3SO3A

Structures of fab-protease complexes reveal a highly specific non-canonical mechanism of inhibition.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
241
structure length
240
Chain Sequence
b'VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPISLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEDGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Suppressor of tumorigenicity 14 protein
publication title A reverse binding motif that contributes to specific protease inhibition by antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 240
sequence length 241
ec nomenclature ec 3.4.21.109: Matriptase.
pdb deposition date 2011-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3so3A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3so3A01
2QF0A 1RIWC 3SORA 3N7OA 1SGEE 3SV8A 1ARCA 1V2JT 1P2OA 3SN8A 1V2PT 1MAXA 4LOYH 1TX7A 1UK4A 1AQ7A 1QRWA 1O2LA 1H8DH 3U69H 2FM2A 4UDWH 1GVLA 3JZ1B 2XNIA 3P92A 1C5YB 3ODDA 1VCPA 7GCHG 1G3CA 1NTPA 1V2MT 1ZTKA 2BY7X 3RMNH 4ZHLU 4CBNA 1DPOA 2PTCE 4CR9A 1Y5UT 3UQOA 3I78A 2ZPSA 1O2TA 2J2UA 4X1PU 3ZZDA 1EASA 3TVJB 4X6MA 4BNRA 4D9QA 1KXBA 4X8TH 1Y3XA 5IYTA 2FO9A 3SJIA 2RG3A 4A92A 3KN2A 3ZZ8A 3P6ZB 1SHYA 1IQFA 4CR5A 1VCWA 1QA7A 3A7YA 2BD7A 3T62A 1EXFA 2A31A 2C8YB 2EI7A 1UTLM 2W5EA 1GI2A 1HIAB 4D9RA 3I77A 2IPHA 4IC5A 1GBDA 4IBLH 1YGCH 1LCYA 3A8BA 1H8IH 1O3PB 2F91A 4X2VA 1BTZA 1PJPA 3ZVDA 3M61U 2SGEE 1Q3XA 4R8TB 3M7QA 1EPTC 1AB9B 1AZZA 1C2EA 1EPTA 5LPFA 3A89A 3RXKA 1EAUA 5IDKA 3ZZAA 5ESTE 1TQ0B 1SGIB 3BIUH 3RU4D 1O5AB 2Z3CA 1Y59T 3P8NA 4ZKNU 3I29A 1O30A 1A3EH 3MNBA 3T25A 1AKSB 2ILNA 1GJBB 1K1NA 1TA2A 2WPHS 1HGTH 1SGFG 3SHCH 2OUAA 2XWBI 1TGBA 1EATA 4KP0A 4FUGA 3MOCA 4NWLA 1O3GA 2J34A 2O8UA 1ZMLA 3SJ8A 4U32A 1TNKA 1EZXC 1NFWA 6GCHF 3TK5A 1C1OA 1FN8A 2ZHWH 2HPPH 3QK1A 1MU6B 2OLGA 3GICB 2WINI 2FWWA 1E0FD 1GBLA 3SU1A 8ESTE 3RLYH 2VH0A 4TWYA 2ULLA 4OS4A 4JYUH 2ZHEH 1NU9A 4FUFA 4X2XA 1H1BA 3SU5A 3GYMA 1O3FA 1UTKA 1SQOA 4I8JA 3KHVA 1AVGH 3PYHA 1KXAA 1SOZA 3KF2A 3ZVCA 1HNEE 1GDUA 1F5KU 2H5DA 2Z6BD 1FY5A 4JZIA 4NFFA 1TPPA 3ENSB 2TPIZ 1C5ZB 1IQEA 1GBHA 2D1JA 1EAXA 3SGBE 2VIPA 2GCTB 1THRH 4PROA 1GMDF 1IQMA 3SV2H 1O2WA 4OS2A 1SQAA 1C5XB 1O2HA 4ISNA 2ZTZA 3AW0A 1XKAC 1YPKH 4FUJA 1LKBA 4DVAU 2ZCHP 4AORA 3PV4A 3ZZCA 8GCHF 5ETXA 2PR3A 2BLWA 2CF9H 3MFJA 5EU8A 2PSXA 1P2KA 3VB3A 1D9IA 1UCYE 3H7OA 4DURA 3AAUA 3BTKE 4BTUB 2QAAA 3SNCA 1LHGH 3HPTB 5DP7A 1XMNB 1EB1H 1LPGB 1ESAA 1SGPE 3OTJE 4B76A 4TPIZ 2VJ1A 2VWLA 5JB8S 2AERH 2TRMA 3A86A 2F9UA 1G3BA 3MNSA 4X6OA 2P3TB 3MO9A 4GAWA 4HGCA 1BTUA 2ZHFH 1BJUA 2XBWA 1LDTT 1EUFA 4NA8A 1UHBB 4NFEA 1YPHE 1SGRE 4VGCB 2A2QH 2QXIA 3Q76A 4GHQA 1FY3A 1SI5H 4J2YB 2A45B 1XM1A 3E0NB 3DFJA 3PLBA 4GLYA 2Y6TA 5A8XA 1TNLA 1T7CA 5C67A 1H9LB 3MU5A 1TONA 1GHBF 1DLEA 2CF8H 1EKBB 3LJOA 2O8WA 2ZGBH 3U8TH 1FLEE 1CBWC 3F9HA 1GCTC 4ZUHA 1E38B 2BQWB 4M7GA 1AE5A 6CHAB 1FJSA 1ZGIA 5LGOA 4Y8YA 3UFAA 2B9LA 2C8ZB 1P9UA 4K3JA 2FMJA 3SUEA 1IOEA 3ODFA 3W94A 1GGDC 2BDBA 3RC6A 2TGAA 1AGJA 2ODYB 4ZH8A 3NCLA 1MZDA 2YNAA 1CGIE 3TGKE 2UUKB 1OWJA 5GCHG 4FUDA 3ZYDA 3EA7A 3D23A 2BQ6B 1F92A 3RMOH 2ZO3H 8KME2 2C4FH 1DWCH 5A09A 4K1TA 2WPLS 1YPJH 1HXFH 1WU1A 1QGFA 2ZECA 5C1YA 1ELVA 1HAZB 4WMEA 3DFLA 1Y3VA 1TMTH 3LT3A 2Y5FA 2GD4B 3MTYA 1GJ9B 5E8EH 2FYQA 2P16A 3B9FH 2OP9A 1ZSLA 4NIYA 2FX4A 2GT7A 7KMEH 3RXCA 3TGIE 1GBTA 3SHAH 2BX4A 1GBCA 1SVPA 5EG4A 4DY7B 1P8VC 3M3TA 2A7CA 2H1UA 2V0BA 3ZVAA 1A1RA 4AZ2B 1C5OH 4ZKOU 4JYVH 1ZGVA 4U30A 3RXRA 3GY5A 1HPGA 3O8DA 1OYQA 3MH7A 5DP3A 4DGJA 5GDSH 4MNWA 2F9VA 2PW8H 1MTWA 1TX8A 3RXQA 1AMHA 3HK6B 5EXLA 1O31A 4E06H 4ZKSU 5DK1A 3LU9B 2C8WB 3RXMA 2H9EH 1C5RA 2TGTA 1QL8A 2FI5E 1Z1IA 1G37A 1O2MA 3VFEA 1C5NH 1WAYB 1BHXB 1JIRA 3M5MA 3FZDA 1TGCA 3LDXH 4A5TS 2BOKA 3BTFE 2G81E 5JB9S 4GSOA 4BXSA 2FYRA 4AYVB 4R0IA 1GBIA 2SFAA 4E7NA 1K21H 3TNTA 3SI4H 3SO3A 3RXIA 2OQ5A 2FI3E 2HWLB 4CRAA 3R0FA 3FP8E 2BY8X 2Z9IA 3TGJE 1ZRKA 4H6SB 3NZIA 2C93B 1E34B 2P59A 5JBAS 2ZDMA 2Z9JA 3TK6A 3ZZ7A 1ZJDA 1GHWH 3F6UH 3LGYA 3RMLH 3BTGE 3RXLA 4RSPA 1PPBH 1UO6A 1KSNA 1NO9H 1GHZA 2Z94A 4TY6A 2R9PA 3K6YA 1N6YA 4GVUA 2AMQA 1E37B 4XOJA 4U01A 2B0FA 1XVOA 5DPAA 2FS9A 1VITH 1C5MD 1KLTA 2DE8A 2Y80A 1O3KA 1NS3A 2ZFRH 3RXOA 3O8CA 2A1DB 1W12U 3SNAA 4MPUA 1AD8H 2OQUA 4ESTE 4BAQB 2P93A 3GY3A 3VPKA 2HOBA 1ZJKA 5EPYA 4XDEA 2BOHB 2FESH 1S5SA 3RM2H 1H4WA 1BBRH 1N6XA 1DXWA 2VNTA 3A82A 3LC3A 4GCHF 1NRPH 1GBEA 1O2RA 3RU4E 1G9IE 1IQKA 4Y8XA 1V2RT 3Q00A 1EZSC 2QY0B 2OC7A 1ARBA 4DCDA 1MD8A 4BTIB 1O3MA 1O5EH 4YZUA 2BDYA 1XKBC 3U9AH 1QURH 1ABIH 1DDJA 1FUJA 3A88A 3P8GA 5AFYH 2FZZA 1C4V2 1CGHA 1HIAA 1ABJH 4MG3A 4Z0KA 1AE8H 1HB0B 3ELAH 4FU7A 5E0GA 4F4OC 1BMLA 1CBWB 1HFDA 3P8OA 1AB9C 4I31A 1ZPBA 4X2WA 1OWDA 1KXEA 3CS0A 3TJNA 2HGTH 3EA8A 1KXFA 1QB9A 1SMFE 2XBXA 1IQHA 5LH8A 1TPSA 2A5KA 5H4IB 3RXFA 1J14A 1YF4A 3R3GB 1GGDB 1AKSA 2I6QA 1C5PA 1NN6A 1O2QA 1Z8JB 5HMAA 1C1UH 1P9SA 3A85A 1ELFA 2ANMH 2GMTB 1CHGA 1NZQH 1YCPK 2R0KA 2ZHQH 4NZQA 4WH8A 5GJ4B 4AN7A 1TRNA 3FAOA 2AIPA 1AO5A 1P03A 2TIOA 1NPMA 1SGNE 2XCNA 3RXBA 1RFNA 4H4FA 1F5RA 1QBVH 1A7SA 2P95A 4JZFH 2V3HH 4CHAB 1J15A 4ABAA 1A46H 2Z7FE 1BHXF 1C2JA 4JCNA 1O2XA 1W2KH 3GYLB 2ZDLA 3T29A 2ZU2A 1MUEB 1CQQA 3K65B 2ALPA 4CRBA 1GHAF 1O2JA 2AMDA 2ZA5A 4B2BA 1EAIA 3EYDA 3O8BA 2ZTXA 1L1JA 2Z3DA 1EP6A 3ZVBA 1IQNA 2Y81A 1A61H 1O2KA 3U1JB 5C3NA 4I8LA 1IQIA 1EB2A 1XVMA 1Z71A 2AIQA 1P02A 4AFSA 2FEQH 1FY4A 2GCTC 3E3TA 2LNCA 1KIGH 1T4VH 3RM0H 1TE0A 4NSVA 3HATH 1HV7A 3AAVA 3UUZA 5A8ZA 5DO4H 2FOAA 1ETRH 2W3IA 1Y5BT 3GCTF 2A4QA 1UCYH 3RXTA 1F0UA 4SGAE 2THFB 4K8YA 2OC8A 1ZLRA 1O5CB 1RJXB 2I6SA 4DIHH 4MTBA 3PO1C 3V0XA 3ZZ6A 2XCFA 1TOMH 2CJIA 1INCA 1NRQH 3ZVGA 1GVZA 2XWAA 2ZEBA 1TB6H 2J4IA 1UVTH 4XBBA 4CRDA 5TCCA 1GI5A 1ZSJA 3FANA 1NC6A 5A0CA 2ZF0H 1UHBA 1GDNA 1FV9A 4VGCC 2JKHA 4Q7YA 5TCAA 3TH4H 4HI3A 2PUQH 3E16B 1BRBE 4AFUA 1KTSB 4ISHH 2BDGA 2AH4X 1GL0E 3Q77A 3MU8A 5DKMA 3MH6A 1DSTA 3V7TA 1Z6EA 5EW2H 1GMHF 2BMGB 2QXHA 1TGNA 1W11U 1SLUB 3ZYEA 4FUHA 2PGBB 1TMUH 2GV7A 3VB4A 1O5BB 1W13U 1AZ8A 3SOSA 3PM3A 1MCVA 1ZSKA 3QLPH 3FZZA 1QTFA 1SGCA 3ATLA 1DITH 2Y5HA 3RXDA 4AB9A 1QIXB 1TALA 1PPCE 1A0HB 2UUYA 2V6NA 2SNWA 2SNVA 6CHAC 3RXAA 1AU8A 1WYKA 2GZ9A 2P8OB 4XE4A 4Y0ZE 1SQTA 1O33A 4CRCA 1AFQB 1A2CH 2R0LA 3VEQB 1C1SA 1G3EA 1TMBH 1NY22 3K9XB 2PFEA 1O5GH 3QN7A 4ABGA 2ZFPH 1O3LA 2G5NA 4ZROA 4CRFA 1ZMJA 4ISIH 3L6PA 1HAVB 4A7IB 3KCGH 2IJOB 3TPIZ 4YOIA 2F9PA 2AEIH 2QA9E 3E0PB 4A1VA 1B0FA 3KL6A 1UTNA 2D8WA 3PMBB 1WTGH 1SB1H 3HGPA 3GDSA 1P3EA 2P3FH 1ZHPA 1WSSH 1D3PB 1K1IA 2XTTB 1ESBA 6GCHG 1VZQH 3S7HB 3UNQA 3V12A 1ZR0A 2F83A 1JBUH 2R2MB 4YLUA 1O3IA 3URDA 1N1LA 1TRMA 2BY5X 2J92A 1MKXK 1O2IA 2BD5A 3GY7A 5EQRA 2Z9KA 3D62A 3M5LA 1XUJA 1TBZH 1WQSA 1CT2E 5DP8A 1EX3A 5G4BA 3U1IB 1O37A 1W7XH 1J9CH 3SNEA 3MU4A 1GMDG 1QB1A 1VGCB 2BLVA 2TGDA 1GI8B 2J94A 1J17T 3H5CB 1G3DA 8GCHG 3TJOA 2BY9X 5JBCS 1F5LA 1ZRBA 3SV7A 3ZZ9A 3HKJB 2GKVE 3SV6A 4YT6H 2ZU5A 1T8MA 3KEEA 2O8MA 1KLJH 2H9TH 1H9IE 3C1KA 1GWAA 4RKOB 1ELAA 3P8FA 2SGAA 3A8CA 3SBKA 1LVYA 4AFQA 1C1RA 3EGKH 3P95A 1GJAB 1HAIH 4E05H 1J16A 5I46H 4O97A 3PLKA 4TY7A 1BJVA 1HJ8A 1WCZA 3LIWA 1D4PB 1JMOH 3OX7U 3P70B 2FOEA 4UEHH 4JMYA 4KTUA 1SFQB 1MMJN 1AWFH 1P3CA 2GDEH 2QC2A 5A0AE 3UR6A 3S9AA 1G32B 5C20A 1GMCG 3UTUH 1DY8A 1ELGA 2GX4A 1ELTA 1C2MA 1GHBG 2Y7ZA 4ABIA 4SGBE 1O5DH 1EQ9A 3PMHB 1UVUH 3S9CA 3SUGA 5SGAE 2HLCA 3LGUA 2AGEX 3A81A 1BOQA 4ASHA 1XX9A 3PO1B 2W7SA 1O2YA 1ANCA 1O2GH 1PQ7A 1X7AC 2BM2A 2Y7XA 1F2SE 3FP7E 3A83A 1KXDA 4WJG2 1LVOA 1NESE 3MNXA 3TU7H 1BRAA 1P57B 4I33A 1GJCB 3F9EA 4ABFA 3E91A 1DANH 5JBBS 4U2WA 4B1TA 2BXUH 3BTDE 3DT0H 1P05A 4BAHB 1CE5A 2OXSA 1CA0B 1PQ8A 1SBWA 2HNTF 2WPJS 1XUIA 1YCPM 1UVSH 1V2QT 2VIVA 3AW1A 4D8NA 1O34A 2ZTYA 1OP2A 1A4WH 2J38A 1PFXC 1DLKB 1ZPCA 4HTCH 3SQEE 1Z8GA 3OU0A 4KGAA 2A5IA 1O2ZA 2G4TA 1GMCF 4BXWA 5EODA 1P04A 2ZG0H 2XRCA 2UWLA 2UWOA 2ZWLH 4B74A 3SV9A 4X8VH 1FMGA 1BCUH 4LZ4B 3BTHE 2BDAA 5CE1A 2F9OA 1IAUA 1PPZA 4OGYA 3MHWU 1TGTA 3AASA 5AVDA 1LVMA 1UJ1A 2BDCA 3KGPA 3BTQE 1W0ZU 2RA0A 2VIDA 1Z1JA 4MNYA 4RKJB 1LHEH 1TNHA 2OC1A 1D3TB 2VVUA 4XBDA 1ZOMA 4ZHMU 5EQQA 1HAYB 1PPEE 1QY6A 2GMTC 1OWIA 5EOKA 2UWPA 2JH5D 1K1PA 5DGJA 1GBKA 1F7ZA 3MMGA 3LGTA 1W14U 1CVWH 5C2ZA 1BBRK 1WOFA 2FI4E 5DJ7A 4FU9A 4D7FA 2R3UA 3PWCA 1SHHB 5EPNA 5AHGH 4CHAC 3STJA 1YC0A 1CO7E 3F9GA 1ETSH 1BB0B 2CN0H 2GTBA 1QCPA 1VITG 2VWNA 1HJAB 1GI9B 2ZDVH 1Q2WA 5C5OA 4I8KA 1C4U2 2JH6D 3KQDA 2O9QA 1O3JA 1ID5H 1TOCB 5JBTA 1BTPA 3GCNA 2G4UA 2GT8A 1KYNA 4BAOB 4X8SH 2ZGJA 3C27B 5EW1H 2ODPA 1GHYH 2FDAA 1LTOA 3M3SA 3KIDU 1YKTA 1S83A 1CGJE 1TRYA 1XUGA 1JWTA 1B5GH 1MTNB 2PGQB 1GJ8B 1LQDB 4AG1A 1RTKA 1ELDE 4RN6A 1V2VT 2Q6FA 1P2QA 2BD8A 5E0HA 4Y7AA 1C5SA 1Y5AT 4B2AA 4K5ZA 1OP0A 2HALA 2XC5A 3MH5A 4AGJA 1SC8U 1YLDA 2UUFB 1FY8E 1HYLA 3UIRA 3LOXA 2Y82A 1V2WT 1W3CA 1VITF 2P94A 2VIOA 2Z3EA 1O39A 3HK3B 4KTSA 1Q31A 2AGGX 5C1XA 2A2XH 5C1UA 3L3TA 1U6QA 2QYIA 1AUTC 2OBQA 4WY3A 1TIOA 3EDXB 2VVCA 3VGCB 1WTHD 1C5LH 4GCHG 4ABDA 1T31A 4DT7B 3RXEA 2NWNA 3OYPA 4YM9A 1HXEH 1V2KT 1S84A 1FQ3A 5FBIA 3SJ9A 2ZGHA 2VU8E 3UWIA 5B6OA 1O35A 1N8OB 2Z9LA 3ZV8A 1YP9A 1Y3YA 4Z6AH 5DP9A 1HAXB 3RXJA 2BB4A 5I25A 2ALVA 5FXLA 3RLWH 3NWUA 1OYTH 3LGVA 3RXGA 1SR5C 2ZGXH 3MU1A 1DSUA 1MCTA 2WUBA 1TAWA 1F0SA 2IOTA 2BYAX 1V2ST 2QCYA 4ABEA 2P8OC 3BV9B 3LKWA 1CT4E 5FCKA 2FOFA 5HXFA 3UOPA 1P0SH 4ZXYH 1CU1A 1TQ7B 1AFQC 1CSOE 3H7TA 4YOGA 1MKWH 3QTVH 4AOQA 2ZI2H 4JK6A 1EP5A 1TFXA 1VJ9U 4BOHA 3URCA 1YPLH 1RD3B 2HNTC 1GJDB 1SLXB 1ANBA 1HAVA 1QBOA 1O2UA 5ESBA 3GISB 2HPQH 4INHA 3A7VA 1B7XB 2ZHDA 1GI3A 3GY2A 1C1NA 3D49H 2FOGA 5DP5A 5BPEA 1NROH 4QT8C 1WQVH 1AVXA 1KLIH 2F9NA 2EA3A 4UFGH 4CREA 1G30B 1W7GH 1K28D 3SGAE 3LH3A 1BTXA 3GY4A 3BTWE 4GUXA 1HLTH 2IN2A 1UK3A 1BTYA 1GHAG 5F03A 2RDLA 3BTTE 5L2ZH 1NRRH 4TWWA 4MVNA 1G2MA 1OWKA 3U8OH 2FLRH 1VJAU 2B5TB 2SGFE 5JDUB 2QIQA 3MI4A 1K1MA 3T26A 4Y76A 1MH0A 4IN2A 2VGCB 3FP6E 2BVXH 3ESTA 1VGCC 1GI0A 3HGNA 4CH2B 1SG8B 4ISOA 3GCTG 4ISLA 5FPYA 3GY6A 3RU4T 4Y11E 1C2FA 2ASUB 1ZZZA 1ETTH 5FPSA 1AI8H 1GBAA 1H9HE 1C1WH 1PPHE 3VB6A 2A5AA 4ZAEA 5PTPA 1MTUA 2LPRA 1CHOG 1A3BH 3UOUA 3K6ZA 4AG2A 4INLA 2KAIA 4B2CA 1DVAH 2NU1E 2CV3A 3MH4A 4I32A 4LZ1H 3TIUA 2CXVA 4K1SA 3GDUA 3DA9B 3M5NA 4GPGA 1O2OA 4IN1A 1BITA 5HYOA 1QNJA 1IQLA 2FPZA 1J8AA 4IW4E 1OWHA 4ABBA 4Y10E 1GI7B 5JPMH 1EJMA 3A7XA 1FPHH 1GMHG 2PUXB 3STIA 4HZHA 4XSKU 4YT7H 1SSXA 4D76A 4MPXA 2P3UB 4NSYA 1EOLA 1FI8A 1EZUC 1PPFE 2JH0D 1S81A 2ZGCA 3WY8A 1KY9A 1FY1A 3BTME 4KKDA 4FVBA 4IS5A 9LPRA 2BDIA 3BEIB 4TYDA 3SNBA 1T8LA 4B75A 1LO6A 1CHOF 1FIWA 3RDZA 1FDPA 2CHAB 2OD3B 1MD7A 3LGWA 5GPIB 1GJ4H 2H2ZA 4FUIA 1BRUP 2A4GA 4WXIA 3LPRA 1CA0C 2VWOA 3S7KB 4NA7A 1ELBA 1ZTJA 3TNSA 1P2MA 1FZZA 4A6LA 5AFZH 4WMFA 2Q1JA 1DUEA 4NG9H 2K1QA 5FX5A 1C5UA 7ESTE 3E90B 4INKA 1EJNA 2HVXA 3ZVFA 4WXVA 5K0HA 1W10U 3LONA 1T8OA 1F0TA 1LMWB 2WYJA 3UREA 4O03A 2ZKSA 2EC9H 4MPWA 1UVOA 3ATKA 1TPAE 3ITIA 5T6FA 4ZHAA 1OX1A 2FTMA 1ZYOA 1P01A 2UUJB 3QUMP 3TITA 4ZKRU 1LVBA 4MNXA 1G36A 3QO6A 1DWBH 1OOKB 1AN1E 2WPMS 2QGRA 2PKAA 1KDQB 1L4DA 1IHSH 1PQ5A 3QZRA 2A0QB 4AFZA 5A0BA 4DW2U 4XFQA 4X2YA 1FN6A 1MBMA 1PPGE 4Y7BA 1AY6H 2FTLE 3V13A 3A7ZA 3SUFA 3KQBA 2C90B 1BZXE 1BTWA 1C2KA 1QA0A 1DOJA 1JXPA 2CGAA 1THSH 3UNSA 3B23B 2ZCKP 1DX5M 3M36A 3SJKA 4MDSA 3EAJA 1V2OT 5FPTA 1MQ5A 3LJJA 5JYIA 1YCPH 3SUDA 2BZAA 4UONA 4NGAH 1DY9A 8LPRA 5TJXA 1O3CA 2WPKS 1HJAC 1C9PA 3M35A 1GHVH 1VCQA 1MTSA 4UFDH 3M3VA 2BD3A 2ZP0H 4J1YA 3NUMA 1O3OA 2FLBH 2PLXA 1GPZA 1S0RA 3B8JA 3ATIA 1W0YH 2PKSB 3M37A 1BBRE 1OWEA 1GDQA 3SJOA 1Y3WA 1UTMA 2BVRH 1TBRH 4IMQA 3MO6A 3SU2A 4X6NA 3A7TA 3F9FA 4ABJA 1C5WB 3TH3H 1GHXH 1SPJA 3BIVH 3BN9A 3T28A 1C1QA 2NU4E 3PMJA 3PROA 5DP4A 2BLOA 4D7GA 1P11E 1V2LT 4UFFH 5HM9A 1Y8TA 1GI4A 3TJUA 1MTNC 1O2PA 3U98H 3PTBA 5L30H 3RC4A 1QRXA 4NZLA 4Y8ZA 1HBTH 1O3BA 4OS7A 2DUCA 3A80A 2QXJA 3SU6A 2FS8A 1TLDA 2G5VA 2WYGA 1BMNH 2QN5T 1O3NA 1WBGB 4FUBA 2ZC9H 4K60A 5EXMA 7GCHF 2BX3A 1ANDA 2FIRH 1FXYA 3A87A 2O8LA 2O8TA 1T4UH 2D26C 2KAIB 3VGCC 1BRCE 2WUCA 4Y79A 1YPHC 5EXNA 3S0NA 1QQ4A 2EI8A 2ZIQH 1O5FH 4ZXXH 2H5CA 2ZFFH 1O2VA 4OS5A 5A8YA 1SLVB 4NCYA 3SU0A 2Q6DA 1SGTA 3PMAB 1GBMA 1N8OC 1NRNH 1SGYE 2ZU4A 1JRTA 1LHCH 4B73A 2A4RA 1TPOA 1UTQA 1HAHH 3RUOA 4K1EA 1W8BH 3SZNA 5T6DA 1CA8B 4I7YH 1YPGH 2QV1A 2AFQB 3T27A 1UTJA 1JRSA 2B7DH 3VB5A 1PYTC 2OCVB 1FONA 2XBYA 2A32A 2BHGA 1NFUA 4CRGA 1IHTH 1D6WA 3NPSA 1EOJA 4A1TA 1DM4B 3GCHB 1XXDA 3ZZ4A 3A8DA 1K1LA 5EQSA 3PWBA 4NA9H 4K8BA 1BQYA 1O32A 2FOCA 4X1RU 1AIXH 3LGIA 2YOLA 2J95A 2ZDNA 1K1OA 2GVFA 1GL1A 2EEKA 1OSSA 2BDHA 5CHAB 3A7WA 4H6TA 2A7JA 5GIBA 3SU4A 4IGDA 4NIXA 3Q3YA 3LC5A 2ZU1A 1MTVA 5T6GA 2A7HA 1P09A 3SW2B 3E1XB 1BMMH 3SU3A 1MBQA 2ZQ2A 1Z8RA 3MU0A 2BD9A 2FX6A 2Z9GA 1OKXA 1F0RA 2XYAA 5L6NH 1C2IA 2XC4A 1EJAA 3ATMA 1BA8B 1GI1A 2JETB 2ANKH 2VINA 1ACBE 2WV4A 5HM2A 1NT1A 1WUNH 2XW9A 4Q2KA 5FX6A 2PKAB 1TYNA 1BUIA 1OPHB 1QJ6B 3RXHA 1P2JA 4OS6A 2OINA 4YTAA 4DOQA 1O3HA 2RA3A 3RC5A 1S0QA 2VGCC 3CENA 2G00A 2ZFSA 1QRZA 3EE0B 3SQHE 2GGVB 1MKXH 1GG6B 1L4ZA 1EAWA 1ZTLA 1D3DB 1MKWK 4K2YA 4X1SU 2PWXA 1RIWB 2W3KA 3CP7A 1NU7B 2VB0A 1HRTH 3Q3KA 1MZAA 4X0WU 2V3OH 5FHTA 4Y0YE 4FVDA 2STBE 3SNDA 1A5IA 1AFEH 1EZQA 1FPCH 3GY8A 5LPRA 1LQEA 4WVPE 3V3MA 2OTVA 3U8RH 2Y5GA 1ORFA 1GJ7B 3TJVA 1AWHB 2M5TA 1C1TA 1DUAA 1Z8IB 4A1XA 5GWZA 3NXPA 1CT0E 1TA6A 1QHRB 1Z6JH 3SI3H 4THNH 1GCDA 1G2LA 1QJ1B 5C5NA 2AYWA 3QZQA 5CMXH 5A2MH 3BF6H 2EI6A 3M5OA 4X1QU 3ZZ5A 1GJ6A 1BIOA 1NM6A 3UQVA 4IC6A 3PTNA 1LKAA 2TGPZ 1SGDE 2BXTH 1ZHMA 1KTTB 3NKKA 3BG4C 2GV6A 3DD2H 1QB6A 1YPMH 4YESB 1C9TA 1O3AA 6LPRA 2VWMA 5FAHA 1C1PA 4O3TA 3GCOA 1HUTH 3EA9A 1TWXB 3FVFB 1SLWB 2ZFTA 1QR3E 1FIZA 1FAKH 2ZZUH 3QX5H 5K7RA 2PV9B 2RCEA 1C2HA 1E35B 2FP7B 3BG8A 4UFEH 2PSYA 1T32A 5F6MA 1S6HA 4KTCA 3LH1A 1BMAA 2GP9B 1C5TA 2G52A 1EPTB 4NIWA 3ZZ3A 5L2YH 3EQ0H 1QJ7B 1TNGA 1MQ6A 2CHAC 2H9HA 3K2UA 1C2LA 1DS2E 1HCGA 5GCHF 4AX9H 3VXFH 2ZFQH 1ZHRA 1IQJA 3T2NA 1LHFH 3QWCH 3W95A 1RRKA 1QBNA 2SGDE 5E2OA 1MU8B 2BTCE 3ZZBA 3T5FH 1GI6A 4FUEA 1V2TT 2OC0A 4X1NU 1RGQA 1Y3UA 4E7RG 1AVWA 1K22H 5DP6A 9ESTA 1SL3A 1MAYA 5F8ZA 4ABHA 1O36A 5T3HA 5LPEA 1VR1H 1K2I1 5BRRE 1C5QA 3DUXH 1THPB 1FAXA 4CH8B 1GBFA 2ZNKH 2C3SA 3GOVB 2F3CE 2GCHG 2YNBA 1UK2A 5J4SA 2G51A 1T8NA 4JK5A 3M7UA 2ZPRA 1DXPA 1O2NA 2BQ7B 2CMYA 1D6RA 1HAOH 1JIMA 1P10A 3RXUA 4GHTA 1C4Y2 1PQAA 1L1GA 1KDQA 1UCYK 2ZU3A 1TBQH 2FOBA 1KXCA 5F8XA 2R3YA 4WH6A 2F9BH 1V3XA 1SGFA 3TLOA 1RTLA 3ATWA 1RTFB 5HGGA 2VVVA 2PTNA 2STAE 4X6PA 1O38A 3QTOH 4BANB 1HAPH 1QL7A 3KQCA 2ANYA 2C8XB 1LHDH 2SGPE 1GVKB 1RS0A 4MPVA 1DE7H 3BSQA 3RXVA 2AGIX 1BDAA 1OS8A 2NU3E 3UWJH 4BTTB 4JYTA 3UR9A 1XUHA 1M9UA 2ANWA 1IQGA 2H6MA 3PLPA 1P2NA 3VB7A 2FODA 4FU8A 2AS9A 2GZ7A 1SGQE 1P2IA 1SOTA 2AMPA 3MO3A 4WMDA 3FFGA 3Q3XA 3F1SB 1L1NA 6ESTA 1A5HA 1BT7A 4LK4A 2NU2E 1GJ5H 3BTEE 1TGSZ 4K69A 4O3UA 3AVZA 4H42U 3GDVA 2PKSC 4AB8A 4AGKA 2ZDKA 1HAGE 1DT2A 2GCHF 4BAMB 5E0JA 3IWMA 1XUFA 3KNXA 4Y71A 1BTHH 1XUKA 4Q80A 1LPKB 3OSYA 1ELCA 3UY9A 1DICA 2ZCLP 1NFYA 2XXLA 2WV5A 4Y6DA 3IITA 1ANEA 3ZV9A 2XC0A 1HDTH 1D3QB 4ZMAH 2VH6A 1NFXA 1E36B 4JZDH 2DE9A 1K9OE 2A4OA 4OGXA 1WV7H 1A0LA 1P06A 5F8TA 2D2DA 1YYY1 1DWDH 4X8UH 3M7TA 1O3EA 1UTOA 2BZ6H 2SGQE 1C2DA 2XBVA 3E6PH 4WWYA 2Q6GA 2R2WU 1GBBA 1GCTB 4WF8A 1S82A 1A5GH 2FOHA 3CS7A 3BEUA 2W26A 3E8LA 4BAKB 5GXPA 1V6DA 3D65E 4OS1A 1LPZB 4JZEH 2HNTE 3PB1E 1C1MA 3DHKH 4YO9A 3TH2H 4DIIH 1DWEH 1OXGA 3SGQE 1V2UT 2BD2A 2VIWA 4DJZB 3RXSA 3TK9A 1AUJA 1O3DA 3L33A 4NWKA 2V35A 7LPRA 5DG6A 3HKIB 4TPYA 1RXPA 4DG4A 4MQAA 1K1JA 3G01A 4IMZA 1Z7KA 4HFPB 2HRVA 3BG4B 1HJ9A 3O8RA 1PYTD 1QFKH 4I8HA 2FXRA 4AYYB 1QQUA 1GBJA 1YM0A 1UMAH 1TNJA 4UD9H 3MNCA 1O0DH 1YPEH 1YLCA 1TABE 4YOJA 1UVPA 3IG6B 2NU0E 1A0JA 1YBWA 1OP8A 3A84A 1TX6A 2BY6X 3OY6U 2B8OH 3JZ2B 3GCHC 2TBSA 1ESTA 2G8TA 2OBOA 3QGNB 3UPEA 2FOMB 1C1VH 2J9NA 4XBCA 2ODQA 4Q7ZA 5E2PA 1DFPA 1L0ZA 3BEFB 2PHBA 1P12E 4FXGH 2VIQA 3S69A 4B71A 1UTPA 3MWIU 4I8GA 5CHAC 3S9BA 1L2EA 2GZ8A 5FBEA 1V2NT 4JZ1A 4O9VA 5J4QA 3OY5U 4MLFB 2W7UA 5EGMA 2BVSH 3RP2A 2BLQA 2QXGA 2GDDA 2BD4A 1NRSH 4YLQH 3QGJA 4Q7XA 1SFIA 1O2SA 3P17H 3RXPA 4F49A 2JETC 4NIVA 3UNRA 1XXFA 2ZDAH 5AF9H 4UE7H 2ZQ1A 3KQEA 4FUCA 4LXBH 1S6FA 2ZPQA 1QL9A 1TNIA 1ZPZA 1FNIA 1JOUB 2G55A 1ELEE 2WPIS 1B0EA 4MNVA 3QDZB 3MYWA 1AHTH 3RMMH 2QF3A 3A8AA 4KELA 1GG6C 1C5VA 3ZVEA 5ABWA 1C2GA 3NK8A 3VXEH 2ESTE 3F68H 5FCRA 1ZMNA 4CBOA 1S85A
chains in the Genus database with same CATH superfamily
4ZCNA 2QF0A 1RIWC 3SORA 3N7OA 1SGEE 3SV8A 1ARCA 1V2JT 1P2OA 3SN8A 1V2PT 1MAXA 4LOYH 1TX7A 1UK4A 1AQ7A 1QRWA 1O2LA 1H8DH 3U69H 2FM2A 4UDWH 1GVLA 3JZ1B 2XNIA 3P92A 2JIZD 1C5YB 3ODDA 1VCPA 7GCHG 1G3CA 1NTPA 1V2MT 1ZTKA 2BY7X 3DSGA 3RMNH 4ZHLU 4CBNA 1DPOA 2PTCE 4CR9A 1Y5UT 3UQOA 3I78A 2ZPSA 1O2TA 2J2UA 4X1PU 3ZZDA 1EASA 3TVJB 4YXWD 4X6MA 4BNRA 2PP6A 4D9QA 1KXBA 4X8TH 1Y3XA 5IYTA 2FO9A 3SJIA 2RG3A 4A92A 3KN2A 3ZZ8A 3P6ZB 1SHYA 1IQFA 4CR5A 1VCWA 2HVYB 1QA7A 3A7YA 2BD7A 3T62A 1EXFA 2A31A 2C8YB 2EI7A 5EIYA 1UTLM 2W5EA 1GI2A 1HIAB 4D9RA 3F2HA 2IPHA 3I77A 4IC5A 1GBDA 4IBLH 1YGCH 1LCYA 3A8BA 1H8HD 1H8IH 1O3PB 2F91A 4X2VA 1BTZA 1PJPA 3ZVDA 3M61U 2SGEE 1Q3XA 4R8TB 3M7QA 1EPTC 1AB9B 1AZZA 1C2EA 1EPTA 5LPFA 3A89A 3RXKA 1EAUA 5IDKA 3ZZAA 5ESTE 1TQ0B 1SGIB 3BIUH 3RU4D 1O5AB 2Z3CA 1Y59T 3P8NA 4ZKNU 3I29A 3FO8D 1O30A 1A3EH 3MNBA 3T25A 1AKSB 2ILNA 1GJBB 1K1NA 1TA2A 2WPHS 1HGTH 1SGFG 3SHCH 2OUAA 2XWBI 1TGBA 1EATA 4KP0A 4FUGA 3MOCA 4NWLA 1O3GA 2J34A 2O8UA 1ZMLA 3SJ8A 4U32A 1TNKA 1EZXC 1NFWA 6GCHF 3TK5A 1C1OA 3PV5A 1FN8A 2ZHWH 2HPPH 3QK1A 1MU6B 2OLGA 3GICB 2WINI 2FWWA 1E0FD 1GBLA 3SU1A 8ESTE 3RLYH 2VH0A 4TWYA 2ULLA 4OS4A 4JYUH 2ZHEH 1NU9A 4FUFA 4X2XA 1H1BA 3SU5A 3GYMA 1O3FA 1UTKA 2CK3D 1SQOA 4I8JA 3KHVA 1AVGH 3PYHA 1KXAA 1SOZA 3KF2A 3ZVCA 1HNEE 1GDUA 1F5KU 2H5DA 2Z6BD 1FY5A 4JZIA 4NFFA 1TPPA 3ENSB 2TPIZ 1C5ZB 1IQEA 1GBHA 2D1JA 1EAXA 3SGBE 2VIPA 2GCTB 1THRH 4PROA 1GMDF 1IQMA 3F2GA 3SV2H 1O2WA 3N7EA 4OS2A 1SQAA 1C5XB 1O2HA 4ISNA 2ZTZA 3AW0A 1XKAC 1YPKH 4FUJA 1LKBA 4DVAU 2W6JD 2ZCHP 2XOKD 3PV4A 3ZZCA 4AORA 8GCHF 5ETXA 2PR3A 2BLWA 2CF9H 3MFJA 4FETA 5EU8A 2PSXA 1P2KA 3VB3A 1D9IA 1UCYE 3H7OA 4DURA 3AAUA 3BTKE 4BTUB 2QAAA 3SNCA 1LHGH 3HPTB 5DP7A 1XMNB 1EB1H 4P00A 1LPGB 1ESAA 1SGPE 3OTJE 4B76A 4TPIZ 2VJ1A 2VWLA 5JB8S 2AERH 2TRMA 3A86A 2F9UA 1G3BA 3MNSA 4X6OA 2P3TB 3MO9A 4GAWA 4HGCA 1BTUA 2ZHFH 1BJUA 2XBWA 1LDTT 1EUFA 4NA8A 1UHBB 4NFEA 1YPHE 1SGRE 4VGCB 2A2QH 2QXIA 3Q76A 4GHQA 1FY3A 1SI5H 4J2YB 2A45B 1XM1A 3E0NB 3DFJA 3PLBA 4GLYA 3WW7A 2Y6TA 5A8XA 1TNLA 2J97A 1T7CA 5C67A 1H9LB 3MU5A 1TONA 1GHBF 1DLEA 2CF8H 2VBCA 1EKBB 3LJOA 2O8WA 2ZGBH 3U8TH 2JJ1D 1FLEE 1CBWC 3F9HA 1GCTC 4ZUHA 1E38B 2BQWB 4M7GA 1AE5A 6CHAB 1FJSA 1NBME 1ZGIA 4Y8YA 5LGOA 3UFAA 2B9LA 2C8ZB 1P9UA 4K3JA 2FMJA 4F48B 3SUEA 1IOEA 3ODFA 3W94A 1GGDC 2BDBA 3RC6A 1BMFD 2TGAA 1AGJA 2ODYB 4ZH8A 3NCLA 1MZDA 2YNAA 1CGIE 3TGKE 2UUKB 1OWJA 5GCHG 4FUDA 3ZYDA 3EA7A 3D23A 2BQ6B 1F92A 3RMOH 2ZO3H 8KME2 2C4FH 1DWCH 5A09A 4K1TA 2WPLS 1YPJH 1HXFH 1WU1A 1QGFA 2ZECA 5C1YA 1ELVA 1HAZB 4WMEA 3DFLA 1Y3VA 1OHHD 1TMTH 3LT3A 2Y5FA 2GD4B 3MTYA 1GJ9B 5E8EH 2FYQA 2P16A 3B9FH 2OP9A 1ZSLA 4NIYA 2FX4A 2GT7A 7KMEH 3RXCA 3TGIE 1GBTA 3SHAH 2BX4A 1GBCA 1SVPA 5T1VA 5EG4A 3FN8A 2RDEA 4DY7B 1P8VC 3M3TA 2A7CA 3KYGA 2K0QA 2H1UA 2V3MA 2V0BA 3ZVAA 1A1RA 4AZ2B 1C5OH 4ZKOU 4JYVH 1ZGVA 4U30A 3RXRA 3GY5A 5DN6D 1HPGA 3O8DA 1OYQA 3MH7A 5DP3A 4DGJA 5GDSH 3VG8A 4MNWA 2F9VA 2PW8H 1MTWA 1TX8A 3RXQA 1AMHA 4OM9A 3HK6B 5EXLA 1O31A 4E06H 4ZKSU 5DK1A 3LU9B 2C8WB 3RXMA 2H9EH 5HKKD 1C5RA 2TGTA 1QL8A 2FI5E 1Z1IA 1G37A 1O2MA 3VFEA 1C5NH 1WAYB 1BHXB 1JIRA 3M5MA 3FZDA 1TGCA 3LDXH 4A5TS 2BOKA 3BTFE 2G81E 2WHXA 4GSOA 5JB9S 4BXSA 2FYRA 4AYVB 4R0IA 1GBIA 2SFAA 4E7NA 1K21H 3TNTA 3SI4H 3SO3A 3RXIA 2OQ5A 2FI3E 2OK5A 2HWLB 4CRAA 3R0FA 3UB0A 3FP8E 2BY8X 2Z9IA 3TGJE 1ZRKA 4H6SB 3NZIA 2C93B 1E34B 2P59A 5JBAS 2ZDMA 2EY4C 2Z9JA 3TK6A 3ZZ7A 1ZJDA 1GHWH 3F6UH 3LGYA 3RMLH 3BTGE 3RXLA 4RSPA 1PPBH 1UO6A 1KSNA 1NO9H 1GHZA 2Z94A 4TY6A 2R9PA 3K6YA 1N6YA 4GVUA 2AMQA 1E37B 2GJGA 4XOJA 4U01A 2B0FA 1XVOA 5DPAA 2FS9A 1VITH 1C5MD 1KLTA 2DE8A 2Y80A 1O3KA 5KGOA 1NS3A 2ZFRH 3RXOA 3O8CA 2A1DB 1W12U 3SNAA 4MPUA 1AD8H 2OQUA 4ESTE 4BAQB 2P93A 3GY3A 3VPKA 2HOBA 1ZJKA 5EPYA 4XDEA 2BOHB 2FESH 1S5SA 3RM2H 1H4WA 1BBRH 1N6XA 1DXWA 2VNTA 2J98B 2KR7A 3A82A 3LC3A 2WSSD 1NRPH 1GBEA 4GCHF 1O2RA 3RU4E 1G9IE 1IQKA 4Y8XA 1V2RT 3Q00A 1EZSC 2QY0B 2OC7A 1ARBA 4DCDA 1MD8A 4F55A 4BTIB 1O3MA 1O5EH 4YZUA 2BDYA 1XKBC 3U9AH 1QURH 3AK5A 1ABIH 1DDJA 1FUJA 3A88A 3P8GA 5AFYH 2FZZA 1C4V2 1CGHA 1HIAA 1ABJH 4MG3A 4Z0KA 1AE8H 1HB0B 3ELAH 3N7DA 4FU7A 5E0GA 4F4OC 1BMLA 1CBWB 1HFDA 3P8OA 1AB9C 4I31A 1ZPBA 4X2WA 1OWDA 1KXEA 3CS0A 3TJNA 2HGTH 3EA8A 1KXFA 1QB9A 1SMFE 2XBXA 1IQHA 5LH8A 4ASUD 1TPSA 2A5KA 5H4IB 3RXFA 5EJLA 1J14A 1YF4A 3R3GB 1GGDB 1AKSA 2I6QA 1C5PA 1NN6A 1O2QA 1Z8JB 5HMAA 1C1UH 1P9SA 3A85A 1ELFA 2ANMH 2GMTB 1CHGA 1NZQH 1YCPK 2R0KA 2ZHQH 4NZQA 4WH8A 5GJ4B 4AN7A 1TRNA 3FAOA 2AIPA 1AO5A 1P03A 2TIOA 1NPMA 1SGNE 2XCNA 3RXBA 1RFNA 4H4FA 1F5RA 1QBVH 1A7SA 2P95A 4JZFH 2V3HH 4CHAB 1J15A 4ABAA 1A46H 2Z7FE 1BHXF 1C2JA 1W0JD 4JCNA 1O2XA 1W2KH 3GYLB 2ZDLA 3T29A 2ZU2A 1MUEB 1CQQA 3K65B 2ALPA 4CRBA 1GHAF 1O2JA 2AMDA 2ZA5A 4B2BA 1EAIA 3EYDA 3O8BA 2ZTXA 2KCAA 1L1JA 2Z3DA 1EP6A 3ZVBA 3OE7D 1IQNA 2Y81A 1A61H 1O2KA 3U1JB 5C3NA 4I8LA 1IQIA 1EB2A 1XVMA 1Z71A 2AIQA 1P02A 4AFSA 2FEQH 1FY4A 2GCTC 3E3TA 2LNCA 1KIGH 1T4VH 3RM0H 1TE0A 4NSVA 3HATH 1HV7A 3AAVA 3UUZA 5A8ZA 2QF4A 5DO4H 2FOAA 1ETRH 2W3IA 1Y5BT 3GCTF 5IK2D 2A4QA 1UCYH 3RXTA 1F0UA 4SGAE 2THFB 4K8YA 2OC8A 1ZLRA 1O5CB 1RJXB 2I6SA 4DIHH 4MTBA 3PO1C 3V0XA 3ZZ6A 2XCFA 3FOAA 1TOMH 2CJIA 1INCA 1NRQH 3ZVGA 1GVZA 2XWAA 2ZEBA 1TB6H 2J4IA 1UVTH 4XBBA 4CRDA 5TCCA 1GI5A 1ZSJA 3FANA 1NC6A 5A0CA 2ZF0H 1UHBA 1GDNA 1FV9A 4VGCC 2JKHA 4Q7YA 5TCAA 3TH4H 4HI3A 2PUQH 4ACBA 3E16B 1BRBE 4AFUA 1KTSB 4ISHH 2BDGA 2KM0A 2AH4X 4RT0A 2KCPA 1GL0E 3Q77A 3MU8A 5DKMA 3MH6A 1DSTA 3V7TA 1Z6EA 5EW2H 1GMHF 2BMGB 2QXHA 1TGNA 1W11U 1SLUB 3ZYEA 4FUHA 3EE7A 2PGBB 1TMUH 2GV7A 3VB4A 1O5BB 1W13U 1WXRA 1AZ8A 3SOSA 3PM3A 1MCVA 1ZSKA 3QLPH 3FZZA 1QTFA 1SGCA 3ATLA 1DITH 2Y5HA 3RXDA 4AB9A 1QIXB 1TALA 1PPCE 1A0HB 2F43B 2UUYA 2V6NA 2SNWA 2SNVA 6CHAC 3RXAA 1AU8A 1WYKA 2GZ9A 2P8OB 4XE4A 4Y0ZE 2AHME 1SQTA 1O33A 4CRCA 1AFQB 1A2CH 2R0LA 3VEQB 1C1SA 1G3EA 1TMBH 2KFWA 1NY22 3K9XB 2PFEA 1O5GH 3QN7A 4ABGA 2ZFPH 1O3LA 2G5NA 3KQ5A 4ZROA 4CRFA 1ZMJA 4ISIH 3L6PA 1HAVB 4A7IB 3KCGH 2IJOB 2JJ2D 4YOIA 3TPIZ 2F9PA 2AEIH 2QA9E 3E0PB 4A1VA 1UW7A 1B0FA 3KL6A 1H8ED 1UTNA 2D8WA 3PMBB 1WTGH 1SB1H 3HGPA 3GDSA 1P3EA 2P3FH 1ZHPA 1WSSH 2HLDD 1D3PB 1K1IA 1QZ8A 2XTTB 1ESBA 6GCHG 1VZQH 3S7HB 3UNQA 3V12A 1ZR0A 2F83A 1JBUH 2R2MB 4YLUA 1O3IA 3URDA 1N1LA 1TRMA 2BY5X 2J92A 1MKXK 1O2IA 2BD5A 3GY7A 5EQRA 3F0OA 2Z9KA 3D62A 3M5LA 1XUJA 1TBZH 1WQSA 1CT2E 5DP8A 1EX3A 5G4BA 3U1IB 5C0TA 1O37A 1W7XH 1VKYA 1J9CH 3SNEA 5KECA 3MU4A 1GMDG 1QB1A 1VGCB 2BLVA 2TGDA 1GI8B 2J94A 1J17T 3FKSD 3H5CB 1G3DA 8GCHG 3TJOA 2BY9X 5JBCS 1F5LA 1ZRBA 3SV7A 3ZZ9A 3HKJB 2GKVE 3SV6A 4YT6H 2ZU5A 1T8MA 3KEEA 2O8MA 1KLJH 2H9TH 1H9IE 3C1KA 1GWAA 4RKOB 1ELAA 3P8FA 2SGAA 3A8CA 3SBKA 1LVYA 2M2AA 5B6LA 4AFQA 1C1RA 3EGKH 3P95A 1GJAB 1HAIH 4E05H 1J16A 5I46H 4O97A 3OEHD 3PLKA 4TY7A 1BJVA 4P02A 1HJ8A 1WCZA 3LIWA 1D4PB 1JMOH 3OX7U 3P70B 4AC9A 2FOEA 4UEHH 4JMYA 4KTUA 1SFQB 1MMJN 1AWFH 1P3CA 2GDEH 2QC2A 5A0AE 3UR6A 3S9AA 1G32B 5C20A 1GMCG 3UTUH 1DY8A 1ELGA 2GX4A 1ELTA 1C2MA 1GHBG 2Y7ZA 4ABIA 4SGBE 1O5DH 1EQ9A 3PMHB 1UVUH 3S9CA 3SUGA 5SGAE 2HLCA 3LGUA 3WWBA 2AGEX 3A81A 1E79D 1BOQA 4ASHA 1XX9A 3PO1B 2W7SA 1O2YA 1ANCA 1O2GH 1PQ7A 1X7AC 2BM2A 2Y7XA 1F2SE 3FP7E 3A83A 1KXDA 4WJG2 2QE7D 1LVOA 1NESE 3MNXA 3TU7H 1BRAA 1P57B 2KZ4A 4I33A 1GJCB 3F9EA 4ABFA 3E91A 1DANH 5JBBS 4U2WA 2J98A 4B1TA 2BXUH 3BTDE 3DT0H 1P05A 4BAHB 1CE5A 2OXSA 1CA0B 1PQ8A 1SBWA 2HNTF 2WPJS 1XUIA 1YCPM 1UVSH 1V2QT 2VIVA 3AW1A 4D8NA 1O34A 2ZTYA 1OP2A 1A4WH 2J38A 1PFXC 1DLKB 1ZPCA 4HTCH 3SQEE 1Z8GA 3OU0A 4KGAA 2A5IA 1O2ZA 2G4TA 1GMCF 4BXWA 5EODA 1P04A 2ZG0H 2XRCA 2UWLA 2UWOA 2ZWLH 4B74A 3SV9A 4TSFD 4X8VH 1FMGA 1BCUH 4LZ4B 3BTHE 2BDAA 5CE1A 2F9OA 1IAUA 1PPZA 4OGYA 3MHWU 1TGTA 3AASA 5AVDA 1LVMA 1UJ1A 4RT1A 2BDCA 3KGPA 3BTQE 3PRBA 1W0ZU 2RA0A 2VIDA 1Z1JA 4MNYA 4RKJB 1LHEH 1TNHA 2OC1A 1D3TB 2VVUA 4XBDA 1ZOMA 4ZHMU 5EQQA 1HAYB 1PPEE 1QY6A 2GMTC 1OWIA 5EOKA 2UWPA 2JH5D 2F4LA 1K1PA 5DGJA 1GBKA 1F7ZA 3MMGA 5HIZA 3LGTA 1W14U 1CVWH 4B6EA 5C2ZA 1BBRK 1WOFA 2FI4E 2IPQX 5DJ7A 4FU9A 4D7FA 2R3UA 3PWCA 1SHHB 5EPNA 5AHGH 4CHAC 3STJA 1YC0A 1CO7E 3F9GA 1ETSH 1BB0B 2CN0H 2GTBA 2WZQA 1WDIA 1QCPA 4B6FA 1VITG 2VWNA 1HJAB 1GI9B 2WPDD 2ZDVH 4XRNA 1Q2WA 5C5OA 4I8KA 1C4U2 2JH6D 3KQDA 2O9QA 1O3JA 1ID5H 1TOCB 5JBTA 1BTPA 3GCNA 2G4UA 2GT8A 1KYNA 4BAOB 4X8SH 2ZGJA 3C27B 5EW1H 2ODPA 3KYFA 1GHYH 2FDAA 1LTOA 3M3SA 3KIDU 1YKTA 1S83A 1CGJE 1TRYA 1XUGA 1JWTA 2L6OA 1SQRA 1B5GH 1MTNB 2PGQB 1GJ8B 1LQDB 4AG1A 1RTKA 1ELDE 4RN6A 1V2VT 2Q6FA 1P2QA 2BD8A 5E0HA 4Y7AA 1C5SA 1Y5AT 4B2AA 4K5ZA 1OP0A 2HALA 2XC5A 3F2FA 3MH5A 4AGJA 1SC8U 1YLDA 2KCOA 2UUFB 1FY8E 1HYLA 3UIRA 3LOXA 2Y82A 1V2WT 1W3CA 1VITF 2P94A 2VIOA 2Z3EA 1O39A 3HK3B 4KTSA 1Q31A 2AGGX 5C1XA 1EFRD 2A2XH 5C1UA 3L3TA 1U6QA 2QYIA 1AUTC 2OBQA 4WY3A 1TIOA 2JDID 2VVCA 3EDXB 3VGCB 1WTHD 1C5LH 4GCHG 4ABDA 1T31A 4DT7B 3RXEA 2NWNA 3OYPA 4YM9A 1HXEH 1V2KT 1S84A 1FQ3A 5FBIA 3SJ9A 2EQNA 2ZGHA 2VU8E 3UWIA 5B6OA 1O35A 1N8OB 2Z9LA 3ZV8A 1YP9A 1Y3YA 4Z6AH 3CNRA 1HAXB 3RXJA 5DP9A 3N99A 2BB4A 5I25A 2ALVA 5FXLA 3RLWH 3NWUA 1OYTH 3LGVA 3RXGA 1SR5C 2ZGXH 3MU1A 1DSUA 1MCTA 2WUBA 1TAWA 1F0SA 2IOTA 2BYAX 1V2ST 2QCYA 4ABEA 2P8OC 3BV9B 3LKWA 1CT4E 5FCKA 2FOFA 5HXFA 3UOPA 1P0SH 4ZXYH 1CU1A 1TQ7B 1AFQC 1CSOE 3H7TA 4YOGA 1MKWH 3QTVH 4AOQA 2ZI2H 4JK6A 1EP5A 1TFXA 1VJ9U 4BOHA 3URCA 1YPLH 1RD3B 2HNTC 1GJDB 1SLXB 1ANBA 1HAVA 1QBOA 1O2UA 5ESBA 3GISB 2HPQH 4INHA 3A7VA 1B7XB 2ZHDA 1GI3A 3GY2A 1C1NA 3D49H 3UAIC 2FOGA 5DP5A 5BPEA 1NROH 4QT8C 1WQVH 1AVXA 1KLIH 2F9NA 2EA3A 4UFGH 1K0HA 2K8IA 4CREA 1G30B 1W7GH 1K28D 3SGAE 3LH3A 1BTXA 3GY4A 3BTWE 4GUXA 1HLTH 2IN2A 1UK3A 1BTYA 1GHAG 5F03A 2RDLA 3BTTE 5L2ZH 1NRRH 4TWWA 5CDFE 4MVNA 1G2MA 1OWKA 3PV2A 3U8OH 2FLRH 1VJAU 2B5TB 5C0UA 2SGFE 5JDUB 2QIQA 3MI4A 1K1MA 3T26A 3DSOA 4Y76A 1MH0A 4IN2A 5KEDA 2VGCB 3FP6E 2BVXH 3ESTA 1VGCC 1GI0A 3HGNA 4CH2B 2YMSB 1SG8B 4ISOA 3GCTG 4ISLA 5FPYA 3GY6A 3RU4T 4Y11E 1C2FA 2ASUB 4Q4LA 1ZZZA 1ETTH 5FPSA 1AI8H 1GBAA 1H9HE 1YY3A 1C1WH 1PPHE 3VB6A 2A5AA 2KCYA 4ZAEA 5PTPA 1MTUA 2LPRA 1CHOG 1A3BH 2KX4A 3UOUA 3K6ZA 4AG2A 4INLA 2KAIA 4B2CA 1DVAH 2NU1E 2CV3A 3MH4A 4I32A 4Q63A 5EJZA 4LZ1H 3TIUA 2CXVA 4K1SA 3GDUA 3DA9B 3M5NA 4GPGA 1O2OA 4IN1A 1BITA 5HYOA 1QNJA 1IQLA 1S6LA 2WV9A 2FPZA 1J8AA 4IW4E 1OWHA 4ABBA 4Y10E 1GI7B 5JPMH 1EJMA 3A7XA 1FPHH 1GMHG 2PUXB 3STIA 4HZHA 4XSKU 4YT7H 1SSXA 1FX0B 4MPXA 4D76A 2RFKC 2P3UB 4NSYA 1EOLA 1FI8A 1EZUC 1PPFE 2JH0D 1S81A 2ZGCA 3WY8A 4DT4A 1KY9A 1FY1A 3BTME 4KKDA 4FVBA 4IS5A 9LPRA 2BDIA 3BEIB 4TYDA 3SNBA 1T8LA 4B75A 1LO6A 1CHOF 1FIWA 3RDZA 1FDPA 2CHAB 2OD3B 1MD7A 3LGWA 5GPIB 1GJ4H 2H2ZA 4FUIA 4I86A 1BRUP 2A4GA 4WXIA 3LPRA 1CA0C 2VWOA 3S7KB 4NA7A 1ELBA 1ZTJA 3GS9A 3TNSA 1P2MA 1FZZA 4A6LA 5AFZH 4WMFA 2Q1JA 1DUEA 4NG9H 2K1QA 5FX5A 1C5UA 7ESTE 3E90B 4INKA 1EJNA 2HVXA 3ZVFA 4WXVA 5K0HA 1W10U 3LONA 1T8OA 1F0TA 1LMWB 2WYJA 3UREA 4O03A 2ZKSA 2EC9H 4MPWA 1UVOA 3ATKA 1TPAE 3ITIA 5T6FA 4ZHAA 1OX1A 2FTMA 1ZYOA 1P01A 2UUJB 3QUMP 3TITA 4ZKRU 1LVBA 4MNXA 1G36A 3QO6A 1DWBH 1OOKB 1AN1E 2WPMS 2QGRA 2PKAA 1KDQB 1L4DA 1IHSH 1PQ5A 4HG6A 3QZRA 2A0QB 4AFZA 5A0BA 4DW2U 4XFQA 4X2YA 1FN6A 1MBMA 1PPGE 4Y7BA 1AY6H 2FTLE 3V13A 3A7ZA 3SUFA 3KQBA 2C90B 1BZXE 1BTWA 1C2KA 1QA0A 1DOJA 1JXPA 2CGAA 1THSH 3UNSA 3B23B 2ZCKP 1DX5M 3M36A 3SJKA 4MDSA 3EAJA 1V2OT 5FPTA 1MQ5A 3LJJA 5JYIA 3ZIAD 1YCPH 3SUDA 2BZAA 4UONA 4NGAH 1DY9A 8LPRA 5TJXA 1O3CA 3U28C 2WPKS 1HJAC 1C9PA 3M35A 1GHVH 1VCQA 1MTSA 4UFDH 3M3VA 2BD3A 2ZP0H 4J1YA 3NUMA 1O3OA 1SKYE 2FLBH 2PLXA 1GPZA 1S0RA 3B8JA 3ATIA 1W0YH 2PKSB 3M37A 1BBRE 1OWEA 1GDQA 3SJOA 1Y3WA 3W1EA 1UTMA 2BVRH 1TBRH 4IMQA 3MO6A 3SU2A 4X6NA 3A7TA 3F9FA 4ABJA 1C5WB 3TH3H 1GHXH 1SPJA 3BIVH 3BN9A 3T28A 1C1QA 2NU4E 3PMJA 3PROA 5DP4A 1MABB 2BLOA 1P11E 1V2LT 4UFFH 4D7GA 5HM9A 1Y8TA 1GI4A 5DSFA 3TJUA 1MTNC 1O2PA 3U98H 3PTBA 5L30H 3RC4A 1QRXA 4NZLA 4Y8ZA 1HBTH 1O3BA 4OS7A 2DUCA 3A80A 2QXJA 2V7QD 3SU6A 2FS8A 1TLDA 2G5VA 2WYGA 1BMNH 2QN5T 1O3NA 1WBGB 4FUBA 2ZC9H 3WWFA 4K60A 2L74A 5EXMA 7GCHF 2BX3A 1ANDA 2FIRH 1FXYA 3A87A 2O8LA 2QF5A 2O8TA 1T4UH 2D26C 2KAIB 3VGCC 1BRCE 2WUCA 4Y79A 1YPHC 5EXNA 3S0NA 1QQ4A 2EI8A 1YWUA 2ZIQH 1O5FH 4ZXXH 2H5CA 2ZFFH 1O2VA 4OS5A 5A8YA 1SLVB 4NCYA 3SU0A 2Q6DA 1SGTA 3PMAB 1GBMA 1N8OC 1NRNH 1SGYE 2ZU4A 1JRTA 1LHCH 4B73A 2A4RA 1TPOA 1UTQA 1HAHH 3RUOA 4K1EA 1W8BH 3SZNA 5T6DA 1CA8B 4I7YH 1YPGH 2QV1A 1YLNA 2AFQB 3T27A 1UTJA 1JRSA 2B7DH 3VB5A 1PYTC 2OCVB 1FONA 2XBYA 2A32A 2BHGA 1NFUA 4CRGA 1IHTH 1D6WA 3NPSA 1EOJA 4A1TA 1DM4B 4TT3D 3GCHB 1XXDA 3ZZ4A 3A8DA 1E1RD 1K1LA 5EQSA 3PWBA 4NA9H 4K8BA 1BQYA 1O32A 2FOCA 4X1RU 1AIXH 3LGIA 2YOLA 2J95A 2ZDNA 3DCLA 1K1OA 2GVFA 1GL1A 2EEKA 1OSSA 2BDHA 5CHAB 3A7WA 4H6TA 2A7JA 5GIBA 3SU4A 4IGDA 4NIXA 4FOUC 3Q3YA 3LC5A 2ZU1A 1MTVA 5T6GA 2A7HA 1P09A 3SW2B 3E1XB 1BMMH 4RI0A 3SU3A 1MBQA 2ZQ2A 3SYJA 1Z8RA 3MU0A 2BD9A 2FX6A 2Z9GA 1OKXA 1F0RA 2XYAA 5L6NH 1C2IA 2XC4A 1EJAA 3ATMA 1BA8B 1GI1A 2JETB 2ANKH 2VINA 1ACBE 2WV4A 5HM2A 1NT1A 1KMHB 1WUNH 2XW9A 4Q2KA 5FX6A 2PKAB 1TYNA 1BUIA 1OPHB 1QJ6B 3RXHA 1P2JA 4OS6A 2OINA 4YTAA 4DOQA 1O3HA 2RA3A 3RC5A 1S0QA 2VGCC 3CENA 2G00A 2ZFSA 1QRZA 3EE0B 3SQHE 2GGVB 1MKXH 4ACAA 1GG6B 1L4ZA 1EAWA 5F53A 1ZTLA 1D3DB 1MKWK 2YMSC 4K2YA 4X1SU 2PWXA 1RIWB 2W3KA 3CP7A 1NU7B 2VB0A 1HRTH 3Q3KA 1MZAA 4X0WU 2V3OH 5FHTA 4Y0YE 4FVDA 2STBE 3SNDA 1A5IA 1AFEH 1EZQA 1FPCH 3GY8A 5LPRA 1LQEA 4WVPE 3V3MA 2OTVA 3U8RH 2Y5GA 1ORFA 1GJ7B 3TJVA 1AWHB 2M5TA 1C1TA 1DUAA 1Z8IB 4A1XA 5GWZA 3NXPA 1CT0E 1TA6A 5HIYA 1QHRB 1Z6JH 3SI3H 4THNH 1GCDA 1G2LA 1QJ1B 5C5NA 2AYWA 3QZQA 3F0PA 5CMXH 5A2MH 3BF6H 2EI6A 3M5OA 4X1QU 3ZZ5A 1GJ6A 3DSPA 1BIOA 1NM6A 3UQVA 4IC6A 3PTNA 1LKAA 2TGPZ 1SGDE 2BXTH 1ZHMA 1KTTB 3NKKA 3BG4C 2GV6A 5FL7D 3DD2H 1QB6A 1YPMH 4YESB 1C9TA 1O3AA 6LPRA 2VWMA 5FAHA 1C1PA 4O3TA 3GCOA 1HUTH 3EA9A 1TWXB 3FVFB 1SLWB 2ZFTA 1QR3E 1FIZA 1FAKH 2ZZUH 3QX5H 5K7RA 2PV9B 2RCEA 1C2HA 1E35B 2FP7B 3BG8A 4UFEH 2PSYA 1T32A 5F6MA 1S6HA 4KTCA 3LH1A 1BMAA 2GP9B 1C5TA 2G52A 1EPTB 4NIWA 3ZZ3A 5L2YH 3EQ0H 1QJ7B 1TNGA 1MQ6A 2CHAC 5C17A 2H9HA 1E1QD 3K2UA 1C2LA 1DS2E 1HCGA 5GCHF 4AX9H 3VXFH 2ZFQH 1ZHRA 1IQJA 3T2NA 1LHFH 3QWCH 3OAAD 3W95A 1RRKA 1QBNA 2SGDE 5E2OA 1MU8B 2BTCE 3ZZBA 3T5FH 1GI6A 4FUEA 1V2TT 2OC0A 4X1NU 1RGQA 5EJ1A 1Y3UA 4E7RG 1AVWA 1K22H 5DP6A 9ESTA 1SL3A 1MAYA 5F8ZA 4ABHA 1O36A 5T3HA 5LPEA 1VR1H 4Z1MD 1K2I1 5BRRE 1C5QA 3DUXH 4XD7D 1THPB 1FAXA 4CH8B 1GBFA 2ZNKH 2C3SA 3GOVB 2F3CE 2GCHG 2YNBA 1UK2A 5J4SA 2G51A 1T8NA 4JK5A 3M7UA 2ZPRA 1DXPA 1O2NA 2BQ7B 2CMYA 1D6RA 1HAOH 1JIMA 1P10A 3RXUA 4GHTA 1C4Y2 1PQAA 1L1GA 1KDQA 1UCYK 2ZU3A 1TBQH 2FOBA 1KXCA 5F8XA 2R3YA 4WH6A 2F9BH 1V3XA 1SGFA 3TLOA 1RTLA 2LELA 3ATWA 1RTFB 5HGGA 2VVVA 2PTNA 2STAE 4X6PA 1O38A 3QTOH 4BANB 2IJD1 1HAPH 1QL7A 3KQCA 2ANYA 2C8XB 1LHDH 2SGPE 1GVKB 1RS0A 4MPVA 1DE7H 3BSQA 3PRDA 3RXVA 2AGIX 1BDAA 1OS8A 2NU3E 3UWJH 5CHBA 4BTTB 4JYTA 3UR9A 1XUHA 1M9UA 2ANWA 1IQGA 2H6MA 3PLPA 1P2NA 3VB7A 2FODA 4FU8A 2AS9A 2GZ7A 1SGQE 1P2IA 1SOTA 2AMPA 3MO3A 4WMDA 3FFGA 3Q3XA 3F1SB 1L1NA 6ESTA 1A5HA 2W6ID 1BT7A 4LK4A 2NU2E 1GJ5H 3BTEE 1TGSZ 4K69A 3OTPA 4O3UA 3AVZA 4H42U 3GDVA 2PKSC 4AB8A 1COWD 4AGKA 2ZDKA 1HAGE 1DT2A 2GCHF 4BAMB 5E0JA 3IWMA 1XUFA 3KNXA 4Y71A 1BTHH 1XUKA 4Q80A 1LPKB 3OSYA 1ELCA 3UY9A 1DICA 2ZCLP 1NFYA 2XXLA 3H09A 4M9FA 2WV5A 4Y6DA 3IITA 1ANEA 3ZV9A 2XC0A 1HDTH 1D3QB 4ZMAH 2VH6A 1NFXA 1E36B 4JZDH 2DE9A 1K9OE 2A4OA 4OGXA 1W0KD 1WV7H 1A0LA 1P06A 5F8TA 2D2DA 3OFND 1YYY1 1DWDH 4X8UH 3M7TA 1O3EA 1UTOA 2BZ6H 2SGQE 1C2DA 2XBVA 3E6PH 4WWYA 2Q6GA 3NRLA 2R2WU 1GBBA 1GCTB 4WF8A 1S82A 5GNDA 1A5GH 2FOHA 3CS7A 3BEUA 2W26A 3E8LA 4BAKB 5GXPA 1V6DA 3D65E 4OS1A 1LPZB 4JZEH 2HNTE 3F3BA 1C1MA 3PB1E 3DHKH 4YO9A 3TH2H 4DIIH 1DWEH 1OXGA 3SGQE 1V2UT 2BD2A 2VIWA 4DJZB 3RXSA 3TK9A 1AUJA 1O3DA 3L33A 4NWKA 2V35A 7LPRA 5DG6A 3HKIB 4TPYA 1RXPA 4DG4A 4MQAA 1K1JA 3G01A 4IMZA 1Z7KA 4HFPB 2HRVA 3BG4B 1HJ9A 3O8RA 1PYTD 3SZEA 1QFKH 4I8HA 2FXRA 4AYYB 1QQUA 2LP6A 1NBMD 1GBJA 1YM0A 1UMAH 1TNJA 4UD9H 3MNCA 1O0DH 1YPEH 1YLCA 1TABE 4YOJA 1UVPA 3IG6B 2NU0E 1A0JA 1YBWA 1OP8A 2J5UA 1TX6A 2BY6X 3A84A 3OY6U 2B8OH 3JZ2B 3GCHC 2TBSA 1ESTA 2G8TA 2OBOA 3QGNB 3UPEA 2FOMB 1C1VH 2XNDD 2J9NA 4XBCA 2ODQA 4Q7ZA 5E2PA 1DFPA 1L0ZA 3BEFB 2PHBA 1P12E 4FXGH 3MQKC 2VIQA 3S69A 4B71A 1UTPA 3MWIU 4I8GA 5CHAC 3S9BA 1L2EA 2GZ8A 5FBEA 1V2NT 4JZ1A 4O9VA 5J4QA 3OY5U 4MLFB 2W7UA 5EGMA 2BVSH 3RP2A 2BLQA 2QXGA 2GDDA 2BD4A 1NRSH 4YLQH 3QGJA 4Q7XA 1SFIA 1O2SA 3P17H 3RXPA 4F49A 2JETC 4NIVA 3UNRA 1XXFA 2ZDAH 5AF9H 4UE7H 2ZQ1A 3KQEA 4FUCA 4LXBH 1S6FA 2ZPQA 1QL9A 1TNIA 3OEED 1ZPZA 1FNIA 1JOUB 2G55A 1ELEE 2WPIS 2YMSD 1B0EA 5C94A 4MNVA 3QDZB 3MYWA 1AHTH 3RMMH 2QF3A 3A8AA 4KELA 1GG6C 1C5VA 3ZVEA 5ABWA 1C2GA 3NK8A 3VXEH 2ESTE 3F68H 5FCRA 1ZMNA 4CBOA 1S85A
chains in the Genus database with same CATH topology
2QF0A 1RIWC 3SORA 3N7OA 1SGEE 3SV8A 1ARCA 1V2JT 1P2OA 3SN8A 1V2PT 1MAXA 4LOYH 1TX7A 1UK4A 1AQ7A 1QRWA 1O2LA 1H8DH 3U69H 2FM2A 4UDWH 1GVLA 3JZ1B 2XNIA 3P92A 1C5YB 3ODDA 1VCPA 7GCHG 1G3CA 1NTPA 1V2MT 1ZTKA 2BY7X 3RMNH 4ZHLU 4CBNA 1DPOA 2PTCE 4CR9A 1Y5UT 3UQOA 3I78A 2ZPSA 1O2TA 2J2UA 4X1PU 3ZZDA 1EASA 3TVJB 4X6MA 4BNRA 4D9QA 1KXBA 4X8TH 1Y3XA 5IYTA 2FO9A 3SJIA 2RG3A 4A92A 3KN2A 3ZZ8A 3P6ZB 1SHYA 1IQFA 4CR5A 1VCWA 1QA7A 3A7YA 2BD7A 3T62A 1EXFA 2A31A 2C8YB 2EI7A 1UTLM 2W5EA 1GI2A 1HIAB 4D9RA 3I77A 2IPHA 4IC5A 1GBDA 4IBLH 1YGCH 1LCYA 3A8BA 1H8IH 1O3PB 2F91A 4X2VA 1BTZA 1PJPA 3ZVDA 3M61U 2SGEE 1Q3XA 4R8TB 3M7QA 1EPTC 1AB9B 1AZZA 1C2EA 1EPTA 5LPFA 3A89A 3RXKA 1EAUA 5IDKA 3ZZAA 5ESTE 1TQ0B 1SGIB 3BIUH 3RU4D 1O5AB 2Z3CA 1Y59T 3P8NA 4ZKNU 3I29A 1O30A 1A3EH 3MNBA 3T25A 1AKSB 2ILNA 1GJBB 1K1NA 1TA2A 2WPHS 1HGTH 1SGFG 3SHCH 2OUAA 2XWBI 1TGBA 1EATA 4KP0A 4FUGA 3MOCA 4NWLA 1O3GA 2J34A 2O8UA 1ZMLA 3SJ8A 4U32A 1TNKA 1EZXC 1NFWA 6GCHF 3TK5A 1C1OA 1FN8A 2ZHWH 2HPPH 3QK1A 1MU6B 2OLGA 3GICB 2WINI 2FWWA 1E0FD 1GBLA 3SU1A 8ESTE 3RLYH 2VH0A 4TWYA 2ULLA 4OS4A 4JYUH 2ZHEH 1NU9A 4FUFA 4X2XA 1H1BA 3SU5A 3GYMA 1O3FA 1UTKA 1SQOA 4I8JA 3KHVA 1AVGH 3PYHA 1KXAA 1SOZA 3KF2A 3ZVCA 1HNEE 1GDUA 1F5KU 2H5DA 2Z6BD 1FY5A 4JZIA 4NFFA 1TPPA 3ENSB 2TPIZ 1C5ZB 1IQEA 1GBHA 2D1JA 1EAXA 3SGBE 2VIPA 2GCTB 1THRH 4PROA 1GMDF 1IQMA 3SV2H 1O2WA 4OS2A 1SQAA 1C5XB 1O2HA 4ISNA 2ZTZA 3AW0A 1XKAC 1YPKH 4FUJA 1LKBA 4DVAU 2ZCHP 4AORA 3PV4A 3ZZCA 8GCHF 5ETXA 2PR3A 2BLWA 2CF9H 3MFJA 5EU8A 2PSXA 1P2KA 3VB3A 1D9IA 1UCYE 3H7OA 4DURA 3AAUA 3BTKE 4BTUB 2QAAA 3SNCA 1LHGH 3HPTB 5DP7A 1XMNB 1EB1H 1LPGB 1ESAA 1SGPE 3OTJE 4B76A 4TPIZ 2VJ1A 2VWLA 5JB8S 2AERH 2TRMA 3A86A 2F9UA 1G3BA 3MNSA 4X6OA 2P3TB 3MO9A 4GAWA 4HGCA 1BTUA 2ZHFH 1BJUA 2XBWA 1LDTT 1EUFA 4NA8A 1UHBB 4NFEA 1YPHE 1SGRE 4VGCB 2A2QH 2QXIA 3Q76A 4GHQA 1FY3A 1SI5H 4J2YB 2A45B 1XM1A 3E0NB 3DFJA 3PLBA 4GLYA 2Y6TA 5A8XA 1TNLA 1T7CA 5C67A 1H9LB 3MU5A 1TONA 1GHBF 1DLEA 2CF8H 1EKBB 3LJOA 2O8WA 2ZGBH 3U8TH 1FLEE 1CBWC 3F9HA 1GCTC 4ZUHA 1E38B 2BQWB 4M7GA 1AE5A 6CHAB 1FJSA 1ZGIA 5LGOA 4Y8YA 3UFAA 2B9LA 2C8ZB 1P9UA 4K3JA 2FMJA 3SUEA 1IOEA 3ODFA 3W94A 1GGDC 2BDBA 3RC6A 2TGAA 1AGJA 2ODYB 4ZH8A 3NCLA 1MZDA 2YNAA 1CGIE 3TGKE 2UUKB 1OWJA 5GCHG 4FUDA 3ZYDA 3EA7A 3D23A 2BQ6B 1F92A 3RMOH 2ZO3H 8KME2 2C4FH 1DWCH 5A09A 4K1TA 2WPLS 1YPJH 1HXFH 1WU1A 1QGFA 2ZECA 5C1YA 1ELVA 1HAZB 4WMEA 3DFLA 1Y3VA 1TMTH 3LT3A 2Y5FA 2GD4B 3MTYA 1GJ9B 5E8EH 2FYQA 2P16A 3B9FH 2OP9A 1ZSLA 4NIYA 2FX4A 2GT7A 7KMEH 3RXCA 3TGIE 1GBTA 3SHAH 2BX4A 1GBCA 1SVPA 5EG4A 4DY7B 1P8VC 3M3TA 2A7CA 2H1UA 2V0BA 3ZVAA 1A1RA 4AZ2B 1C5OH 4ZKOU 4JYVH 1ZGVA 4U30A 3RXRA 3GY5A 1HPGA 3O8DA 1OYQA 3MH7A 5DP3A 4DGJA 5GDSH 4MNWA 2F9VA 2PW8H 1MTWA 1TX8A 3RXQA 1AMHA 3HK6B 5EXLA 1O31A 4E06H 4ZKSU 5DK1A 3LU9B 2C8WB 3RXMA 2H9EH 1C5RA 2TGTA 1QL8A 2FI5E 1Z1IA 1G37A 1O2MA 3VFEA 1C5NH 1WAYB 1BHXB 1JIRA 3M5MA 3FZDA 1TGCA 3LDXH 4A5TS 2BOKA 3BTFE 2G81E 5JB9S 4GSOA 4BXSA 2FYRA 4AYVB 4R0IA 1GBIA 2SFAA 4E7NA 1K21H 3TNTA 3SI4H 3SO3A 3RXIA 2OQ5A 2FI3E 2HWLB 4CRAA 3R0FA 3FP8E 2BY8X 2Z9IA 3TGJE 1ZRKA 4H6SB 3NZIA 2C93B 1E34B 2P59A 5JBAS 2ZDMA 2Z9JA 3TK6A 3ZZ7A 1ZJDA 1GHWH 3F6UH 3LGYA 3RMLH 3BTGE 3RXLA 4RSPA 1PPBH 1UO6A 1KSNA 1NO9H 1GHZA 2Z94A 4TY6A 2R9PA 3K6YA 1N6YA 4GVUA 2AMQA 1E37B 4XOJA 4U01A 2B0FA 1XVOA 5DPAA 2FS9A 1VITH 1C5MD 1KLTA 2DE8A 2Y80A 1O3KA 1NS3A 2ZFRH 3RXOA 3O8CA 2A1DB 1W12U 3SNAA 4MPUA 1AD8H 2OQUA 4ESTE 4BAQB 2P93A 3GY3A 3VPKA 2HOBA 1ZJKA 5EPYA 4XDEA 2BOHB 2FESH 1S5SA 3RM2H 1H4WA 1BBRH 1N6XA 1DXWA 2VNTA 3A82A 3LC3A 4GCHF 1NRPH 1GBEA 1O2RA 3RU4E 1G9IE 1IQKA 4Y8XA 1V2RT 3Q00A 1EZSC 2QY0B 2OC7A 1ARBA 4DCDA 1MD8A 4BTIB 1O3MA 1O5EH 4YZUA 2BDYA 1XKBC 3U9AH 1QURH 1ABIH 1DDJA 1FUJA 3A88A 3P8GA 5AFYH 2FZZA 1C4V2 1CGHA 1HIAA 1ABJH 4MG3A 4Z0KA 1AE8H 1HB0B 3ELAH 4FU7A 5E0GA 4F4OC 1BMLA 1CBWB 1HFDA 3P8OA 1AB9C 4I31A 1ZPBA 4X2WA 1OWDA 1KXEA 3CS0A 3TJNA 2HGTH 3EA8A 1KXFA 1QB9A 1SMFE 2XBXA 1IQHA 5LH8A 1TPSA 2A5KA 5H4IB 3RXFA 1J14A 1YF4A 3R3GB 1GGDB 1AKSA 2I6QA 1C5PA 1NN6A 1O2QA 1Z8JB 5HMAA 1C1UH 1P9SA 3A85A 1ELFA 2ANMH 2GMTB 1CHGA 1NZQH 1YCPK 2R0KA 2ZHQH 4NZQA 4WH8A 5GJ4B 4AN7A 1TRNA 3FAOA 2AIPA 1AO5A 1P03A 2TIOA 1NPMA 1SGNE 2XCNA 3RXBA 1RFNA 4H4FA 1F5RA 1QBVH 1A7SA 2P95A 4JZFH 2V3HH 4CHAB 1J15A 4ABAA 1A46H 2Z7FE 1BHXF 1C2JA 4JCNA 1O2XA 1W2KH 3GYLB 2ZDLA 3T29A 2ZU2A 1MUEB 1CQQA 3K65B 2ALPA 4CRBA 1GHAF 1O2JA 2AMDA 2ZA5A 4B2BA 1EAIA 3EYDA 3O8BA 2ZTXA 1L1JA 2Z3DA 1EP6A 3ZVBA 1IQNA 2Y81A 1A61H 1O2KA 3U1JB 5C3NA 4I8LA 1IQIA 1EB2A 1XVMA 1Z71A 2AIQA 1P02A 4AFSA 2FEQH 1FY4A 2GCTC 3E3TA 2LNCA 1KIGH 1T4VH 3RM0H 1TE0A 4NSVA 3HATH 1HV7A 3AAVA 3UUZA 5A8ZA 5DO4H 2FOAA 1ETRH 2W3IA 1Y5BT 3GCTF 2A4QA 1UCYH 3RXTA 1F0UA 4SGAE 2THFB 4K8YA 2OC8A 1ZLRA 1O5CB 1RJXB 2I6SA 4DIHH 4MTBA 3PO1C 3V0XA 3ZZ6A 2XCFA 1TOMH 2CJIA 1INCA 1NRQH 3ZVGA 1GVZA 2XWAA 2ZEBA 1TB6H 2J4IA 1UVTH 4XBBA 4CRDA 5TCCA 1GI5A 1ZSJA 3FANA 1NC6A 5A0CA 2ZF0H 1UHBA 1GDNA 1FV9A 4VGCC 2JKHA 4Q7YA 5TCAA 3TH4H 4HI3A 2PUQH 3E16B 1BRBE 4AFUA 1KTSB 4ISHH 2BDGA 2AH4X 1GL0E 3Q77A 3MU8A 5DKMA 3MH6A 1DSTA 3V7TA 1Z6EA 5EW2H 1GMHF 2BMGB 2QXHA 1TGNA 1W11U 1SLUB 3ZYEA 4FUHA 2PGBB 1TMUH 2GV7A 3VB4A 1O5BB 1W13U 1AZ8A 3SOSA 3PM3A 1MCVA 1ZSKA 3QLPH 3FZZA 1QTFA 1SGCA 3ATLA 1DITH 2Y5HA 3RXDA 4AB9A 1QIXB 1TALA 1PPCE 1A0HB 2UUYA 2V6NA 2SNWA 2SNVA 6CHAC 3RXAA 1AU8A 1WYKA 2GZ9A 2P8OB 4XE4A 4Y0ZE 1SQTA 1O33A 4CRCA 1AFQB 1A2CH 2R0LA 3VEQB 1C1SA 1G3EA 1TMBH 1NY22 3K9XB 2PFEA 1O5GH 3QN7A 4ABGA 2ZFPH 1O3LA 2G5NA 4ZROA 4CRFA 1ZMJA 4ISIH 3L6PA 1HAVB 4A7IB 3KCGH 2IJOB 3TPIZ 4YOIA 2F9PA 2AEIH 2QA9E 3E0PB 4A1VA 1B0FA 3KL6A 1UTNA 2D8WA 3PMBB 1WTGH 1SB1H 3HGPA 3GDSA 1P3EA 2P3FH 1ZHPA 1WSSH 1D3PB 1K1IA 2XTTB 1ESBA 6GCHG 1VZQH 3S7HB 3UNQA 3V12A 1ZR0A 2F83A 1JBUH 2R2MB 4YLUA 1O3IA 3URDA 1N1LA 1TRMA 2BY5X 2J92A 1MKXK 1O2IA 2BD5A 3GY7A 5EQRA 2Z9KA 3D62A 3M5LA 1XUJA 1TBZH 1WQSA 1CT2E 5DP8A 1EX3A 5G4BA 3U1IB 1O37A 1W7XH 1J9CH 3SNEA 3MU4A 1GMDG 1QB1A 1VGCB 2BLVA 2TGDA 1GI8B 2J94A 1J17T 3H5CB 1G3DA 8GCHG 3TJOA 2BY9X 5JBCS 1F5LA 1ZRBA 3SV7A 3ZZ9A 3HKJB 2GKVE 3SV6A 4YT6H 2ZU5A 1T8MA 3KEEA 2O8MA 1KLJH 2H9TH 1H9IE 3C1KA 1GWAA 4RKOB 1ELAA 3P8FA 2SGAA 3A8CA 3SBKA 1LVYA 4AFQA 1C1RA 3EGKH 3P95A 1GJAB 1HAIH 4E05H 1J16A 5I46H 4O97A 3PLKA 4TY7A 1BJVA 1HJ8A 1WCZA 3LIWA 1D4PB 1JMOH 3OX7U 3P70B 2FOEA 4UEHH 4JMYA 4KTUA 1SFQB 1MMJN 1AWFH 1P3CA 2GDEH 2QC2A 5A0AE 3UR6A 3S9AA 1G32B 5C20A 1GMCG 3UTUH 1DY8A 1ELGA 2GX4A 1ELTA 1C2MA 1GHBG 2Y7ZA 4ABIA 4SGBE 1O5DH 1EQ9A 3PMHB 1UVUH 3S9CA 3SUGA 5SGAE 2HLCA 3LGUA 2AGEX 3A81A 1BOQA 4ASHA 1XX9A 3PO1B 2W7SA 1O2YA 1ANCA 1O2GH 1PQ7A 1X7AC 2BM2A 2Y7XA 1F2SE 3FP7E 3A83A 1KXDA 4WJG2 1LVOA 1NESE 3MNXA 3TU7H 1BRAA 1P57B 4I33A 1GJCB 3F9EA 4ABFA 3E91A 1DANH 5JBBS 4U2WA 4B1TA 2BXUH 3BTDE 3DT0H 1P05A 4BAHB 1CE5A 2OXSA 1CA0B 1PQ8A 1SBWA 2HNTF 2WPJS 1XUIA 1YCPM 1UVSH 1V2QT 2VIVA 3AW1A 4D8NA 1O34A 2ZTYA 1OP2A 1A4WH 2J38A 1PFXC 1DLKB 1ZPCA 4HTCH 3SQEE 1Z8GA 3OU0A 4KGAA 2A5IA 1O2ZA 2G4TA 1GMCF 4BXWA 5EODA 1P04A 2ZG0H 2XRCA 2UWLA 2UWOA 2ZWLH 4B74A 3SV9A 4X8VH 1FMGA 1BCUH 4LZ4B 3BTHE 2BDAA 5CE1A 2F9OA 1IAUA 1PPZA 4OGYA 3MHWU 1TGTA 3AASA 5AVDA 1LVMA 1UJ1A 2BDCA 3KGPA 3BTQE 1W0ZU 2RA0A 2VIDA 1Z1JA 4MNYA 4RKJB 1LHEH 1TNHA 2OC1A 1D3TB 2VVUA 4XBDA 1ZOMA 4ZHMU 5EQQA 1HAYB 1PPEE 1QY6A 2GMTC 1OWIA 5EOKA 2UWPA 2JH5D 1K1PA 5DGJA 1GBKA 1F7ZA 3MMGA 3LGTA 1W14U 1CVWH 5C2ZA 1BBRK 1WOFA 2FI4E 5DJ7A 4FU9A 4D7FA 2R3UA 3PWCA 1SHHB 5EPNA 5AHGH 4CHAC 3STJA 1YC0A 1CO7E 3F9GA 1ETSH 1BB0B 2CN0H 2GTBA 1QCPA 1VITG 2VWNA 1HJAB 1GI9B 2ZDVH 1Q2WA 5C5OA 4I8KA 1C4U2 2JH6D 3KQDA 2O9QA 1O3JA 1ID5H 1TOCB 5JBTA 1BTPA 3GCNA 2G4UA 2GT8A 1KYNA 4BAOB 4X8SH 2ZGJA 3C27B 5EW1H 2ODPA 1GHYH 2FDAA 1LTOA 3M3SA 3KIDU 1YKTA 1S83A 1CGJE 1TRYA 1XUGA 1JWTA 1B5GH 1MTNB 2PGQB 1GJ8B 1LQDB 4AG1A 1RTKA 1ELDE 4RN6A 1V2VT 2Q6FA 1P2QA 2BD8A 5E0HA 4Y7AA 1C5SA 1Y5AT 4B2AA 4K5ZA 1OP0A 2HALA 2XC5A 3MH5A 4AGJA