XCNA 3P6ZB 1V3XA 4X2WA 3UWIA 1S6HA 1U6QA 3OX7U 3Q77A 1K9OE 3AW0A 1D3TB 1BOQA 2R2WU 2XWAA 1B0FA 1C5LH 1AB9C 1TYNA 1G2LA 3U8RH 1BMFD 3STJA 2BDHA 3F9EA 1MMJN 2ZDAH 1BRAA 1FN6A 1C5UA 3MU4A 1O0DH 2C93B 3SYJA 1NU9A 1N6XA 1VITF 2BVSH 4XFQA 3UREA 1SR5C 2IJD1 4AB8A 1YPMH 4WMFA 2ZFSA 3A84A 3TJUA 2VU8E 3NZIA 3N7OA 4ABEA 3T26A 3BEFB 3M5LA 5DPAA 5CMXH 2O8TA 3AW1A 2J94A 1ZYOA 5T1VA 2Y7ZA 2XNDD 3FKSD 2ZDKA 1NC6A 3SGAE 2GMTC 1E38B 1DWDH 4QT8C 5FX6A 1CGJE 3V7TA 2XRCA 2GZ7A 4A5TS 4CREA 4NG9H 5FXLA 1HAYB 1DUEA 1RTFB 3LIWA 1YPGH 4JYTA 3ZVGA 1UK4A 2ZFPH 3H7TA 3KQ5A 1ACBE 5GWZA 2YNBA 4TY7A 3A87A 3DSGA 3KYFA 3SJOA 3MU5A 3ZZ5A 3U98H 1O3OA 3A7VA 1HB0B 4RSPA 4WH6A 5GNDA 1KDQB 1WCZA 4DY7B 2NWNA 5FX5A 4BOHA 1H9HE 1O5AB 4BAHB 4X8TH 3SNDA 3PMHB 3SNCA 2ZDVH 1VJ9U 2BDGA 3ZZ7A 4DGJA 2EQNA 4Q7ZA 4ISLA 3BF6H 2YNAA 2H9EH 1ETRH 4XBBA 2R2MB 4FUEA 5GDSH 2H5DA 4OS4A 2ZG0H 4AN7A 4DOQA 5FCKA 3ZZ9A 3SNAA 2BQ7B 4AOQA 1WOFA 1BB0B 3GY5A 5EQQA 1PQAA 4FOUC 1C5RA 1UTJA 2HPPH 3SOSA 3SV8A 1C4Y2 3DUXH 1ARCA 1P0SH 4FETA 2FOAA 3I78A 3RXKA 1PPEE 1TGNA 1MH0A 1GJ5H 3KQBA 5EJ1A 1QFKH 4BTIB 4XOJA 1C2KA 1LVBA 1PQ5A 3RC5A 1ELGA 1MKXK 2BY8X 1DY8A 1E79D 3OEHD 2GJGA 1O2ZA 1XKBC 1ABIH 4KP0A 1CHGA 1C1OA 1O2SA 2A45B 1H8DH 2HNTC 3LC3A 3NPSA 1NFUA 4VGCC 2Q6GA 1KLTA 1O38A 2ZU1A 5FBIA 2ZIQH 1TFXA 3P92A 3F9FA 1WTGH 3TLOA 2WINI 1ESBA 1GCTC 1ANDA 1FAXA 1VKYA 1GHWH 1DSUA 1HCGA 2PUXB 1L4ZA 2OXSA 1C1NA 4GPGA 4DIHH 3SU1A 4INKA 2GV7A 5SGAE 1QRXA 2PKAA 5EJLA 4OS6A 2EY4C 1Y3YA 1GI2A 4ISHH 1QA0A 3AVZA 3UTUH 1K22H 3PMBB 1V2QT 3RMOH 5DP9A 1SGFG 1ANBA 4NIVA 2H5CA 1HAPH 4CRGA 2GCHG 4AG1A 2WSSD 3GY6A 1TABE 4YO9A 2YMSB 3UNSA 3QWCH 3ZV8A 3T28A 1MU6B 5E0JA 5CHAC 1SQAA 1ZMLA 3RXIA 2UUFB 3ZVEA 4D7GA 1RIWB 2JJ2D 4X6NA 2VVUA 3SHAH 1OXGA 2G55A 1XUFA 4RT1A 1FPHH 2OC0A 2SGQE 1JBUH 2OP9A 3PM3A 3PLKA 3KGPA 1LHDH 4MQAA 4K1TA 3M7QA 2BOKA 2GZ9A 1S0QA 1RGQA 3E6PH 1C1UH 2BY9X 5C5NA 1HJAB 4X0WU 1BRBE 1EP5A 2ODPA 1HIAA 2Y82A 1QQ4A 2UWPA 3AAUA 1S82A 2Z9LA 4ISNA 4TT3D 1O2YA 3PV2A 2CMYA 2ILNA 1V2OT 1ZGIA 3BG4B 4GAWA 1MAXA 8GCHF 1GG6C 2CHAC 4B75A 1LDTT 1YYY1 4A6LA 2FXRA 4NGAH 2BX4A 2NU1E 1AE8H 1G9IE 1XX9A 2A7CA 2V3OH 2QN5T 2QAAA 2VINA 5K7RA 3P95A 3LH3A 1WDIA 2GTBA 1TA6A 1K1IA 3ZVCA 2PTCE 1W13U 4Q80A 4AG2A 1KYNA 1MUEB 3RXCA 2ZNKH 1BTXA 1D3QB 2BVRH 1G30B 1WQSA 2VBCA 1OWEA 1BMLA 2RDLA 3E3TA 1BMMH 9LPRA 5E2PA 3MH7A 3VB3A 5JPMH 1FDPA 2BZ6H 2O8UA 1GBBA 1SG8B 3TNTA 4E7NA 1UK3A 1CBWB 1G36A 4ASHA 4XE4A 2A2XH 1AUTC 1YM0A 3PB1E 1QJ7B 3WWBA 1GWAA 1C1MA 2HNTF 2I6SA 2ZFQH 1LKAA 5AFZH 2J4IA 2ZHWH 2AMDA 2Y80A 1BT7A 1C5YB 2B0FA 2XTTB 4FU8A 1J9CH 1MKWH 3QTVH 3GS9A 3QX5H 1O5DH 1P2KA 1D6RA 1Y3XA 4A1TA 5DP4A 4DT4A 2GV6A 1O5GH 1DSTA 1PQ8A 3HKIB 2GDDA 3OU0A 3SU2A 1UTQA 2SGEE 2PUQH 1O3EA 4ZUHA 2Z7FE 3SJ9A 1QBOA 1MZDA 4SGBE 1ZLRA 1SGIB 3N7DA 4Y8ZA 1TNLA 4TYDA 1EP6A 4UD9H 1V2RT 2A1DB 2FTLE 1C5PA 4BANB 1AE5A 1FMGA 1PYTC 1ZZZA 1HJ9A 4AFUA 1MBQA 1TPPA 2STBE 3EA7A 1ZHMA 3CS0A 4YTAA 4CBOA 5C3NA 1P57B 4NA7A 5L6NH 1YY3A 1X7AC 5FHTA 3LGUA 1E0FD 4K69A 1GJ7B 2VIOA 1GMDG 5I46H 1HXFH 1P10A 1O2RA 3ATMA 5A8YA 2A7JA 3MNSA 4D7FA 4XBCA 2Z9IA 1DUAA 2A4GA 3S7HB 1SQRA 1P02A 1WTHD 2WYGA 3MNXA 1O2VA 2Z94A 4ABGA 2QXGA 1XUGA 4X1PU 3EA8A 2P3TB 2FDAA 2W3KA 4TSFD 1BTHH 3BV9B 1BTUA 1KSNA 2QF3A 1AFEH 3F68H 5LPRA 4MTBA 4KTSA 5JB9S 3PLPA 1ZR0A 1KTTB 2ZU4A 3OFND 2ESTE 5JBCS 2Q1JA 2AHME 5EIYA 2ZDMA 2BD4A 1O3FA 1OS8A 3M36A 1FLEE 1ELVA 4I8KA 1SGRE 3M7UA 1A3EH 5A0AE 4Y8YA 4JZIA 3HGPA 1P05A 4ZH8A 4YESB 6LPRA 3RLWH 1QB1A 4JYUH 2WPKS 2JJ1D 1S5SA 1UTOA 2FWWA 3KEEA 1ZPZA 8LPRA 3RXFA 5FPTA 3VB6A 2HRVA 2VIWA 1GVKB 1MTSA 3P17H 2UUKB 3KCGH 1O3NA 2J2UA 1F5LA 1PPZA 3VB7A 4UE7H 4Q7YA 2JDID 1VJAU 4YT7H 1O3PB 2D2DA 2F9NA 4Q7XA 2ZI2H 2UUYA 3LONA 4F49A 5DP8A 1LHCH 1JXPA 5TCAA 6GCHF 1SKYE 4MVNA 1SOZA 3U9AH 1TQ7B 4P00A 1DX5M 1MCVA 4X6MA 3UPEA 4CRAA 3QGJA 2QGRA 1QZ8A 1ORFA 1VCPA 5LPEA 3RXGA 4U32A 4XDEA 2PSXA 1ZOMA 3TPIZ 5DSFA 2FO9A 1F0SA 5C1YA 3RDZA 2A5KA 1EATA 1T31A 1XUIA 2HLDD 3LGIA 2F4LA 2AGEX 3TK5A 4ZHMU 1ZHPA 5CHBA 2V35A 1BIOA 1XM1A 1YF4A 1INCA 1LCYA 2KCYA 3SN8A 3DFJA 4R8TB 4H4FA 4JZEH 4WJG2 1C1QA 2K1QA 1ABJH 1L1NA 3STIA 3TU7H 1A2CH 1YP9A 1IHTH 3W94A 1GDNA 1RTLA 5EXNA 1LMWB 1P06A 4K8BA 4ZKSU 2QE7D 3UOPA 1ANEA 1FZZA 4NZQA 1F7ZA 1YPHC 3Q3YA 1ZPCA 1ELCA 5ESBA 3RXDA 3AAVA 3OAAD 3TGIE 1O33A 1VZQH 1WSSH 1LVMA 5EQRA 1C5TA 1NFYA 2FP7B 4VGCB 1TBRH 2P3UB 1V2UT 4UONA 1Z6EA 3MU0A 2ZECA 1BJUA 3TGKE 1T8NA 1GJ4H 4LOYH 1UTPA 2A31A 3RU4T 1JRTA 4Q4LA 1Z8JB 2THFB 2ZF0H 2JH5D 1GI3A 1WU1A 1GBKA 1BUIA 1GBIA 3VFEA 2PSYA 2NU2E 1SLWB 1C9TA 1SLXB 4Y10E 2OCVB 5C20A 1V2ST 2FI3E 4BAQB 1OP0A 4K8YA 4F48B 3M5NA 4ACBA 1MAYA 1LHEH 4X6PA 1W7XH 3ZYEA 5L2YH 2VH0A 3FP8E 1DXPA 3GYMA 3DT0H 5BRRE 4K60A 2ALVA 3E0NB 4O9VA 4AGJA 1GDUA 3EE0B 2XC0A 3K2UA 3QO6A 1DE7H 1KXEA 1YGCH 4OS5A 5EG4A 1DT2A 1FV9A 4B6FA 1C2FA 3FFGA 3TH4H 1JIRA 2A0QB 1AMHA 5F6MA 2ZHDA 5DGJA 1CT0E 2XWBI 1CA0B 2WZQA 3PMJA 3U1JB 1YWUA 3JZ2B 5BPEA 2Y6TA 2JIZD 5AF9H 3M3TA 1HAHH 1MU8B 2DUCA 3A88A 2FOBA 2BD8A 2W26A 3A8BA 1V2JT 2QF5A 2VGCC 1CBWC 1UVUH 2G52A 1EAWA 1O2MA 3P70B 2ZQ1A 1SGCA 1V2KT 5GCHF 1IQEA 4ABHA 1H9LB 3B8JA 1AKSA 1ETSH 1BBRK 1TBZH 1Z7KA 2FOCA 2TGPZ 4ABDA 1A0JA 3ODDA 3OYPA 4CHAC 3R0FA 4TY6A 3D49H 2D1JA 2F9BH 4D9QA 3ZYDA 1AUJA 2BLWA 2SGDE 4WXVA 3RXEA 1ELAA 4I32A 1C5OH 4Y79A 3U1IB 3SGQE 4ESTE 1UMAH 1JOUB 7LPRA 2K8IA 1O5FH 3SU6A 3RXAA 2OD3B 1FXYA 3MH6A 1DVAH 1TLDA 3UY9A 2BQ6B 1ZJDA 3MQKC 4I31A 3U8OH 1DWBH 4GVUA 4RKJB 1ELDE 1BDAA 2CN0H 2FS9A 4ABBA 1GI5A 3PO1C 1TB6H 1K28D 3S9BA 4NFFA 2IOTA 3Q76A 2F83A 4WF8A 2AIPA 3HK6B 4HTCH 1PQ7A 2WV5A 4E7RG 5JDUB 5JBBS 1C5NH 1P2IA 2ULLA 2PKSB 2Y5HA 3QLPH 2LNCA 1Z6JH 1RJXB 4DURA 3A83A 2WV9A 2QF4A 1DWEH 1L2EA 2BDAA 3LGTA 1KXBA 4M7GA 3M5MA 4Y7BA 3UQVA 1KTSB 1IAUA 4YOIA 3G01A 3OE7D 1OP8A 1XUKA 2XW9A 1VCQA 1LO6A 3P8GA 2NU3E 1O2QA 1MKXH 1ELBA 1V2NT 3UAIC 4B2BA 4F55A 5ETXA 4B76A 2EI7A 3PWCA 3GCOA 2OINA 3PYHA 3TJOA 1UW7A 3LJJA 2WPMS 1C2GA 4NA8A 1IQNA 1GHYH 1GJ6A 3B9FH 3SI4H 4Y6DA 1FY4A 2OBQA 1FONA 4JK6A 2OUAA 4D9RA 1N8OC 4D8NA 1BHXB 1TWXB 2G00A 5J4SA 4NIYA 1GMHF 1OWHA 2ODQA 2V7QD 1IQIA 4GCHF 3T25A 1F5KU 2ZHEH 1MTNB 4X1QU 1EPTB 1SGPE 3NCLA 4NSYA 2FYRA 5HYOA 1VR1H 2O8WA 3V3MA 3RXRA 1B7XB 1TNGA 5F8ZA 4UFEH 3B23B 4AX9H 2V3MA 2M5TA 1T7CA 1G3DA 3K6ZA 3CS7A 3PRBA 2FPZA 2QXHA 3GCHB 5E8EH 4KGAA 2B8OH 3JZ1B 4Y76A 3PTBA 1Y5UT 3MU8A 3ELAH 1O3AA 3O8BA 2DE9A 2ZPQA 2OTVA 1BRUP 1FJSA 1O3CA 1BMAA 1SVPA 3DSOA 3RM0H 1OWDA 2V3HH 1PFXC 2P3FH 4X2YA 2BDCA 1UVPA 3PO1B 3A85A 1MQ5A 1AQ7A 1NRRH 3ZZ8A 1F0TA 1TMUH 2UUJB 1SHYA 1BBRE 5HGGA 1O3BA 3A81A 2GP9B 4KTUA 4YT6H 1J16A 1OKXA 1A7SA 1AN1E 1C2JA 2OQ5A 1S6LA 4IMQA 3RC4A 4IN1A 3V13A 2P8OB 2J97A 3KNXA 1EAXA 1W7GH 1V2WT 2J98B 3SO3A 1HDTH 2PV9B 1C5SA 1ZTKA 1G32B 2YOLA 3AASA 2K0QA 3P8FA 3F0PA 4I8GA 5H4IB 1T8LA 5LGOA 1ZMJA 1YPJH 2H9TH 4NWKA 4H42U 2ZFRH 1LHGH 2WUCA 4RN6A 1DS2E 2FX4A 3IWMA 2IN2A 2A5IA 3MTYA 5FBEA 1CSOE 2TGTA 1FIWA 1P12E 1BRCE 3ZVBA 3F6UH 4B73A 3SZNA 2ZGCA 3UNQA 2BD9A 3BG4C 1QB6A 1C1VH 1TBQH 3N7EA 3P8OA 2WPIS 1BTZA 3SJKA 1NTPA 3OSYA 2BY7X 4P02A 1QL9A 1BTPA 1C5MD 1GJAB 2JETB 1FY3A 1EXFA 4WH8A 5A0CA 1D6WA 1E36B 3DHKH 2BD5A 2DE8A 3ZV9A 1P2QA 3PROA 4JK5A 3RXMA 3GDVA 1AY6H 1EJNA 1WYKA 2AIQA 1HAVB 5AHGH 2XBVA 3UR9A 1SHHB 1O3MA 2FM2A 1EZXC 1S0RA 1K1JA 1PJPA 1RRKA 3PWBA 1O34A 1W11U 1TNIA 1YCPM 1P9UA 3T29A 2J9NA 1VGCB 1O35A 5EXMA 2XBXA 1P3CA 1YLDA 2QCYA 2VB0A 2BDBA 2ZEBA 2NU0E 4X8VH 1EB2A 2HGTH 1THSH 2OC7A 1H4WA 2IPQX 3DA9B 4IBLH 4LK4A 4I33A 1SBWA 3F2FA 4GLYA 3RXLA 1O2TA 1TGSZ 1AB9B 1W3CA 4I8HA 4OS1A 3ATKA 1RFNA 2GDEH 3U28C 3U8TH 3I77A 1NRNH 4ZKRU 1IQJA 3RMLH 1DLEA 1FQ3A 1MKWK 2R0KA 5C5OA 2VIVA 4HGCA 1SFQB 1GJ9B 1GI6A 3Q3XA 1D3PB 4X1NU 2LPRA 4A1VA 2RFKC 1N6YA 2A4OA 2JKHA 3SU5A 2TGDA 2TIOA 2EEKA 1LQEA 2SGAA 4HZHA 2QF0A 1C5WB 2C8XB 1HRTH 1IQKA 1WAYB 3Q3KA 2VWOA 1BITA 1A3BH 4FVDA 2FOMB 3K65B 1GGDC 3T5FH 1C2HA 4ZXXH 2J38A 1T4UH 1TGBA 3SV9A 2FOFA 4ABIA 1HAIH 1C2MA 1TNHA 2RCEA 1BCUH 1GJ8B 3KL6A 2ZCLP 1TX7A 3EYDA 3RXTA 1CU1A 3EE7A 5J4QA 1DWCH 1N8OB 5GPIB 4WVPE 6GCHG 3A80A 1C1RA 4AFSA 1HUTH 1HAXB 3PMAB 3ATLA 2V0BA 3LC5A 3ZZ4A 4ISOA 1J15A 1TNKA 4BXSA 3O8CA 2R0LA 1GBEA 1CO7E 3KN2A 1QRZA 2QY0B 1ZSLA 4XSKU 1GHAF 1O36A 1NBMD 1VITH 3ZZ6A 1TONA 1TPOA 3RUOA 3VGCB 2WV4A 3PTNA 3VXFH 2B5TB 2H2ZA 3MNCA 1H9IE 4ZMAH 1HAOH 2GT7A 2GVFA 1TGCA 2P95A 5DP6A 4H6TA 4CRCA 3M35A 4J1YA 1C5XB 1HIAB 1O30A 3IITA 1TALA 3TNSA 2QIQA 2PKSC 3TK9A 2GKVE 4YOGA 1DLKB 1AZZA 2BZAA 2ZTXA 4UFFH 4XD7D 1MQ6A 1O5EH 4NFEA 3ZZDA 1A1RA 4UFGH 4GUXA 4SGAE 1XVOA 2F9PA 8ESTE 3MMGA 4B74A 1TIOA 5JBAS 4CRFA 1UHBA 4WMEA 4GHTA 3RU4D 1O37A 3E0PB 3RXJA 5FAHA
chains in the Genus database with same CATH topology
1ZSJA 1EX3A 1D4PB 4NIWA 1BMNH 1O2HA 4MNVA 3TJNA 1IQGA 2FOGA 1O5BB 2VH6A 1SB1H 5EQSA 1A0HB 8GCHG 4I7YH 3MO9A 1P2OA 2F9VA 2A32A 3MI4A 3EDXB 1EZUC 4FUHA 4MPUA 1W2KH 2XC5A 4WY3A 2FEQH 1NFXA 1F0RA 4O03A 1C4U2 3H7OA 3S9AA 4CRDA 2FODA 2GCHF 3PV4A 5A0BA 5K0HA 1H8IH 1C2DA 2FYQA 3O8DA 1EZSC 1CA0C 1Y8TA 4MDSA 2G51A 3L6PA 3QTOH 2GGVB 4AYYB 4MPVA 3RXOA 1L1GA 2ZHQH 1O2OA 3KF2A 1C5ZB 1NT1A 1AZ8A 5E0GA 4BNRA 5DP3A 1K1OA 2VWMA 2ZZUH 3UUZA 1XKAC 3GCTG 1V2PT 3RXPA 3TH2H 5IDKA 1LKBA 4FUGA 2NU4E 4ZROA 1CGHA 2G4UA 1DDJA 3EAJA 2FESH 1EOJA 1V6DA 1FY5A 1BTWA 4FUFA 5T6FA 5GIBA 5EW1H 1D3DB 3GCHC 4OS7A 2BXUH 1QA7A 1A46H 3BTTE 3GY8A 1YC0A 1Q31A 1P2NA 1SOTA 3LKWA 4B2AA 1JWTA 2R3YA 1GMDF 1EPTC 2HNTE 2ZGBH 1MCTA 2STAE 1K1PA 1ANCA 1CQQA 1O3KA 2QA9E 2PFEA 2SGPE 1GBJA 3E1XB 1OYQA 2C8ZB 2GCTC 5LPFA 5C1XA 1F92A 4IMZA 3ZVDA 5JBTA 2HWLB 2CF8H 2OC1A 3BIUH 2PLXA 1FAKH 3SU0A 3S0NA 2ANWA 3SI3H 1GVZA 1SSXA 1OWKA 2O8LA 3MNBA 1JIMA 1O2PA 3OY6U 3GY2A 1Z8RA 3M37A 4JZ1A 1HXEH 3VPKA 2EC9H 2ZP0H 2O8MA 2VVCA 3TK6A 3A8AA 1WUNH 3SNBA 2TPIZ 3FVFB 1UTNA 4KELA 3FANA 4NA9H 1DITH 3C27B 3SHCH 1GGDB 5G4BA 1QQUA 3RXBA 1EJAA 2P93A 3RXSA 5EXLA 1FUJA 4XBDA 2IPHA 4YLQH 1CVWH 1GI8B 3D65E 1IQMA 1ZHRA 4DJZB 3RMMH 4BAOB 2ZC9H 3SV2H 1H1BA 1WBGB 3M5OA 3UFAA 3BSQA 1GJDB 1TX6A 3KIDU 1AD8H 4DIIH 2OC8A 1UCYK 2B7DH 1PPGE 1WQVH 1TNJA 1BTYA 4FU7A 1HBTH 5I25A 4OS2A 2GZ8A 1Y3UA 2HALA 1TPSA 1QHRB 3BG8A 1SLVB 4Y7AA 1GJCB 1C5QA 2FLBH 4YLUA 1O2IA 1UCYE 4F4OC 2SNVA 3HPTB 4MPWA 3T2NA 3RP2A 1KXDA 2V6NA 1K21H 1Y5AT 3OY5U 3ITIA 1RS0A 1DANH 4WMDA 2EI8A 2RG3A 1LTOA 2B9LA 3VEQB 1J17T 5E0HA 1MTWA 1C9PA 2SFAA 2XYAA 5E2OA 2BHGA 4HI3A 1TRYA 4DCDA 3LPRA 1MD8A 4Y71A 4YOJA 3GOVB 4O97A 3QN7A 2BY6X 2ZU5A 2Y81A 4DG4A 1AVXA 1GBTA 5PTPA 2Z3EA 1ZGVA 5EGMA 1PPFE 1YKTA 4B2CA 3UNRA 1TMBH 1HYLA 3LU9B 1AHTH 1AWFH 1AVGH 1P01A 4E06H 3MH4A 1DXWA 1TGTA 2W7UA 4I8LA 2GMTB 2GT8A 1P2MA 1PPCE 5ABWA 1W12U 2BYAX 3BTWE 1EKBB 2FTMA 4B1TA 3A8CA 3FZDA 3SUDA 2PR3A 5L2ZH 2ZWLH 1SGNE 7KMEH 2EI6A 1Y59T 3A86A 3MO6A 1NS3A 1YPLH 2Z9GA 2BD7A 1HPGA 3E16B 3TIUA 1EPTA 3L3TA 2C4FH 4FU9A 1JMOH 2ZFFH 3ZZAA 2W3IA 1CT4E 1UJ1A 2SGFE 1WV7H 2FOEA 2P8OC 4CR5A 1GI4A 2Y5GA 3KQDA 1O2KA 4DVAU 4Z6AH 2WPHS 1SQOA 2ANKH 3GYLB 2FMJA 3ZZBA 1UVSH 2BQWB 1EQ9A 3SUGA 1NFWA 3HGNA 3SQEE 1EOLA 1UTLM 2PTNA 2W5EA 2ZPRA 1B5GH 1XMNB 1T8MA 4ZHLU 1F0UA 5JB8S 3F9GA 4TWYA 2BLQA 1NZQH 4THNH 1GI7B 3ZZCA 1GL0E 4X2XA 1KDQA 1SC8U 3SGBE 1KY9A 1XUHA 3BEUA 4K1SA 2VIQA 1TE0A 1AIXH 3DFLA 3RXVA 1YPKH 3TJVA 3T27A 3F1SB 1VCWA 3MWIU 1RXPA 2ASUB 1GI1A 3ATWA 5A8ZA 1FIZA 3A7YA 2H6MA 1NRQH 3RU4E 8KME2 1CHOG 1Z1IA 3FZZA 4MNYA 5EPYA 1Q3XA 2O9QA 5GXPA 5DO4H 4KKDA 3BTQE 1GCDA 3MOCA 3S69A 4FUCA 3SUFA 1NO9H 1ZPBA 4IGDA 1AVWA 3BTHE 2CV3A 1MTVA 1A0LA 3SORA 1UCYH 3MU1A 1N1LA 2BVXH 4NCYA 7ESTE 1Q2WA 1VITG 3GISB 3S7KB 1S81A 2ZU3A 4OGYA 1W8BH 1LHFH 2QYIA 1C5VA 1AI8H 1TX8A 2ZTYA 3A89A 2JH6D 1EB1H 4Y0YE 2FOHA 3KQCA 1Z8IB 2VNTA 1A5HA 3UQOA 1UTMA 3GICB 2OLGA 1LPGB 1QL7A 4FVBA 1XVMA 2ZQ2A 1GJBB 4H6SB 3V0XA 2CGAA 1C1PA 4WXIA 5DK1A 1BZXE 1QR3E 2ZCKP 3A7WA 4LZ4B 3GY3A 1GG6B 2OBOA 3LGVA 1AKSB 3MH5A 1CT2E 2BLVA 5LH8A 1SLUB 4ZKNU 1UVOA 2Y5FA 2F9OA 2TBSA 1THRH 5A8XA 2BD2A 1W0YH 2FI4E 1BA8B 1Y5BT 1P11E 4MPXA 1NM6A 4DW2U 1F5RA 1YPHE 4O3UA 3TITA 2VIDA 6CHAC 1DY9A 3BTKE 1GHBF 2HPQH 1EAIA 2R3UA 3BTFE 1IQFA 2P94A 2CHAB 1YBWA 1GI0A 1GL1A 1D9IA 4UDWH 1O5CB 3OTJE 5TCCA 4LXBH 2BLOA 4DT7B 3M61U 1RIWC 2XCFA 3MHWU 1PYTD 1QTFA 3DD2H 3EQ0H 1QB9A 1Z8GA 2Z9JA 1K1LA 3ESTA 1W10U 5DP7A 4BAMB 1P8VC 3BTEE 4MNWA 1CHOF 4CH2B 1TQ0B 4BXWA 2BTCE 1L1JA 4D76A 3BIVH 1HNEE 1QURH 5TJXA 1HJAC 2Y7XA 3E91A 4FXGH 1SQTA 1FY8E 1G3BA 1P3EA 3QZRA 2VIPA 2AFQB 2AMQA 1MD7A 4BTUB 1K1MA 1AGJA 1DFPA 3RC6A 2Z9KA 4NWLA 1FPCH 1IHSH 4OGXA 1GMHG 4GCHG 4NIXA 4TPYA 2ZA5A 2ALPA 1RTKA 2A4RA 2AH4X 3ZVAA 5JYIA 3A7XA 3BTDE 1KXCA 3LJOA 1IOEA 5DJ7A 5FCRA 2AMPA 4ABAA 3UR6A 2HVXA 1QCPA 2HLCA 1SFIA 1UO6A 4Y8XA 2ODYB 5T3HA 1CGIE 2XXLA 3M3SA 3RMNH 2QXIA 3ODFA 4IC5A 5L30H 1ZTLA 1C1TA 2GD4B 1TRNA 1Z71A 3LGWA 1T32A 3QGNB 5CE1A 1EASA 2HOBA 1TRMA 2GCTB 1ESAA 1MTNC 1ESTA 2ZGXH 3RXHA 1BBRH 4CRBA 2P59A 1LVYA 1G2MA 3LOXA 4X1SU 1GBAA 1AFQB 6ESTA 4X8UH 1E34B 2XBWA 3H5CB 2F9UA 1HLTH 1ELTA 3A7ZA 1C1SA 2BMGB 2ZDLA 3SU3A 3SUEA 1V2TT 1ELEE 3HKJB 4JMYA 1QY6A 4AB9A 4ABFA 4WWYA 3A8DA 3O8RA 2WUBA 1SGDE 2CJIA 2FZZA 2J34A 3E8LA 2AS9A 1EUFA 3BEIB 1O2NA 3TGJE 2C8WB 2BM2A 1AWHB 2ZTZA 3QUMP 3PLBA 1DM4B 4U2WA 1GBCA 2AERH 1SGQE 3TVJB 2VJ1A 3MO3A 2G5VA 1M9UA 1P04A 1OWIA 3RLYH 1ZRBA 2R9PA 1P2JA 1FI8A 1Y3WA 3SW2B 1GBFA 2A2QH 1OWJA 4K5ZA 4IN2A 3UOUA 4AFQA 1GDQA 1GBDA 4TPIZ 1LPZB 1KLIH 4LZ1H 2PHBA 9ESTA 3URCA 2C90B 1O3DA 4MNXA 1GPZA 2QXJA 2FIRH 1S84A 4NSVA 1GMCG 1QGFA 2H1UA 1G37A 1NRPH 1GMCF 1L0ZA 1GHBG 3GCNA 1O2LA 4CR9A 2Q6FA 3T62A 3HK3B 1C4V2 1A5IA 3RXQA 4FUIA 1O3GA 4JZDH 1GI9B 3W95A 1A5GH 1C2EA 2VWNA 2F3CE 1NY22 3ENSB 1NN6A 4CHAB 4JCNA 4A92A 3CENA 1UTKA 1IQLA 3C1KA 1CE5A 2CXVA 4Z0KA 2KAIB 4IS5A 1ZTJA 3L33A 2IJOB 4ISIH 3SJIA 1MBMA 3EGKH 2AGIX 3GDSA 5EPNA 1ZRKA 5AVDA 2XC4A 1HAGE 1FN8A 4ZAEA 5GJ4B 1O2GH 3CP7A 2Z3CA 3MFJA 1K1NA 3K9XB 1HJ8A 1EAUA 3NWUA 1O2WA 2ZDNA 2VGCB 1F2SE 2XNIA 2ANYA 1XXDA 4JZFH 4RKOB 1QNJA 5CHAB 1J8AA 3RM2H 1DICA 2FI5E 4ZKOU 3GCTF 1YCPK 1HAZB 1GVLA 1QL8A 4TWWA 1GHAG 5DG6A 3M3VA 4K3JA 5F8TA 1KXAA 1DOJA 4IW4E 1TA2A 3R3GB 4HFPB 2PKAB 1HFDA 1K2I1 1O2JA 1GBMA 1THPB 3SNEA 4INLA 2TGAA 1NU7B 4B71A 1NPMA 3KHVA 1E37B 3EA9A 1GHXH 2UWOA 2ZCHP 2W7SA 5A2MH 1AO5A 2Q6DA 5F03A 1UK2A 3RXUA 4CBNA 3VB5A 2ANMH 1PPHE 4UEHH 1P09A 5GCHG 1P03A 4FUDA 1BJVA 3TH3H 2ZKSA 2J92A 1OOKB 5DP5A 2BD3A 5F8XA 1O2XA 2ZO3H 2BY5X 3Q00A 3D62A 4AORA 2C8YB 2A5AA 5FPYA 1TOMH 2I6QA 4MG3A 2RA0A 1PPBH 3GDUA 2JH0D 1GCTB 2VVVA 5T6DA 2ZGJA 2G81E 1ELFA 2BXTH 1E35B 3I29A 1QBVH 2ZHFH 5HM9A 3NUMA 4J2YB 3FP7E 1SL3A 2FLRH 4NZLA 1S83A 1VGCC 1UHBB 1OP2A 4K2YA 5IYTA 5T6GA 3MYWA 1JRSA 1J14A 4KTCA 3P8NA 1Z1JA 2C3SA 3GY7A 4MLFB 1NRSH 4FUJA 1LVOA 2WYJA 5EOKA 1O3LA 1OSSA 3U69H 1FY1A 2CF9H 5C1UA 7GCHG 3A7TA 3QZQA 4Y11E 4JYVH 3LH1A 3SQHE 4IC6A 2Z3DA 1C2LA 1T4VH 4X6OA 1OYTH 2KAIA 4Y0ZE 2QC2A 1QRWA 4PROA 1ARBA 1G3EA 2UWLA 4BTTB 1XUJA 4AFZA 4BAKB 3D23A 5ESTE 3ZVFA 1S85A 1AU8A 2EA3A 2ZGHA 1TPAE 1O31A 1GHVH 5C2ZA 1FNIA 2J95A 1A61H 1GBHA 1B0EA 1ID5H 1HV7A 3SV6A 1L4DA 1W14U 3LT3A 4UFDH 1HGTH 4CH8B 4ABJA 5FPSA 2JETC 1O3HA 1C1WH 1QBNA 2ZFTA 3URDA 1O3JA 3SBKA 2AEIH 2WPLS 2F91A 5A09A 1G3CA 2A7HA 1UVTH 3GY4A 4ZHAA 5EU8A 4AZ2B 1P9SA 1CA8B 3ATIA 3F9HA 1NROH 2QV1A 1RD3B 5EW2H 1QJ6B 1SPJA 6CHAB 1C2IA 2BOHB 1XXFA 2BB4A 2GX4A 2TRMA 3SU4A 2D8WA 4FUBA 2FX6A 3A82A 1KXFA 1T8OA 1SMFE 2P16A 2VWLA 1O39A 1Y3VA 3SJ8A 3E90B 4Q2KA 1SGTA 1MTUA 3UIRA 1ZMNA 3HATH 1A4WH 3LDXH 4GHQA 1GHZA 3BTGE 1KIGH 5HMAA 3K6YA 1EJMA 2ZU2A 2G8TA 4X2VA 5HM2A 2FS8A 4INHA 3M7TA 1YCPH 2PW8H 3WY8A 4GSOA 2WPJS 3KQEA 1QJ1B 1MZAA 2ZPSA 5EODA 3VXEH 1O3IA 2G4TA 4A1XA 1BQYA 1TOCB 4A7IB 2OQUA 3UWJH 3FP6E 3NKKA 1LPKB 2SNWA 3S9CA 3VGCC 2PGBB 1AFQC 3LGYA 1SGEE 1O2UA 2A4QA 1ETTH 1LQDB 1SI5H 3BTME 3SV7A 2Z6BD 4E05H 2G5NA 2H9HA 1BHXF 4O3TA 1O32A 4U01A 1SGYE 7GCHF 2D26C 3QDZB 5HXFA 2BDYA 5B6OA 1SGFA 4U30A 5C67A 1S6FA 1V2MT 1YPEH 4AYVB 1GBLA 2AYWA 1TMTH 3QK1A 4X1RU 1YLCA 2BDIA 4X8SH 1QIXB 1V2LT 1NESE 3BN9A 1ZJKA 3IG6B 1KLJH 1IQHA 2AGGX 3V12A 1DPOA 1OPHB 3VB4A 2PWXA 1HAVA 4K1EA 2BX3A 5AFYH 3NK8A 4AGKA 2RA3A 3FAOA 4R0IA 1V2VT 2XBYA 1TAWA 1ZSKA 4I8JA 2PGQB 3ZZ3A 1W0ZU 3NXPA 1EZQA 4ZXYH 1OX1A 4YM9A 4YZUA 5DKMA 2XCNA 3P6ZB 1V3XA 4X2WA 3UWIA 1S6HA 1U6QA 3OX7U 3Q77A 1K9OE 3AW0A 1D3TB 1BOQA 2R2WU 2XWAA 1B0FA 1C5LH 1AB9C 1TYNA 1G2LA 3U8RH 3STJA 2BDHA 3F9EA 1MMJN 2ZDAH 1BRAA 1FN6A 1C5UA 3MU4A 1O0DH 2C93B 1NU9A 1N6XA 1VITF 2BVSH 4XFQA 3UREA 1SR5C 4AB8A 1YPMH 4WMFA 2ZFSA 3A84A 3TJUA 2VU8E 3NZIA 3N7OA 4ABEA 3T26A 3BEFB 3M5LA 5DPAA 5CMXH 2O8TA 3AW1A 2J94A 1ZYOA 2Y7ZA 2ZDKA 1NC6A 3SGAE 2GMTC 1E38B 1DWDH 4QT8C 5FX6A 1CGJE 3V7TA 2XRCA 2GZ7A 4A5TS 4CREA 4NG9H 5FXLA 1HAYB 1DUEA 1RTFB