3SO3C

Structures of fab-protease complexes reveal a highly specific non-canonical mechanism of inhibition.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
225
structure length
220
Chain Sequence
EVQLVQSGGGLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCVKDLGIAARRFVSGAFDIWGQGTMVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDTKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A reverse binding motif that contributes to specific protease inhibition by antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Suppressor of tumorigenicity 14 protein
total genus 41
structure length 220
sequence length 225
ec nomenclature
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3so3C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3so3C01
3RVXC 1PGRB 3T65B 1ZA3B 1ZOXA 2BNRD 3K2UH 1HYSC 3H9ZA 1CF8H 3CNKA 4ORGA 3D69B 4KQ4H 4N0YH 3VW3H 2NLJB 3LZFH 1RHFA 4XPFH 3BEVA 4M6OH 1KTLB 2MFNA 1JF6A 3RZCD 5LGJB 3M8OH 1UWEH 5ENWA 4WHDA 1K9TA 3PDGA 2C4FT 3OZ9H 2WAHA 3NFSL 2JK5B 5HI4C 1I75A 4KMTH 4ZOEA 3H9YA 4JZNB 3IAGC 3QO0B 5CBEA 4EOWL 2Q1EA 3MCG1 2A9MH 2ATKB 3ES6A 2XRAL 4GMTL 3E3QC 3C5JB 3QXUA 4ZFFB 1D5BA 2VXTL 3B2VH 4BZ1L 2X7LB 4J1UA 3KPMB 1XMWA 5DFTA 4P5MA 2X4RA 1WZ1H 3QPXH 3HA0A 3TZVA 3QCVH 4LVNC 1U95B 1CYGA 3S34H 5E9DB 1S9YB 3DURA 5C3LD 2A6JA 1OM3H 4OLXH 1KJ2H 4FQHA 1OAZL 4KRNA 3CLEL 4MS8C 4U1JA 3I2CL 3PWLA 5DEFB 3BOVA 5AYUH 1TFHA 5GS0D 3RNQA 3FN0H 4IS6A 1WJ3A 3D0LA 4GG6A 1F4XH 3BZ4B 3WKML 2OCFD 4W4NA 1W0WB 3VCLA 5I1LA 5JOEA 3CD4A 4N1EA 4OTXH 3H7BA 3HC0A 5KN5A 1O0VA 3IXAA 4FFYL 3WIIL 4NSKB 2JIXD 3VMNA 4IRJA 2HT4D 4OCRH 5CWSA 1SYVA 1HQRA 1KLFA 4MB4A 4C83A 1N59A 1DN0B 4OUOA 4ZTOL 2CH8A 3GIZL 3QEUA 1YN7B 5E6ID 2V9QA 5DWUL 2FR4B 3UTSD 1S9WA 5DRXA 4OLVH 4PJFB 2GTWB 7FABH 4XCEA 3MFGB 3LS5H 4PJ8C 3HZMB 3WO4B 3MV8B 3S37H 5GRJL 32C2A 4MXWL 2J1KA 5EOQH 1VB9A 1A6PA 1PKQA 1IBGL 1P7QA 2DTML 4NRXA 3INUL 4L9LC 3HE7D 5IM7B 3GI9L 4NQXA 3U0PB 4PGEB 4XRCA 2X1QA 3AGVA 5CP7A 4C55A 5JPNB 1TIUA 1MUJB 4JPIB 1WT5C 4UDTA 4NBYB 2HVJB 4KHTH 4D0BB 4X6CB 3QYCA 1Z9LA 5JIIA 1MHHA 2Y06L 4HUMB 3IRPX 5FYKH 4TPRH 1INDL 3VXUD 2DD8L 1QNZL 4XC3L 1BM3H 1CFSB 4U1LB 4AG4L 1Q9KA 1C5DB 1MCRA 3PQYB 4Y5XB 3VXRD 4RGOH 3ZDXE 2FBJL 3QDJE 43C9A 4WY7H 5DMJB 4NDMB 3DV6A 5J8OA 4O9HL 1CCZA 1KN4H 2AEWA 2FLRT 3W0WE 4AENA 5DJ0B 1D6EB 4KRPB 5F9OH 2AJ3A 1YNTA 4KZEH 1K3IA 1LILA 2VN4A 4CNIA 5I0DA 4OF3A 2EDJA 3HE6B 1T1YA 1MCEA 4PJEA 3HMXH 2AW2A 1QFWL 4QYOA 4S1QL 1RUAL 1W0VB 4JFFB 4XWGH 4YHPB 4GXUM 3CZFA 3HE7B 3O6ML 3TIEA 1FZKA 4QRSB 2NY5H 3ZHKA 3QO0A 3CUPA 1DEEA 4WWKB 1MY7A 2G60L 5C6WH 3W82A 5DD0H 2DRUA 2GFBA 4W4OC 2LE9A 1GIGL 3EFFA 5DRZB 4DKDC 4LARH 2ADFH 4PLNC 1MPAH 4PJ9D 2OZ4H 5FO9B 1K2DB 1F58H 3HAEA 4O2CA 4HUVB 3WUZA 3HN3A 3T8XA 4I3SH 3BJ91 1DBBH 3HE6C 3H42H 5CCKL 2NY2B 1I8IB 3FRPA 4EIGB 3RVXD 2ID5A 4PRHB 4YAQA 3IAQA 4L8SC 4R4FL 4M93B 3VXMB 1JGUH 1J0HA 2SEBB 1MI5E 3EDKA 3Q6GL 5JW5A 4MAYB 3IGAA 2D4FA 5D71L 3QDGD 4YHYB 5HHMB 4X7EC 3KPPA 1K4CB 5LCVL 3ZE1E 1MAJA 4OZFG 4ZODA 3DMMD 5IBLD 5C0CE 4DZ8B 4PUBH 1DANT 1Z0MA 4Z7WE 5GZOD 4N5UA 4FNLH 3WFBL 4FXLA 2ZSVB 2IADB 2YD4A 1CZ8H 3EO1B 3SPVA 2OZ4A 1ZVYA 5ALCL 4YIQA 2BNQD 1S7XA 3KGRA 3B4NA 1A7QH 1QBLH 5C86A 2NY4B 2DF3A 5HD8D 3GSNH 3TO2A 3EIFA 3O41B 2XWJB 5FDWB 5TQ0H 4NQCB 1RIVL 1PY4A 4YE4H 3PIQA 2CDFB 2DQDH 1AXSA 2FJHB 2FHBA 3F7QA 1LEKA 1XEDA 2V2WB 4Y1AA 2HT2D 5F7KC 2AJYH 1QRND 1BBJA 5E6ZA 5CINL 5CIPB 5C0GB 2Y5TB 2F58H 3JV4B 1OB1B 4LCWB 4F8QA 4G7YL 3SDDB 3OX8A 2ESVD 3LH2H 1U8MA 1T20B 4KI5D 2AV7B 5GS0H 2JCCE 2Z91A 5J6GB 2WSKA 4JJ5A 3O45B 3U82B 4OZFB 3DVGA 3FONA 4JZOA 2JK5A 1HSBB 1WBZB 2YD3A 1IAIH 2IFFH 4WI5A 1FN4A 4X7DC 1KPVB 5JDJA 3VRJB 4PJXE 2YPVH 2HKHL 4Q9RH 1PX4A 2XACC 2FEDD 3MRQB 5FYJE 1KBGH 5EBGA 5EOCJ 4XCEB 5T1KB 3TVMA 1S9XB 2H2PD 1NLBH 2Z8RA 3HZVB 4MJ5A 3QG6A 2AEPH 5HYFA 1QR1B 5C0IA 2PYED 1SBSH 3ARUA 1I3RA 2A6KB 1R3LB 4YZFE 5FO8B 2A1WL 3OJMB 4LPWA 2NZ9C 3G6JA 4IIQC 5DRWB 1TMCB 2YC1B 2FO1A 1NJ9B 1ES0A 8CGTA 1SJHB 2FDBP 3SE3A 3GSOB 3AREC 4M7LT 4QOKB 4WCYL 4JGJA 5GS1C 2VL4A 3PL6B 4W81A 2NXZB 5E8NB 1TITA 4HWEL 5I1LB 5D8JL 5HHNB 4DGYL 5TDNB 1UVQA 4LLVA 3L9RA 5ESVA 4K2UL 3MLPA 3EOYG 1IQWL 4YDVA 1EZVX 4OD1L 2R4RL 3LKSB 1IC5H 2VDNH 5C0CB 4LP5A 2OJZL 2OS7A 4M48H 2VUYA 1NCCH 4OZ4A 3HNVH 1IEHA 3H3KA 5ADPL 2E5EA 1PG7X 4P46A 3VFMB 4PP1C 1YEDB 3ARDD 5DVNA 4R7DA 1K4DB 5IB4B 3MO1B 3CGTA 4WI9A 5HY9B 4XNMA 3TBWA 4PJFF 1OGAE 1J9CT 1KJMA 4YK4B 1U93A 1NEUA 2CSPA 2A83A 1MCCA 3EAKA 5IVXF 3BWAB 3LH2L 2B1AH 4HS6B 3SGJC 3ARBA 3GMOA 5LGHL 2ZUUA 1J12A 2IH3B 5CHNA 1MVUB 2W0KA 4JO2H 3KPLA 1DR9A 3UCRA 1B4JL 4N9GB 2E9JA 3WLWC 3WFHB 3FO2A 3MR9A 5KVGH 2FL5B 2HTLC 1HI6B 2AJYL 3R1GL 3KPRA 3HAEB 2EYRA 4KY1H 1LD9A 1VGKA 4WUUE 5T1KA 3MZTA 4KROD 4WHYG 4AL8L 3RBGA 1FSKC 2OR7A 3NIFF 1IM9A 2B20A 4JEGB 5T5FH 5IR1A 2VDQH 3BUTA 1LO3H 3N1PC 1TPXC 2AJXL 3QUKB 1K3ZA 4MAYD 1C7TA 5DK0B 5IB2A 4NQEE 5E2TH 1YECL 2YRLA 2YZ8A 3O4LB 3QUZB 4AEIH 5ESQA 1KCUL 5E4EB 4MDIA 2J4WH 3QI9D 1B9ZA 4JJ5B 1BEYL 5FM5M 3PDOB 4GLRH 3RU8H 1CGUA 4GS7C 4RMSA 5BZDA 4NNXA 4JFQA 3RDTD 2BVPB 1NUDA 5D7IB 1JF1B 4O2EB 1NGQL 4MHHI 2NY1B 4LAJH 3D9AH 3Q6GH 1YPZA 5CP3A 3NZ8B 3L7EA 3P3YA 4OUUA 1P5VA 4X9IA 4L5FL 1S5IL 4ONFH 4GW5B 3EOTH 3PWUA 5MHSD 3RGVB 1C5BL 3BO8A 4S11A 3DYMA 3OXSA 4N0FB 5JNYA 3G5ZA 1PSKH 5I6XC 4Q6IB 5GIRA 2NR6D 1SEQH 2VTFA 3DXAE 1RK1B 3X11A 5LWYL 1R24B 1N0XH 5I71C 1I8LA 1MEXH 2NXZD 2OTWA 3MV7B 2DYPB 1RIUH 4G9FD 3T3MF 1CLZH 4QOKD 3C8DA 4L8BA 5CGYD 1ZGLP 4YUEL 4JFEB 2HLFC 4HKXA 1JNNH 1EPFA 4DN3L 4F7MB 1JPGA 1P4LA 5IP4A 1DQQA 2NY5L 3PQYD 3VXRB 3C5SA 3OJVC 3VMOA 5C6TL 5DURB 1I8MB 5TH2B 1XZ0B 3X3GL 3V4UL 1XF5B 3KG5A 2HVKB 5KOVC 3MLWL 2DBJA 4OJFL 1DQMH 4MJID 4M43H 4PBWD 1FN4B 4Z0XA 1G9NH 5SV3A 4LNRA 5I76A 3MRKB 1A5FL 4PD4K 4Z76A 4O9HH 4OQTH 1NBZB 5EO1B 4FQXC 2NCMA 4JG0L 3O3DA 2VIRB 1J1XL 4J12A 4F37K 3LKQA 4BQBA 3IFPB 4BH7A 3K8LA 4OFVA 5EBWB 2V2TB 4XC3H 4JAMB 1QNZH 5EU7C 1UZ8B 4LHUD 4I2XB 1NMBL 4QXGH 3ZE1F 3OHXA 1Z5LB 3BPLC 3JV4A 3BP7A 1P4IL 4O4YH 1A6AA 3PHOB 3CVHH 1U3JA 1CXHA 3CZFB 3HE7A 4MDJA 4M61A 4DKFL 3O6LH 3RZWA 3VWJB 1OPGL 2D4DA 2JB6B 2NX5A 3W0WB 5CJ8A 3ARGD 2J6EL 4ODXA 1ZEAH 4IJ3B 5HYIA 2P43B 5LKNA 2DTMH 4HV8A 4MXWH 5D7JA 5JHDD 3B3IA 5F9WB 3MRNA 4U31A 1CICA 3HZKA 4G6KH 4DFIA 2VJXA 3QHTC 4HZAA 5FO7A 3QXAA 3IJSA 5HHPB 1ZHKB 3RY6C 4PJ5A 7FABL 5LVEA 3I50H 5C0AD 1J0YA 3QQ9D 1OAXH 2P5WA 3CCHB 1KXTB 4UU9B 1DDHA 4GRWB 1KGCD 1XF3B 2FCBA 3PL6A 4EJ1C 4ZTOH 3ZTJH 3PWVA 1K5NA 3KHQA 3L3GA 3DUSA 2ZUSA 5FOBB 2DM2A 1BZQK 4B50A 1AGFA 2WUBL 4BUGA 2HFGH 2FJGA 4NM8L 3ARQA 3ESUF 2DWDA 4GAGL 2E3VA 3KLAB 4MD4A 2YN3A 4E42B 4QO1A 1VFUA 4RAUB 5KJRL 2M8XA 3N0PB 3NIFE 5AYUL 1IRAY 1KG0A 5L2KA 4Y16D 3DSFH 3I3BA 1AXTL 3WO3B 1OAZH 1A7PL 4L4TB 4NP4H 2VR5A 4OCWH 4ZUSB 4JM2A 3RWIA 1MJJA 4M5ZH 3B9KC 3DGGB 1FG2A 3PNWB 2FECL 2VQ1A 4N1CA 5C0DA 4FXGA 3RI5K 1Q9LB 3WUWB 4QRRA 1F3JB 5FA3A 4JQXA 4MJ6B 5HHOB 4FTVE 4EOWH 2BNRB 1C08B 4NN7C 1I7ZA 3DROB 3RZCA 4KMTL 5F3HB 1F00I 1NAMB 1EAJA 4QHKI 3LQAC 4H8WC 3MV9E 3NIDF 4JY4B 3QDJD 2EDLA 1UWEL 1NFDB 2BSTA 4DAGL 3KJ4B 2YN5A 1QO3B 4P2OD 1HK6A 4ZNEA 4KQ4L 4N0YL 1NC4D 4YEEA 3RWHB 2XN9E 1CF8L 5MEQB 2EYTB 5DQDL 3HR6A 1ZT4A 4M62H 2EDEA 1FVDA 2G5BA 4QRRD 3TA3B 1MHEB 4PG9A 2GJZB 2EDOA 3BP5B 4NO5A 4XBPA 3FO9A 1ZLWH 1XGUB 4PJDA 4OZHF 1UZ8A 1UA6L 1F3DJ 1X5IA 3LSOA 4JM2D 2HJLB 4LASL 4ZS7H 4QTHA 4HIXH 4TSAH 1I3RB 1PVHA 1T22B 5D2LB 1TZIB 1CLYL 2XWTA 2BHYA 5D1ZD 3MOAL 5GQBA 2QSVA 3VXPB 4OGYH 4GG6F 2I26N 4AEHL 3CVIH 4PLKC 4ZO6A 4LU5H 3CFCH 4HWBH 1CK0L 4I5BA 5HVHC 4LLMB 1IM9D 4K8RC 1LD9B 3C5SB 2RQ8A 2ZCHH 1KN2L 2XZQL 5BVPH 4MJ4A 1QLRB 3GK8H 3LRGA 5C0FB 15C8L 1XGRA 4FQ2L 3UYRL 3HNTL 4F8TA 2OR9H 3CX2A 4LRNL 1JNLL 4UQ2B 4Z18A 4XVUC 2AABH 2UZIL 4NGHL 2DYPA 4WDIB 1PLGH 1MREH 1T7WA 5C0AA 4PB9L 1MWAL 2X4OA 4A2LA 1CL7I 4CW1A 1MFDH 4Z7UA 2JCCB 3IJYA 2P49B 5CUSL 4ZYKB 1T7XA 1FBIH 1TVDA 2B4CL 4XPGH 1P9MA 1MQ8A 3I3DA 4JFXA 5D1QB 2Z35B 4PS4H 1D5ZB 3V4VH 4PJAA 4KKCC 3OR6B 4PPTA 4M93C 1UWXK 2NW3B 4P46D 1TZHA 3GBNH 4G6FB 3GO1H 4JDVB 2ESVE 5F8RC 5E9DA 5BRZE 4LLDA 4XTRC 1ODAA 3AMKA 3WFCL 3WIFB 1RIHL 4NKQB 1ZANH 4G43A 5E24E 3VFGL 3WHXB 4GUPA 3RA7H 4NWTL 4CU7A 1UM6H 4NQDB 2VXUL 5FA3B 2C3VA 4LHUA 1QLEL 4J4PA 1TJIH 4NZRH 1MOEA 3KPQA 1G9MC 4Y4HD 2YD9A 2EIZB 4OI7A 4UDTB 4HWNA 4XMKH 4N8PA 3MUGB 3O8XD 4JHBA 4OIIL 5C92A 5INDA 4UT7L 4W68A 4XXDA 3IFPA 3TIDB 3A0OA 3KJ4C 2VIRA 2QQLL 2OR8A 2WWMC 2LAAA 4QF1A 2WQ8A 1DLHB 2APXA 3QDGE 1BWMA 3SHSA 1U3ZA 4HWZA 1UJ3A 1OP5H 5IW6A 4Q2ZA 1EZVY 4NNYA 4AQOA 5KANG 3E0GA 3MV11 4HWUA 2HVKA 3OKOA 4QXWA 1IGYA 5CZXD 3HZYB 3MRBB 4WO4B 5JOPD 4KRPC 3HCVA 1MJUH 4QLRA 4LSSH 2EXWD 1KNOB 2XKSA 4P2RD 3A67L 5BOZG 4EDXA 3HPLA 5F1NB 3OKMB 2OSLB 3B9KB 3EFDL 4HX1B 3QDGB 3PWPB 1TCMA 1DBKL 1D9KA 3I75A 4M3KB 5HVGB 3FT4B 1A4JB 2D3VA 3FQNA 2F19H 1JPST 1EUUA 5IESH 3ARRA 4YGVA 5EU7E 4HC1H 1ZVHA 5KN5B 2Q87A 1QBAA 3EBAA 4HCRA 3D48R 1IT9L 2VL5B 5EIIA 3GSWA 3QQ9C 5E8PB 4DKEL 3UYPA 1B2WH 2Z31C 3LHPH 3D0LB 4GG6B 1QRNA 5EZOL 2E7BA 3LQAL 2YPLA 3PABA 5J1SC 4NDMA 3MACH 5E2UH 1JGVL 3FO1A 3UTTA 1LE9A 1AGBB 1W72B 2PO6C 4XHQA 1NFDA 4LBEA 3CXDL 4PTUA 2IAMC 1LO0H 2JB5L 5J11B 4NOBA 3ABZA 1AI1H 1D5IL 2D7MA 3QQ3A 1GRWA 4NQSA 3KPNB 4DN4L 2X9WA 4YHNB 2X70A 3JZ7A 2DQGH 1S7VA 1B0GB 4Y5VA 1KB9K 3JTSA 1CGXA 1BQUA 4G5ZH 2X4RB 3P9LA 4X5WB 2X4OB 4Q9BA 3QI9A 1WTLA 1U92A 2QQQA 4F9LA 3WIHL 4HK3N 4HUKB 2NY0D 2AJZA 1X9QA 5IBUG 4ZQKA 1NMCC 1S78C 4G6JH 4JKLA 4OSUL 4XCNA 1SJXA 2NY5C 3QEGH 2ORBL 2CUMA 4LCIL 1NBZA 5EO1A 4ZG1A 4RIRA 2CDEB 4Z7QF 3B9EA 4RMRA 1D5XB 2XZAH 4QTIH 4J3UA 1XF2B 3ZTNL 2E7LA 1FNHA 2H6PA 3O9WB 3P0GB 2PXYB 1AHWC 3HUJA 4LLMA 2ZG2A 4J3OC 3FB5A 3BEWB 4JVPA 3DX9B 3UDWA 4OF6A 5D5ME 4IRZL 3IB4A 4NKDB 3VXPA 1MRCH 4C54A 1G9MH 4U6HB 2DJSA 3V6OC 2J8UA 2AI0L 2DWDB 2EICA 1G0YR 3HMXA 3GM0A 5E2WH 2WIIB 2XTJC 1P53A 3CFEA 1DCLA 4URTB 3AREA 5EC1B 5DMKB 4CN1A 3MC0A 1G6RB 5HDQL 2NPLX 3H9HB 4UV4L 3ME0A 3MCLL 4D8PA 2W91A 1J8HE 4DEPB 4PG9B 2D7TH 4S10A 1NDMA 3MUZ1 5J3HD 3EJZD 1FVDB 1DZBA 5JLZA 1YJDL 3BN9C 4MQXD 2EYTA 1WWWX 1AXSB 5E8DH 3WL9A 1FL5A 3U4EA 2DMCA 1YDPB 4P4KB 4M6NH 2EDFA 4P5KA 3H9SD 1NMAL 4BUHA 2EIEA 3N50A 3CDFA 1NUGA 1S7XB 4EDWL 4FZ8L 3QNXA 1A7NH 4N9OB 2FYYA 1OQXA 3MFFB 1C7SA 3CFKB 3HPJA 3WEXB 1P2CA 3PWPD 1WV7T 5F9DC 2BJMH 1ED3B 2QHLA 1ZS8B 2NMSA 3O8XA 3FO0L 3FT2A 3ULSB 2VDMH 1PG7L 5DLMH 1FIGL 1L7IH 3KYAA 2X4PA 3G6JE 4M4PA 5H94A 1C12B 4HBCH 4I4WB 3QJHB 5HHOD 4F2MA 4J3SA 3S98A 4UQ3A 1I7TA 3CX5K 3O2WH 2X44D 1EV2E 2B4CC 5BQ7B 2HMIC 3RHWK 4OB5H 1KLGB 5E1HB 4GAYA 4JFPA 4ISVA 5IFJB 1LO2L 2JJSA 4XT1C 1QA9A 4R97B 5MP6L 4TUJB 4H26B 4Q2ZB 5E9DD 5D7JC 3ZKMD 4I2XE 3L3OA 3JWOH 3MQIA 5FUOH 2BY0A 3ZT5A 2EH8H 3A6OA 3CFJA 4HXAH 4PJHE 1HOCA 2CR3A 1WAAE 1UKQA 4YK4C 3THML 1UYWH 1XF4B 3MCLH 1FZOB 5BJTA 3NCEB 4NWUL 4GRLA 4P9MH 3RIAK 3T0DA 5DO2D 1OARL 1KOAA 4HFWA 1DN2A 4TTDD 3U46A 4NCC1 3KPQB 5E4EC 3MROB 3ELAT 5FB8A 1KJ2A 2PW2B 4MNQD 3LKPA 4Z95L 1JPSL 3BWUC 3RTQD 5TGBB 1VKXB 1CBVH 2JKXA 4H8WL 1FSKB 4L29B 2DQJL 4Y19D 4OBSA 3TWCL 2VSDA 2PNDA 4LKXA 2WV3A 5IFHH 4N8VG 3NACH 5KS9E 1OP5K 3W39B 4NPYB 1OWRM 4ETQA 4LSQL 4P4KC 4ELMA 2XZAL 4QTIL 5AZ2L 1LEKB 5IF0B 1KCKA 5E4IA 3EYVB 4U6VH 5FDWA 2VWEE 4LCIH 1YEHH 2W92A 4PJAB 3KWWA 4U0RB 3SOBH 4ODTH 4GBXA 1MNUL 4Z8FL 5E99H 4IMKC 4RMQA 4NN5B 1R0AH 2CIIA 3LN9A 2X4SA 2D03L 4MA8H 3K7UA 1FCGA 1JZ3A 3QJFA 3EO1A 3SPVB 3TJEH 3GDBA 3BZEB 5I1JL 3QP3A 1A2YA 3K1DA 3VXME 2R8SL 2JB5H 2RBLA 3E6FB 3FQNB 4J7RA 1I8KB 2DOCA 3OXRA 3E6HB 1R3JB 4YDIH 2P8PB 4WEUD 3BP6B 3LHPL 4GW4B 1UWGL 2GUOB 3BXNA 5DK0A 4L4VA 3OJDB 2PXYC 3LOWA 2FH6A 2ZNWA 1C16B 4NKDA 2AQ2A 1RUPL 4MD5B 2Y23A 2FD6L 4P2OA 2QHRH 1YPZE 3ULUF 4XVJL 4MA8L 5DJYB 4J6RH 3VGAC 3SN6N 4G8GE 1CN4A 4JDTL 2H2PC 5F89B 3O3BA 1NEZA 5IW6B 1TTFA 4Y4FA 4OFYA 5E99L 3P73B 5GS1B 2BSSB 3RVUD 5F96L 3BPOC 5TDOB 3WNPA 3SDDC 4L9DA 2IH3A 5JIHA 3NPSC 3WFDH 4ENED 3BWAA 4QRPE 3LMJL 1U92B 2O5ZL 3RFZC 2R29H 5DDHA 4HPYL 4F9PA 2I9TA 4YHNA 1FL6A 1FC2D 2MNUA 1CFTB 3KS0H 2KZWA 4H8WH 1ND0A 4G9FB 4IOIB 5DD6A 4NQDA 1WCBB 1K6QL 3U1SH 3JV0A 5D1ZB 1WVZA 3QDJB 5ACZB 3TBYA 1A4KA 2O26U 3CFKA 4QHLB 4OIIH 4OZ4B 4GRLC 3QWOB 4JANA 1MCLA 4C59B 4IRJC 1QYGL 3F7PC 2KL6A 3GSWB 4WU5B 4X6BB 5EBLB 5HHXL 3MBEA 4TVPE 3F5WB 5I8KL 1NCTA 4E41E 2BVPA 1DUYA 2EDNA 3C6SB 1CGSH 1TJIL 2V7HA 1HSAB 4K3DL 3T0XA 2L7JA 4JHWL 4WV1B 5K93A 4NWTH 4E41B 2EZ0C 3B5TA 5BW7C 2YR3A 1ZANL 3SDXB 4I9WE 1WSST 2F5BH 2P5EB 3PWJB 1YMME 5EC2A 3ZKXB 3SDYH 4OI8A 3N1MC 3U46B 1LO2H 4TUKL 3PL6D 3HPLB 5I9QB 4LPUA 5DEGA 3LB6D 1Q0YL 3UZEA 5EUOB 3VXSA 5ENWB 1AD9B 2AJVH 2GITB 3LKQB 1E4KC 1FIGH 1PG7H 2HG5B 4P23D 3UTZA 3DIFB 3UAJD 5EB9A 4TUJA 4EVNA 5MERA 5IMMA 1GVIA 1J0ZA 5AWNL 1MIEL 1MCSA 1MFNA 5HGAB 1XF5A 3B5GA 2R15A 3U30C 5IVXB 1MWAH 3BEWA 3MYJA 3T2OA 3VI3F 2P46B 4JRXB 4Y5YA 2PXYA 2BMKA 2IAMA 4FZ8H 4YHLL 4JKWA 3EO0A 1VADB 1HH6A 1S9WB 1SBBA 3RKDC 1KPRB 15C8H 4F7MA 3IKCB 3S96B 1KN2H 2X4QB 4JM2C 1ED3A 3EHBC 3BKJL 4K55A 2XXCB 3BGMA 4XAWL 1YC8A 3QXAB 1BF8A 3CFCL 3AAZB 3X11B 3D3VE 4PLJC 4RFNB 5ACMA 4Z77A 4KUZL 2RIKA 5IHUL 5A43C 2JTDA 5E70A 4O02L 5DRNA 3FL7A 4IS6B 4YWGH 5IW1B 5C07B 3RJDA 5B3NA 2V5RA 1BLNA 2BVUA 5FCSH 3UDWC 3EYVA 4X6CF 3M17B 5IEKB 3SE4A 4ELMB 5C0CD 2DJ4A 2D9CA 2WBJD 2VLKE 3P0YL 2YRPA 3SKMB 1WF5A 1JGLH 3V6ZB 3C8KB 3ZL4H 2HKFL 4BM7A 5B39B 1QFPA 4IMLA 4AM0A 3Q3GB 4AH2B 3F8UB 4KVCH 3QB7C 3ZTNH 4LPVA 5LJYH 2IAMD 4PRIA 1OTSC 2E8YA 4FA8A 2IQAB 3H3BC 5SX4H 3HC3H 2R1WB 5ANMB 1AO7E 4PJBA 3RWIB 3PGFL 4GRLB 4WW2B 1S8DA 1AR1D 8FABA 1RZ8A 3H9SB 3E8UL 2YD6A 3T1FB 2MWCA 2APWA 2BOCB 1DQLH 1NCNA 3MRGB 3QSKB 2FX9L 2VAAB 3QCTL 3PGCA 1D5IH 1AI1L 3ARFC 1T0PB 4YGAB 4MLSA 2XWTB 4U1IB 4WUKL 3EZJB 5K9JL 2AQ3A 1IGCH 1QSVA 4HJ0D 4APQB 2D9QB 2YOCA 3G5XA 4OKVA 1EHAA 2MJWA 5T1LD 3V6FB 5EA0L 3QBTB 4G6AC 5DD3L 5DJZB 4ZSOA 3ARGC 5B39G 2G75A 4C56A 4OZGB 1CDYA 3UMTA 4R26H 2P5EA 2B1HL 2GK0B 3ULSA 2P5WB 5L2JB 1U91B 4GAGH 2HT4C 1NGWB 3AY4A 2HFGL 1IM3A 4J3VA 4NM8H 1AO7D 1GGUA 2HJKA 4HUWB 2NY1D 5EBMA 1F11B 1AP2A 3MRDA 1MCJA 5IW1A 3V9FA 1T0MB 1LEGB 3F5WA 4F7CA 1C1EL 4UAOC 5EU3A 5ICZA 4OLZL 1Q38A 1MJUL 4QHLA 1T66C 1DBMH 1I7ZB 3DROA 4IEFB 1A4KB 3ARFA 1JHLL 2ARJA 2BDNL 4U1LA 3FQUA 2X4QA 4BH8A 4BFEA 1A6ZA 4X6DB 3LRHA 4FN0A 4YDLB 3J8F7 4KH2A 1I9EA 3OTTA 4Z7WF 1SM3L 4U1KB 4UT7H 2ENSA 1I9IL 4ODSH 5C0RL 1L6XA 1SY6L 3P11H 2W59A 3BQUD 4WWID 3VDAA 5T3XH 1ZLWK 4P2QD 4Z76B 5IMKA 3MJ9A 2V5TA 4JG1H 1RU9H 2NY6C 2VXUH 1XCTB 1JV5B 1UM6L 1WICA 4G8IB 5IROA 4LVNB 4KRPD 5AAMA 4HGKC 4M9OA 4JO3L 2QBWA 4X4ME 3GKZA 3PXJA 1NMBH 4QXGL 5AZEH 3BIKA 2GY7B 4GSDH 4LVHC 4CVZA 3GRWH 3O2DH 2X05A 2Z31B 2GUOA 4GKSA 5HYSB 1OL0A 1JTTA 2CKNA 3TP4A 2C1OB 3MLRH 3W2DL 1DN0A 1DQTA 2F53E 2ZOLA 4L4VE 4PS4L 1GGYA 5T1MA 4JCMA 2IH1A 4YXKL 3VXUB 4XPGL 3V4UH 3DVNA 4XBPB 3UC0L 3QJFB 2XWBA 4HAFA 1RFDL 4YXLH 4Q9QH 1BREA 4H5SA 4AIZB 3U6RB 1U3HD 1IGMH 2ATPA 4I48A 1YNTB 4XGZA 5IMOA 3U4BH 1T0MA 1L9MA 5D5MF 3WSQH 2QLVB 4DZBB 3MV8D 5K9QG 3MRRA 3HNTH 5FK9B 2FO4B 5F70A 3NCMA 5C07A 3UZVB 3L1OH 4LEXH 4JPKL 4IOIA 5D7LB 3IDMA 1E28A 2H3NA 2Y4SA 1U8KB 5IHLB 4HWBL 1EGJA 2QQKH 5C0ND 1CS6A 4KTYA 3V5DB 1RZIB 4LSRL 3OV6A 2KUTA 3HI5H 4ZMAT 4M7LL 3SJVE 2FIRT 3EYUH 4GRLD 5JW4R 1D9KB 2LAGB 1I85A 4OIBA 1IKNA 1M4KA 3BH8B 3QG6B 1QR1A 4HIXL 4TSAL 3V52H 3EJJX 3QIBA 1VEPA 1UA6H 4R4BA 4G80B 4Z78A 5C9JA 1J5OL 3ULUD 5DQ9A 1IAOA 3D3VA 4GKZB 4S1SH 5F9JB 1CXLA 5B3JF 1XR8B 1RJLB 2H6PB 1G7MB 1IKNC 1KIRB 3V5HB 1D5XA 4FQPA 5K9QI 3QIBC 1EERB 3TLRA 4WRLA 1H8OA 1CFBA 3WLWD 2HG5A 3GSVB 4PLKD 1SVCP 5IG7A 3QRGL 4NOFA 3TO4D 4BQ9A 2VZTA 2UUDH 4KJWC 4NZTL 4MJ2A 1OGAB 1QSZA 4P2YA 4BZ2L 3Q3GA 1KLUB 5T5FL 4EUPB 5EU5A 4LCWA 4UB0L 1S7VB 1TVBB 3VXTA 4ZFZA 4P2RA 3ARGB 3KXFE 5IEKA 1BOGA 2BK8A 1JHTA 1AY1L 5KANI 2D31A 4LSVL 1B4JH 3KNBA 4NO0B 2MCPL 1BIIA 1N26A 4XHJC 4XXCA 5H37H 1I1AB 3BP4A 4M5ZL 3C87A 1NBYB 2J6EA 3QNYA 1T0NB 2ZP0T 5I6XB 1VFBB 3ZHDA 3DX8B 3ROOA 1U42A 2IAND 3ECBB 3HNSL 3VJ6A 1BX2B 5MEND 1JZ2A 2R69H 1OD9A 3IFLH 2C4XA 3TYFA 3L9RB 2XPGA 3NPSB 2Z8SA 4YDKL 5HHNA 4KKBD 1EEZA 4ZPTA 5A40E 2P1YA 1QR4A 2R69L 1W0YT 2FBOJ 3QRFM 2QTEA 3ARED 4J4PD 3GEWB 1TJGL 3EO0B 3CH1A 1MELA 3GSNA 3V6FA 2BMKB 2QJDA 4ENEC 4U1MA 4NQCE 3H9HA 2VDNL 4NZUL 5JA9A 3MLTB 3I9GH 5HYJE 2F54D 4MQTB 4GAJH 4DTGL 3RAJH 4ZXBA 1AY1H 2PKDA 1K8IA 2EYRB 1OAXL 2YD8A 5D8JH 1FVEB 1MFCH 4N8CH 2R2EA 5IJVA 4YR6B 3QHFL 2ZUVA 3N1GC 2LU4A 2CPCA 5JR1H 2BOCA 3NCYS 3TNMB 4XXDB 1MF2H 5E8OA 1JMZA 8FABB 1A64A 1HKLL 1OAKH 5T3XD 2JF1A 5E94B 3SKNA 3VXMD 3QRGH 2A1WH 4LMQI 1DQQB 5F7WC 1RZJH 4J2XA 2J6EH 4HIIB 2O61A 5HY9A 1JUFA 1S7QA 4JR9H 1CDCA 1T5WB 2CJUH 3BKMH 4PB0H 3GMMB 3GSQB 4X8JB 4D9LH 1UKTA 3O6LL 2V17H 5AUMA 1MQKH 2R1XB 3EYQD 1IL1A 2FHFA 3O6KH 4JRYE 5DHXB 4AIOA 1BAFH 3FB8A 1BZ9A 1FLTX 4U6XA 1U58B 3MRLA 1I7RA 4MZ2A 1UH2A 3QQ3B 1L0QA 1GC1L 2IQ9H 4X4YA 3V79C 4DJMA 2EDTA 3ULUE 3VGFA 4P5KB 3PWUB 2AEQL 5ERWA 4PYHA 3BSZH 4WHTB 2GI7A 1TQCC 6FABH 1A5FH 1G9NL 4LSRH 1A7OH 4M43L 1A3QA 1JFQL 1T7VA 3UTSE 4O2EA 3GBLA 4PBVC 5JXAL 2AXHA 5I1CH 1A1MA 5F88A 4TNWK 3MLXH 5BZDB 1TQBB 3HE6D 1UXWB 3OAZH 4GG8B 3L1OL 5DA0B 5J57B 5F9AC 5C6TH 4X6FB 1FG9C 1MRFH 5HHME 2YXMA 1NAKL 1YY9C 1Y6NR 2WP3O 2JIXA 4UOW1 4MNQB 3IDNA 4TTDC 4WFEE 4XBEL 2P24B 4LCCB 1XIWC 5DO2C 1YQ2A 2CRZA 2ITCA 1CWVA 2Z31A 3I85A 4AT6A 1NEZG 1RIUL 3UP1A 1OTTD 1I8LC 1VEOA 2UY7A 4X7TB 5A2KH 1W2KT 3QAZB 1N0XL 1NBQA 4PGCA 5IB1B 4GRWH 5JXAH 5BOPA 3IDIB 3QIWD 5L8JB 3ZE0E 1J11A 2ZCKH 3P40A 3DX7A 1A7OL 3TH4T 5FYKD 3W2DH 4GLRI 1AGCA 4JY6B 5LCVH 4PJ7A 3V95A 4Y4HA 1M6OB 1KLGA 1MSPA 4I9WD 2ENYA 4JVWA 4OLYL 3VWJC 2J8UF 4OD2B 1JYVA 4G9DB 4HKBA 4UV7H 1NGQH 1TVHB 4KJYB 4TSBL 2GSGB 2IANE 1ZVSA 1EFXA 1UQSA 1UJ3C 5E1AA 3F7VB 1D7FA 3HUJF 1F58L 3RWHA 1VGEL 1MLBA 2V17L 1L9NA 1JNJA 5T3XL 3LEXB 1P2CB 2CJUL 4PB0L 1MPAL 1T1XA 3NAAL 4PJHF 4NC2B 3SE9L 3VMPA 4CRPA 5GJSH 5IMOB 1FRGH 1S78D 3NZ8A 1AQKH 3OKDA 5E2TL 3PP3K 1EEUA 1T0NA 3QNYB 3TCLB 1KFAH 3O3EA 3I02B 4JN1L 1A21A 1FC1A 4JRXE 2BNRA 3WJJC 1JRHI 1G1YA 1IZJA 1LP9E 3FFCE 2XNAB 3EYQC 4N8CL 4GKNA 4UT6L 4XNQB 5KVGL 3HMXL 1JUFB 3IETA 1HCVA 3T0EC 2LVCA 4JZNA 3VXTB 5GRXG 1DBAH 3RWGA 4JO2L 4GKSB 4PGZA 3GUTB 1C1EH 2CKBH 4FFWD 2VABB 1QZ1A 2VXSH 4CVZB 2AQ1A 4NZUH 2WQRA 2EE3A 2D7NA 2YBRA 3CXHJ 3LQZA 1YJDC 5DZNA 2CRIA 2EDKA 4HSQA 3ZDXF 3CFJB 3IYLW 4ZAKA 1LNUB 1A6UH 1UB5B 3STBA 2YKLL 5IJVB 4O2CB 4HUVA 3MBED 4MAYC 4NBXB 3GMNB 3V0WH 1FVCA 2Y1VA 1Y0LB 3DXAA 1NCWH 4YC2C 2E7LC 2AKRA 2OJEB 4NRYA 3MREB 3IFLL 3H8NA 3KPSB 3AS2A 5DD3H 5EU6B 4R9HA 2VLRE 5EA0H 2BXZA 2XZCH 3OJDA 1YMMD 2OYPA 4M48L 1C12A 1T03H 1S9VB 1IC5L 5DUPH 1DDHB 1IGCL 3GI9H 3S9DB 1A0QL 4WUKH 3QUYA 4K3JL 3GHEL 4M6MH 1N3NA 2FX9H 3ZKSD 4GG8A 4GAFB 1M7IB 1HSAA 2NY0B 4OF0A 1OY3B 5IROC 4NT6B 4Q6YA 3GSRA 1JYXA 1NL0H 4DKAA 4TN9A 3MRFA 3S3SA 4CNIB 4QKXB 4YPGA 2CIKB 5EO9A 4X98B 3QIWA 1EVTC 3VI4E 4BZ2H 2K7QA 2PTUA 1VESA 4ODXB 1FGVH 5DWUH 4NQCA 3EJYD 4OLWH 3D18B 3A6CH 4LMQE 1SBSL 4PJXF 3BVNB 5D9SA 3ARXA 4PTTA 1S7WA 4Z7NE 2A38A 3QIUB 2Y7QB 3WS6A 1G7JA 4A6YL 5F3HA 2R2BA 4S1SL 3ZL4L 1U8IB 3BPNB 3RKDD 1WWBX 4F80A 4OD2A 4Y5XC 5E8EB 3WE6A 3QNZA 4DZ8A 1G7QB 1BJ1J 3GMMA 5GSVB 5C0DB 2UYLB 5C09D 5FDYA 2BSSA 4G8GD 2BRRH 4IIQA 1UFUA 5L2KD 1BOYA 1HXMA 1VADA 1NEZB 1IGIH 1S7TB 4M7LH 5JA8B 1FZOA 3VGBA 1FDLL 2RB8A 2ADGA 4PGCB 4L9LA 1BD2E 2F58L 3O0RL 5I16A 2X1OA 1K8DA 3M45A 3LS4H 4GMTH 2R2EB 5CJQL 3BKJH 5HYEA 1RUKL 3VFPA 4B7IA 3DIFA 2X4UA 1FNAA 5D2LA 3FFCD 2I5YL 1KXVC 4V1DA 5IOPB 1I4FB 4ZNEE 2X2YA 2DKMA 1B4RA 5D5MB 1I8KA 3WXWH 3W5NA 1AC6A 4PV8A 1GZQB 4KKNA 3B9VA 4Y4KB 4LKCA 2VABA 1UXWA 3L3GB 4NO5B 3VFSB 2X6MA 5AWNH 3LIZH 4E5XA 2NZIA 4FRWA 5E6IB 2VNCA 4QRQB 2F8OA 1DP0A 1U36A 4PUBL 5D7LE 4GRWF 1HKFA 2V7HB 4G43B 3QZWA 4ERSL 1DUYB 3V2AR 1FYTE 4I3RH 5DQJB 3O3EB 3MBEB 4WW1B 3MRMB 1CR9H 4QGYA 5HDBF 1CXEA 3O2DL 2VXVL 3ULVL 1D6EA 4FQIH 4GSDL 4OZGE 1KV3A 3RUGF 4U6XB 4KVNL 3VGHA 3MRDB 3WV0A 3I3EA 4KROC 3BPCB 5JHLH 4KU1A 3STZB 2Z35A 1A4JA 4RISH 4CU8A 1F3JA 4GMSH 1RU9L 2OQJB 5E8NA 2VSCA 4K8RD 1A1OA 4ZO9A 3DO3A 1FPTH 2OBGA 2OZ4L 2X40A 4HMDA 1S9VA 5BS0D 4OCSL 5DA4A 5A2JH 5ILTH 2R0KH 1UJTA 1QYGH 4TTGA 5C0AB 4S2SA 3S4SA 1EBAA 1KENL 2FJFB 1IC1A 1KT2B 4HMEA 4Q0XH 2F54B 2RFXA 2FATH 2I24N 5C0BA 4MJIA 5T33L 3G5XB 1NCDL 4OKVB 5L0QB 1WLHA 4PRNB 4Y4HB 3OAUL 4NQVA 2ZCLL 2OTPA 1JL8A 4JM4L 5JHDE 5GS2D 1DEDA 3KPRB 4FZEL 1DUZA 3ARDC 5L7XH 4PY7B 1ZHLA 3G6AA 1QFWH 3W0WD 2D0HA 4XVSH 4QNPF 2FX8H 4LCUA 3W9DA 1S7SB 3GJFA 4R3SA 2W9EL 5TDPB 1CL7H 1E27A 5I2IA 4R96B 5IQ9B 4LL9A 3JV5A 3PJSB 2EDHA 5SWQA 1KJ3H 2ITCB 2ZUQB 4LSTH 4S1DC 5F9OL 4G7VH 4BK4A 1GYAA 2QKIB 4WTXA 3LDBC 3QUXB 2UYLA 3HLAB 3ARVA 1ZGLB 3QNZB 4AG4H 3GSUA 1F90L 1URLA 4IHOA 2IMMA 5GISH 4B7LA 4ALAL 1R3HA 4F33B 1N2RB 2B1HH 2D2OA 4JO1L 5FYKL 3P9LB 1UB6A 4G8FB 1N8ZB 3IVKA 5IVOA 3C8KA 1G7IB 2DM4A 2WINA 4GO6B 4R0LB 4YHYC 3MRPA 4F7PB 1N5YL 1R3IL 4ODUB 4M7KL 4PTTB 5CFHA 3BPNC 3NBNA 5D7IE 5L8LB 4LBEB 4KDVA 2HN7A 3O6FD 2WK2A 2BY2A 5KS9B 4WO4C 4YFEA 4X7FC 3RKPA 4E41D 1XR9B 5HDOA 3RVWD 3LEVL 1JYNA 3C2SA 5LQBL 2H8PA 1JTPA 1MLBB 1PAMA 4MXVE 4F7EB 1H5BB 4U6TA 4HIEB 2X1WL 2P8LA 3TJEL 5GRJH 2BERA 4BSJA 4Y16C 3UX9B 4POZD 1P7KA 2D03H 3E2HC 4OBRA 1T66D 2BVQB 1HHHB 4MA1B 5DRWA 2C26A 2Z0BA 2IPUK 3IFOB 3TF7C 3PDOA 3WFZA 4OLVL 4P5TC 4XPAL 3Q0HA 3UXFA 2A6KA 4U6VL 3SKOA 1OP3K 3GIZH 4HZLA 2I60H 5I1KH 2HWZH 4NIKB 4WFHE 3NACL 3OF6D 4KVCL 4JRXA 4Y5YB 5I16B 5FKAB 4ZUVA 2FH8A 5F21B 4NJAH 2PTTB 3VD7A 1MIMH 1BECA 4FQXB 4RGMB 2BHUA 1F6AA 3PGDB 4RIRB 3MR9B 5D7LD 1UB5A 4KKAD 1ZA3A 1I1FA 1NCBH 1NFDE 2HLFD 3SGKA 5DK2B 4FXKA 4F58H 2Q3AA 4QHMB 1DQJA 3MV9B 1XIWA 3T4AA 3GJFH 3HRPA 3L3DB 3QI9B 5C09A 1LO5B 3RZCC 4KWUA 3IXAB 3PE9A 2Y5TA 4HHAA 5CZXC 5BVJB 2DDQL 3FB6B 1TCRB 5H2BB 2VXTH 3B2VL 4BZ1H 4LQFL 4R6UA 4RAHA 4LF3A 5GJTH 4IJ3C 1U8QB 1CD1B 3P30H 3SBWA 4KK6D 1MWAB 1JWMA 3WEXA 3HFMH 2GKIA 4O5LH 3B3IB 3NFSH 4G9FE 5F1KC 3OAZK 4HV8B 1YPZB 5JPMA 4L4TD 5D1XB 5LAXA 1L7IL 4MHHG 3QWRD 5DLML 4N1HB 5FYKU 4M6OL 4EI5B 1B3JA 3ISWA 1U8NA 5D96B 2HJKB 3LZFL 3OKEB 1MIEH 4HUWA 5T1MB 3IXTB 4DVRH 4Z7OF 1NFKA 3O4LD 3QUZD 2AK1H 3EOAB 4R7NB 2HFEA 5IT2H 3KLHC 1A7NL 5IB2B 4Y19B 1NMAH 4OGZA 1PKOA 3Q2CA 4YBQC 4H88L 2CKBA 1EHNA 4TUKH 3FRUA 3SDYL 1N7MH 1FZMB 1MCWW 1YY8A 4PY7A 1A6TB 3FFDA 1I7UA 4LNRB 1OTTC 4TNVK 5I76B 3CDGB 1YN6A 4YHIA 4Y16A 4YDJA 5TE6L 3T09A 4D0DA 4K3DH 4PRNA 3DX9A 1CGSL 5CHNB 3Q6FB 5IKCB 4L8CB 5HHQB 3BXNB 1Q1JH 4L8DA 3RUGA 1T21B 2OP4L 5EZIH 4XC1H 5KVEH 4JQIH 4MQ7B 3CIQA 4UU9A 1IJ9A 3ZYZA 3T08A 1WQVT 4NN7B 1JNHA 3JSSA 2ERJB 3BE1H 1YMMB 2E7MA 3QXTA 1K4DA 1G9ML 3TO4B 2BVQA 4HH8A 1HN1A 4F3FA 2XQBL 4OZHE 1ZT1B 2DYPD 4QHNA 1XGPA 4NSKA 5I8CB 3DRTB 1YEEL 3JWDH 1QKZH 2P5WD 1EVUA 1VACB 3V6OA 2O5ZH 5ABDE 4LFHG 3AU1B 4N5EC 3SGJA 3TT1H 4YEFA 3U7WH 1ZWIA 2YA1A 2ZG1A 1Q8MA 3B2UD 3MXVL 4NHCL 1AFVL 2ZSWB 2HH0L 4OSUH 1RZKC 5CSZA 3TPUB 2HN7B 2CLZB 3MJ7A 4JRYB 1G1CA 1IGTB 3SE8H 3ARGA 1U0QA 2NX5D 1WAAA 4J6RL 4G5ZL 1LDPL 1X5LA 1E4XH 2EO1A 5E2JA 2GSIB 2QHRL 4S0SD 5GHWH 4R8WL 1LO0L 2ZJSL 1KC5H 4IRJD 5JPNA 4P57A 2HTLD 2BP3A 1UWGH 4D0CB 3HLAA 4LVEA 2M26A 1KJ2B 3ULVD 2VR4A 3KPPB 3CFIC 4OGAC 5C0EB 1II4E 25C8L 3QEHA 1R3KA 1MCBA 5SWQB 1L0XA 3SE3C 3L3HB 1IT9H 3QEQD 4XCFH 5F72S 4HMCA 5DQ9B 4XPBH 2R8SH 4WJ5A 1A1NB 2LU7A 2ZPKH 1HOCB 4ELME 1F3DH 5DJXB 1KPUA 4LLUB 1T04A 2ZNXA 4Z7WB 5F3BB 1DBKH 3X17A 1K2DA 3P4LA 2DQFA 4Z8FH 1YN7A 2C3WA 4ZUUA 5HI3D 2C1PA 4QTHB 5F44A 2Z31D 2NTFB 3A67H 4RGNE 1S9KC 2EH7H 4ZNCD 5GGSA 5CLTA 3ULUH 1Y18A 1RULH 3BZEA 2Q8BL 2FEDC 1JYWA 2WBKA 5FGCB 3TWCH 3ARTA 1X7QB 4AY0A 1A1OB 1FZKB 1W0WA 4GT7A 1EEZB 4QRSA 2WZPD 1INQA 2FECI 1NANI 1JPSH 5I8EB 4GBXB 4PJHA 4Z95H 4PJIE 2DKUA 1U8PA 5DHVH 1F4WH 2UWEA 2ZPKL 3N06B 5D7IF 1T6WA 1OF2A 3P0VH 3EOBA 3C9NB 3OKLB 4N0UB 5DJ0A 3VRLE 1T80A 3QEQA 1QLEH 4KDTC 1Z6JT 4Q58C 3RA7L 3L5HA 1EHLH 4FXGB 4RX4D 3S6CA 3MROA 3P4NA 3MJ9H 4HHAB 1J1PH 3QDMA 5ETUB 4KGJA 5DYOB 1NBVH 5GPRA 5C09B 2V7NB 4Y7MA 3I6LE 3TJHC 1D9KC 1S5HB 1IQDA 2Y6SD 4PJDF 4ZUSA 5IQ9A 3NCFB 3VGEA 1RJCA 5EOCL 3M1BA 5DHVA 4FXKB 4YX2H 3E2HB 4PJ7B 3MLYH 3UROR 4FQJL 3U36B 2EYSA 4Y16B 4DW2H 4CUCA 2DL2A 5MERB 2BVOA 3KJ6H 2CQVA 4YBHA 5D7JD 4IBLT 3KPSE 5IHZB 2DS4A 1IILE 4ZAKD 4HDIA 4Y8AA 5C8JB 5DJXA 1YY8B 5E2VH 1JZ6A 2Z4QB 1OD7A 1LNUA 4EBQH 1OAYH 1PYWB 1JWSA 5B3JE 4P2OB 2J3SA 3CAFA 1FE8L 5DSCA 3PV7A 1U2CA 3MLTA 4KK8C 5HTSA 4DGVL 1RURH 1KTKE 4P46C 4WW2A 1JNLH 2Q6WA 1X5GA 2D0GA 2OR9L 2P44B 4K7FA 1ONQA 4FQ2H 3UYRH 3RWDA 2ZG3A 3GK8L 3RY4A 4X7CC 4LVOB 2OP4H 5EZIL 4GS7B 3S3PA 1J86A 5BW7A 2VE6B 3VFUB 1QRNE 1MAMH 3LSOB 3U0WH 4JJHA 1U8MB 3MJGX 1U8OB 4PJDB 5AYQA 2AXGB 4TNWF 2GJZA 3BP5A 2Q8AL 4JREB 1F8TL 1EEYB 4JDZB 3VGDA 3GNMH 1TZHB 4W4OA 1U3HC 2DQEH 3TPUA 4M3JA 1T1XB 3TBYB 3VFOA 2N7AA 1DLFH 5I18H 1UVQB 1G0XA 4X8XA 2KBGA 3HS0B 3R8BB 1KIPB 3VI3E 1TXKA 2CIKA 2F54E 1I7RB 3BKYH 4IRSC 1MRCL 2GSGA 5A16B 5DTFA 4C56B 4IRZH 4GXVL 2FRGP 1KSRA 2LABA 2YC1A 5DQDH 5H8DA 3BGMB 4L8SB 2QADB 3T0VA 1OWWA 2Y9RT 2YWZA 4JKPH 3ZSSA 5FO8A 5L88H 3G04A 3KLDA 4LCWD 3W81A 3GSXA 3VXRE 4WEBH 2ORBH 2J88L 3BZDA 1XT5A 1G9EA 2B5IB 4HUXB 3ZYJA 3FOLA 4MQXC 3WIHH 1CFQA 1I1AD 3ARWA 1KEGL 4XI5D 3OKOB 4NO0D 2N4IA 5GRYA 4UOW0 4LVHB 3DYOA 1CU4L 1PZ5B 4UAOB 2HRPH 2Z8VC 3WN5B 3IFNL 4P2OC 3RI5F 4MNGB 1QFOA 4RBPH 4PRAB 1LMKA 4P5TA 3MACL 3CSYA 3RDTA 1LEIB 1RUQH 3HE7C 3LQAH 3VXSE 4P59H 2W9DL 4DKEH 4UILH 3DSFL 5B39A 2GSIA 1NCBL 5KJRH 1BVKB 4JHZA 2I9LA 2CK2A 3BJLA 5HHMD 5IW3A 3MO1A 2YMXH 1J8HB 5HGGS 5BV7L 1E0OB 4G6MH 4QYOB 1U8HA 1ZK9A 1MIML 2EC9U 1WT5A 3RTQB 2YPLB 1E4JA 4U2YA 2X41A 1FORH 3IS0X 5GRVL 1QRNB 1CE6B 5I73B 2MQCA 4M1CC 5DRNB 4JGMA 1I1YA 1T4KB 3GJEA 1CIDA 3MRFB 3OKNA 1IZKA 2C5DC 5I30L 2VZ1A 2DQHL 4OGXL 3BH9A 3UJIL 5D1XD 1FJ1A 5DHYB 2W9LA 2VLJA 1D5MA 2VLKD 1NGZB 2AXFB 3I50L 3SDAC 5TDNA 3RWJA 4N0CD 5D2LE 1U91A 5MEPB 1I3VA 2PO6D 4FQ1H 1QPPA 3T3PF 3BHBB 2G75B 2HA1A 4RAVA 2EE6A 2IFGA 5DJZA 4WHYH 5JW4Q 3QUKA 3DMMA 1GZQA 3G6JB 5LQBH 5IR1B 3LEVH 4ELKA 1KTLA 4X6DF 3ARDA 1H3PH 2KQNA 4NRYB 3NN8B 1OPGH 1WGOA 2XOTA 2BC4A 1T1WA 4P23B 1WC7A 2BVOB 4HIJB 3GMPA 4LCCC 2GJ6E 2CGRL 4O4YL 3ZKQD 2G9HB 3VFGH 4PJIA 1RIHH 4I0KA 2X5PA 4EI5D 3GO1L 1C5CL 1N6VA 2C3XA 3RVTC 5CEZH 5EIQA 5I17B 3FQXB 4WW2C 2FZ3B 1ORQB 1W72H 4GUPB 4OI9A 1X4YA 1CVRA 1VERA 2W9EH 4JGUA 2R39A 4L4TE 3KYMB 2MCG1 2DBLH 1CTOA 5BMFL 1ORSA 1E28B 2H3NB 4X80L 4MA3A 1MREL 4C57C 1BVLA 3HS0A 3HHRB 1RZKL 2H1PL 3F7RA 3ZT7A 4DN3H 2Z93B 4JM4H 4LRNH 3BDYH 1GCFA 3W0WA 2ZUXA 3QZWB 1UM4H 1ZXQA 2IALA 4HT1L 4R4ND 4PJCE 5I74B 1N6UA 5D70H 2GT9B 2ZCHL 5E8PA 3HG1A 3D6GA 3G9VA 5ILTL 2P8MB 4LU5L 4QT5B 3LQMA 4L29A 3QPQC 1MY5A 4JFDE 3T0WA 3VXUA 3P4OA 4RISL 5BS0A 4P9HL 3MOAH 5EC1A 2VE6A 3VFUA 3WJJA 4NFDA 5FYKE 1CLYH 4ONFL 5GGUB 1S5IH 4ZUUB 4J8RB 1BQHA 5I1DA 4MJ5B 4LHJB 4M4RA 5JORA 2CMRH 3FZUD 1PZ5A 3D9AL 5GGQH 3BGFC 3H0TA 3BI9X 5GRUL 2A73B 3BIKB 3N9GH 1Q9WA 3IDJB 2YPLD 5EWIH 1PQZA 3RL2A 2QQNH 1OTUD 1P7QD 5IIEA 1F13A 3TN0C 4FFZH 3VH8G 3PL6C 5ESAB 2QR0B 4NQUA 3KPLB 4I0PD 5HGHB 3E6HA 1GXEA 1G7QA 4DAGH 3MA9H 1WISA 4C83B 5DMYA 4HK0B 4L3EB 2YPKB 2WBJB 1ZT7A 1I9JH 1D9KD 1LO3L 2GHWB 1FYHB 2NYYD 3SCMA 2F53D 1ADQL 5HI5D 4K3GA 2YD2A 2FNBA 3KAAA 3G5ZB 2OQJA 4RRPG 5C07D 3R1GH 2V6HA 2GW5A 1M05B 2J8HA 3LKRA 3AS3A 3IJSB 3QG7H 2X4TB 1E6JH 5SWSE 4NKIL 2YA2A 3U83A 1XGYH 4WUUD 2C7UA 4XMLL 4ODUA 3W39A 1A7PH 2VDPL 3DUUA 5JUEH 2AVGA 2BRRL 3RZCB 1SQ2N 3BAEH 1P4BL 2NX5B 3DHJA 4RQQA 2AXGA 1MWAA 4Y1AE 1C5DA 1JRHH 3RGVD 4WGVB 4MDJB 3RWEB 3UPCA 3GMLB 4N0CC 3DI2B 4BQ8A 5CBAB 3GJFK 2PW2A 5ICYB 1WEJL 4L4JA 2IEPA 3TC9A 5CBEB 3P77A 4M1DL 1BVKA 4Q7DA 5C0JB 4LSPL 5ADPH 2WUBH 2AK4D 3DHMA 3VG9B 1UT9A 1WFUA 4UIMA 3RX7A 4A6YH 1KLUA 1S7UA 2XZZA 2J2ZA 4ZTPL 4ESKA 5I2IB 4DQOH 4MWFA 3QHZH 4AMKL 3GJFB 1S7SA 5GZNC 1WFOA 4OGAD 4BELD 5JDSB 4FS0A 1A8JH 1IQWH 2V9TA 1HZHH 3KXFA 4OLWL 5IM7A 4CMMA 3NCJH 5HXMA 2PXYD 3SY0B 4DGYH 1A3RH 4P2QA 3AS0A 1FIEA 3MX0A 3K1KC 1F4YH 3D25A 1P6AB 1FAKT 4FG6D 4G6KL 5FOBA 4ZUVB 1RJYA 4FABL 4POUB 1C16A 1X5AA 3OJ2C 4S2SB 3S4SB 1WCQA 3CH1B 3GSNB 3GHEH 5GGTH 3SE4C 4PJFA 1KB5A 4ORZC 3HI6H 1A0QH 4UDUA 2PO6A 4YFDB 5DJAB 5FGSA 4P49A 5DUPL 3ROLB 1X5YA 2AEPL 3DOSA 3SDXA 4NN6C 2E6PA 1T03L 3OXRB 4ZPTB 2J7LA 3RWJB 5SWSD 3RQ3A 3P4OB 2AEIT 1YNLH 3CC5B 3FO9B 5DHYA 4KAQL 2HKHH 1T1YB 1FFNB 4PJEB 4UNUA 5HI5C 4Q9RL 1JTOA 3T0ED 3MRNB 2HJFA 5JTWA 3T2NH 3ARBC 3LN4B 3O9WD 4X6BA 3V0WL 4FMKA 4NUJB 3C60B 2GT9A 4JKKA 1H5BA 4Y5YC 5BXFB 2P4AB 3QO1A 2CK0L 2V9RA 3O81A 4KJPC 5IK3A 5FHBH 3TBSA 4OQTL 1A14L 3OGCB 4OD3L 4HKJB 1OW0A 4TNVF 5IF0A 2VXSL 1E4XI 4GH7B 1J8HA 3FJTA 3MA7B 2CKBL 1P6FA 1TCRA 4ZOCA 3PWPE 1T5XB 2DLHA 1U58A 1T1ZB 2GJ6A 2VISA 1UB6B 4G8FA 1MFAH 2ZSVA 4NC1C 4WI4A 4D0BA 2E9WA 3LV3A 1R3HB 4F33A 4JPIA 4F57H 3S3JA 3C5JA 1H3WM 2MSPA 3BKCH 2W0PA 4HK0A 3DARA 5TQ0L 3Q1SH 4CDHA 3VG0L 5FYLE 4MCYB 5TDOA 4XPHL 1JNNL 5F7HA 5D2NC 4F15B 2AJUL 1AGCB 1V5JA 5GSRB 1MCDA 4JN1H 4YUEH 4KV5E 4JLRB 4UTAL 4NZDA 4U6YA 1QQDB 1YC7A 3LDBB 3MYJB 3SE9H 5L0QC 3QUZC 4NJ9H 3MCKB 1WBXB 3SQOL 2PN5A 2A73A 4L4VB 3S36L 1NSNH 5BO1L 1FVEA 1HHJB 2BC4B 4HWZB 2VZ3A 3H7LA 4HZLB 1LP9F 5CLWA 3ZDYE 3WDHA 1C5BH 3O45A 3EOTL 3K46A 1I1AC 3ARDB 1NC4B 2EDYA 4UV7L 3QXDA 2Z91B 3H3PH 4P3CH 1RMFL 3SBWC 5TF1H 5CILL 1S7UB 1TJHH 2ZUQC 4JFOA 4MXQD 4HKZB 1NUNB 4HLZH 5ECJE 1MCOL 2P8MA 5HBBA 2JJUA 3WCYA 3QH3A 1F97A 3P77B 4BQCA 1ETZB 4I3SL 5DXWA 5IFAH 2EDXA 4C58B 5FOJA 5K59E 4ZAKC 4GKNB 3MJ7B 4U1GC 1NSNL 5BO1H 1ACZA 1RMFH 5J7CC 2H8PB 3DMMC 5IBLC 1JWUB 3RU8L 3W9EA 3MRCB 1BEYH 1YEDA 4PJ8B 5ERWB 4NJ9L 1CXKA 2ADFL 2N56A 3L3IA 4QCIA 5CGYC 3OB0K 5FCUH 3TCLA 3O2VH 3QUMB 2NXZC 2AJXH 1CDHA 3RWFA 2G60H 4PGDB 1CD9B 3SQOH 3GSRB 1LE5A 4QHNB 3T3PE 3A6BH 1MRFL 4YDLC 5ESVB 4UTAH 2ICWJ 4S1QH 2H45A 2R56H 3AFLA 2AJUH 1KIUA 1MFAL 5I1CL 4XPHH 2OSLA 3B9KA 1TVHA 4ZSOB 1RHHB 2JCCF 3VG0H 4EDXB 1Y18B 4L8DB 3LAFA 5E56A 4YXHL 4F57L 2XTLA 5IJKC 1PJ9A 4WO4A 1IM9B 5FHBL 1FYTB 5HGHA 2BVEA 1AR2A 2AKRB 1JGEB 3AXLB 4PGJA 2CK0H 2DWEB 4JY6A 4YHIB 1KTDA 2EXYC 3D39E 4TPRL 3UTZB 4MZ3A 4KK8D 1UH3A 2VDKL 3IDIA 5E6IC 1N0LA 5D1XC 5DJ8A 4EQ2A 4G3YH 5JDSA 4KHTL 5DHVB 5J1AA 4G8EB 5DJ6A 3O6KL 1RZ8B 3D85B 5BS0E 1NCCL 3O9WA 4M1CD 3BMVA 1KACB 4HS3A 5JORB 2NY2D 3C09C 2OM5A 1U93B 5KG9A 4Y4KC 5J9PB 2R4RH 1Z9SA 1JHKH 4CN4A 1B0WA 1VFAA 5EZLB 4MCYA 3INUH 2A0LD 4XNQA 2VLMD 4OV5B 4PJGB 5J6GA 3UPRB 1H3VA 4WV1A 4XCYA 1Y6KR 3X14B 2MKWA 2Y6SC 3SO5A 3Q5OA 4JFED 1NGXB 3OKYA 1RSFA 4J4PC 4RQQB 5FUZL 3VFMA 4A2MA 1NMCB 2X89A 5CMAA 3QHFH 1G6VK 4JDVA 1T89A 5ICXA 1AGDB 1MFCL 2EKSA 5DI8A 3MXWH 5DD5H 5DGRA 3NCJL 4YJZL 4JQXC 5L9DH 5EIVA 3DETC 1HDMA 2M1KA 4WFGD 1HZHL 4NKMB 4GAJL 3MRRB 1A6VL 2X4TA 3IJHA 3TN0B 3QO1B 1M05A 3NMEA 3MMEA 4DQOL 4OCRL 1NLBL 3B83A 2VN7A 3DRQB 4MAUH 2VL5A 3ZKND 2Q86A 1YNKH 1KBGL 2NY4C 4M1DH 4QOKA 5DF0A 5I0ZA 2EEDA 2QSTA 5T1DL 1ZT1A 4D8PB 1CGWA 3HUJE 1MH5A 3C6LD 1N3NB 4WI7A 4RMVA 5I1GL 5HPOA 5IOPA 4JFFE 4LSPH 3I2CH 3HNSH 4YC2B 3RVVD 2WP3T 3CLEH 3OKMA 1Q9OB 2BNUA 5ESQB 4K7FB 4Z7WA 2IBZX 3VFPB 4AEFA 3S35L 4L3CA 4P4RA 4LVOC 3TVMB 1KPUB 3ILPA 1JRHL 1O5DT 3PHQA 4MCZA 4D2NA 4HJGA 3MRBA 4TULL 3MRHB 1G7PB 4Z78B 1GC1C 4GRMA 1E6JL 2ADJA 3T1FA 3NFNB 4L4VD 5E08L 3HUJB 4Y2DC 3V0AC 4U6YB 1S8DB 2DQIL 5CEXB 3B6SA 3O8XC 3S5LA 2DQDL 3FOMA 2YSSA 4QRTA 4WWKC 2HAZA 4NKIH 2EEBA 1YMHB 4XNUH 5DK3A 4UB0H 1ADQH 1I85C 2F15A 2DM3A 4R2GD 5KZCB 3ULVF 3RWCB 2F53A 3DWTA 4WI2A 3WNNA 2XFXB 5H94B 4DK6A 3D2UD 3WUWG 5FF6B 1T5XA 4LEOA 5GIRB 3VW3L 2VKXA 2VXQL 5MEOB 1FFOB 2Z92A 1X5HA 4G42A 3RWEA 5ELIA 4F7EA 4E9LA 4HXBL 3WHXA 1W72A 4D9QD 2QQNL 3NTCH 2CDGB 5DC9B 4K94H 4TOYH 3D18A 4DZBA 1UCBH 1D6VH 4PLOB 4OFKA 4PJGE 1MCHA 3OKLA 2G2RA 1U8JA 5FECA 2ATPB 3D85D 1LHZA 1EEYA 3O2DA 2HJFB 1AP2B 5IVNA 1TTGA 5EWIL 1XF1A 2BSED 3P9MA 2JB6A 2N7BA 4WFFD 3AM8C 3RTQA 4GKOA 1EJOL 3N9GL 1YDPA 4P4KA 1Z9OA 5GRUH 1M7XA 1FL5B 4OF8A 3U4EB 3TN0D 4XVUD 1KJVA 1F6FB 5FB8B 3QXVA 1VFAB 1T2QH 3U9UA 2QQKL 1Z3GL 5E0QA 4EZMA 3QH3B 4LLYA 3VFSA 1RQ5A 1GGCL 4HKZA 1KB5B 2Q6WB 3VGAB 3FZUC 3MPCA 1E27B 1G6RA 4IOFD 4L1HA 5E00B 4RCAA 3QCUL 3D87B 1JI2A 3LD8B 3O3DB 5D7SH 5J4MA 5JQHC 3BDYL 3G6AB 5EU4A 1VGKB 2X4UB 3HAEG 3V4PL 1T83C 4NKOA 1KTDB 3O6MH 4WW2F 1BFTA 3MV8A 3T65A 4GKZA 4UMGA 1FYTA 4HT1H 4L9LB 1JK8B 1AGFB 1LK2B 4G80A 5BQ7A 2B0SL 1U3HA 4YXKH 3C6LC 4RDQF 4ETYA 3D0VA 4JFDD 4X80H 4MVBD 4OFIA 3EZ8A 2RCSH 1JPGB 1P4LB 3X12B 3MNWB 1WIPA 3G9AB 3IF1A 1HHIB 2FBJH 4NFBA 4RGOL 1UWXH 2OXGA 5IGXH 4HCRL 3GRWL 3JWDC 4XCCL 5B4MD 3ULVE 5EU6E 4YH6A 3C6LA 3BUYB 5HHPA 1RZIA 6CGTA 3LV3B 4OM1H 1QEWA 1HCFX 4BA8A 1XGTA 4JO3H 3MFFA 5A16A 3MUY1 2X70B 1VFBA 2CIIB 1QFUH 1JJUA 4LGSB 2HYMA 4JG1L 5K9KB 2Y07H 4BSVB 5CJOL 3BO8B 1DANU 4FHBD 1OOAA 4DWHA 1OT2A 2VZVA 1GJIA 1U8HB 1AC0A 5BRZA 1WCBA 4ODSL 5C0RH 1DJSA 1BFSA 3F12B 4LF3B 1I9IH 4PJGF 4ODWB 5L6YL 2PYEB 4ZUWB 4JY4A 1MHPL 4MA3B 5HGDB 1DQDL 4WU7B 5EOTB 3AS1A 1AKJB 4LPYA 2XA8L 1R5VA 3BIAX 1M7DB 2FIKB 5IWLA 4LRIA 2VR9A 4K7PX 4XCYB 2K7PA 3L5WA 4OCMC 3K8KA 4WTZA 4X8JA 4OV5A 1QSEE 2XN9A 4PBXA 2CO7B 1JHLH 2FZ3A 1S7QB 2R0ZH 2WWKT 3QFJB 3ZKXC 1JGDA 3NGBC 2IG2H 2VLRB 32C2B 4L8CA 4PJ7E 3B8SA 4HS8H 1FORL 1IEBA 2PTTA 1K85A 1X5XA 5L2KB 3ARSA 5IBTL 5T3ZD 3PHQB 5I30H 1UXSA 2DJUA 1TETL 2WUCH 1ZKAA 5B21A 3F7YA 1AQDA 3FN0L 5C2BL 3IKKA 4R26L 1JGEA 3AXLA 3NN8A 3U0TA 5KSUB 2V2XB 2XT1B 4FQQB 4ELKB 4UILL 3D1MC 2W9DH 3V6BR 1MH5B 4QXTB 1CE1H 5DRZA 5CWSB 2P5ED 4OLXL 3UTPE 2ICWI 1CDJA 2GFBB 4QT5A 2EO9A 2OTUA 4P2CG 3PWVB 4RGNB 1CFNA 3T2PA 3VXQA 1U8KA 2NY3D 4LQ1A 4P5TD 4PRDB 5ISZD 4E41A 3UTTD 4OF5A 3KWWB 1D5MB 3VD5A 1KEGH 2I07A 5DMIL 3N1FC 2MPAH 5D96C 2YXFA 1U8JB 5FECB 2DQTL 1CU4H 3PGFH 1S9YA 3DURB 3Q5YA 1H3TA 4WEBL 4QEGA 2E7CA 4H20H 4WFHD 5I8CA 5JMOC 4ZPVB 2EC8A 5L88L 4XPFL 3AB0C 1X6NA 3QDJA 2FB4L 4RNRB 5B38G 2IBBA 3MJ6A 2NW2A 1T5WA 4PYGA 5KVDL 2N1KA 3PNWA 2QSCH 3IF1B 5BVJA 3U79A 2HKFH 1A6WH 2DLIA 4RFOL 2PR4L 1JGLL 1EAPA 5HGBB 4HKBB 3L3DA 5HHQA 3DSNA 2DMKA 1FLRH 2W0LA 1RZJC 3T0EB 1QVOB 2EE9A 5BV7C 3FTGA 2CLRB 1OSPH 2R0WH 1FVCB 1QLRA 3DXAB 3O4OB 4YWGL 3GMPB 2R2HB 1MCWM 1T2JA 4NBZB 4KUZH 2Q8AH 1PQZB 4LSUL 3RL2B 2A74A 3CU7A 4XB7A 4XNYL 2DQEL 3U0WL 3H0TB 2BSRA 2ICWB 1MAML 1K5NB 4RAVB 3BP6A 1F8TH 3MBXL 4KXZI 3GZKA 1AXIB 4UTBL 3LB6C 2XPGB 2VH5H 1YZZA 3QXWA 4JPVH 4KZDH 4IMLB 4AM0B 3O11B 4LLWB 2APBA 3GI8H 2VC2L 1A1MB 1F4HA 2JE8A 4NO3B 3TNNB 4EN3B 3OBAA 2A6DB 3QUML 4DVBA 1A22B 1EDQA 4WFED 5GGVY 4XH2B 3SDCD 3KYOA 2JJSC 2CLZA 1FL3B 5DR5L 3U48A 3LKSA 5E7FA 3TVMC 4FQJH 5FAAA 4CKVX 4LOUC 3TO2B 3WHE0 4EBQL 4XP1H 4NQTA 5E2VL 4OFPA 5FYJU 1UGNA 4X4YB 5F97E 1WZMA 2AP2A 2DLGA 4MSWB 2FX7L 1GZPB 3NA9H 4XWOD 5MENB 1X7QA 1FL6B 1U41A 1JPTH 4H1LH 5L2KE 1U2HA 4X4XB 3PHSA 2CR6A 4TSCL 1XCQB 3MJ9L 4QRPD 4HF5L 4YX2L 2F5BL 3T77B 3VXSD 1RUML 2PTVA 2QADD 2WW8A 5D7KE 1KCRL 3VFVA 3O4LE 1IAMA 3T1WA 4OLUH 4YFLI 3QDMD 1JIBA 1NBVL 1FH5H 1RK0B 3DTXA 3K4AA 3ROLA 4HIIA 4Y4FB 4U3XA 4D9RD 1UACL 3ESVF 3P0VL 5SX4I 2P42B 3ZE2E 1MRDL 4XAKE 5EU6A 3VGGA 1IGYB 5KSVB 4WNQB 4D0DB 1UKSA 2YK1L 3VRJA 2BVTA 1T7ZA 3OR7A 1BQHG 1BD2B 4AZ8A 4JY5L 5A3ID 3QZWG 2YRZA 5GXBB 3I6LD 2CDEA 5C0EA 5FYJD 4PV9A 4HPYH 4OIAA 5GGUA 4H25B 3OPZH 4LPTA 3MGTA 4FTVD 2R29L 5EFIB 4WWKD 3TM6A 1I3UA 2Y5EA 3B9DA 4O2FB 1JZ7A 2YEZB 1A02N 3WE6B 4PJCB 2CRMA 2IWGA 3GKWL 3QQ4A 4PJBF 1IC7H 2WIMA 4FMFA 2HFEB 1T1ZA 5FKPA 5TQ2L 5HVFB 3SKMA 1DEEB 4WWKA 1J8KA 1VFMA 4DEPC 3GKWH 4ODWA 5B8CC 2EH7L 4U7KA 4KHXH 4MX7A 1ZMYA 2DIJA 4XVJH 5CSZB 3MV7E 4U4BA 4ONGH 1J87A 3FO1B 4Y4FD 2FD6H 3C2AH 2FLBT 3ULVC 4X83A 5C7XH 3WNLA 4KQ3H 2H41A 4X0KB 3T0EE 5F71A 3UZQA 4H5SB 3O3UN 1RVFH 4ONHB 3REWA 3L95B 4TVPH 3R4DA 4O00A 1F11A 1QEWB 2ADIA 5BZWA 1KELH 5E6YA 4J3TA 3WNOA 5HPMA 1WIOA 1KC5L 4GW1B 1U3YA 3MLSH 4YHOH 4R8WH 2OI9B 3TYGH 1O7SA 2DIBA 1ZHNA 2JCCA 4RWHA 5CJXA 2OX5A 1IGFH 1FO0H 4OCYL 3D0VB 1SJHA 3SE8L 4LDEB 3VXNA 3CH8A 3FHQA 3LN5A 4U33A 4XPTH 1NC2D 2ZJSH 2HH0H 1OTUC 1FFRA 5KSUA 4TSCH 1E4XL 2Z4QA 5C08A 3VWKB 3WLBB 4I18C 2OL3L 5HVWA 4HLJA 3CLFH 5IJKA 4QHUA 2EIDA 3QWQB 1HNFA 5IMKB 3ALWA 4U1GB 3NCYP 1AFVH 4ZAKB 3VD3A 1PD6A 3C5ZD 1KF9B 4ISVB 3TT1L 4R4BB 5DR5H 3ALPA 4X99A 4X6CE 2OL3B 4UQ3B 3GB7B 1IQDB 2LQRA 3BE1L 1J18A 1J10A 4JN2A 4EKXA 5HYQB 4OCLC 4XNMB 1IAII 3TBWB 1MHCB 4PRPD 1JP5A 2XQBH 5TE7L 1Q1JL 4XCNB 4CU6A 2MQ0A 43CAB 4EIZC 5IB4A 5MENE 2E6JA 1HQRB 1AE6H 4DK3A 4FFWC 1V7NL 4HD9A 4LAQL 1UYWL 2O5XL 3GMQB 5MI0B 3ARFB 1JI1A 4JQIL 4ZPVA 3R06B 5KVFH 1FNGA 4NHUA 1R5VB 4XI5C 4XC1L 2FYYB 3JWOL 5CSGA 5FUOL 3ZDZE 5I1HH 5CEZD 5AEAA 3RY6A 4CADA 3BD3A 4WW1A 3TV3L 5FHAL 1WBYA 3RL1A 5HDLA 4LSUH 1SJEA 4H88H 1CT8B 1QSFB 4U1JB 5DS8B 4OT1L 5TE6H 4I8DA 4LLAA 5L2JA 1QFHA 1AGDA 1VFOA 4YPGB 5EO9B 4X4MA 3X13B 3QULA 5J13B 3G5YA 1Q72L 2W60A 3CPLB 2XWBB 1OSPL 2BNQE 4CMHB 3OHXB 4U3CA 2VDML 3QQ4B 2DLEA 5HHOA 5AG9A 4PV8B 4UINL 4PIRF 2ATKA 4QWWD 4YHZL 3OG4B 4FQQA 5CP7B 3KPOB 2AK4B 2UWEE 5IT2L 2C3HA 3ILQC 3NIGE 4QXUH 4RFOH 4V1DB 4BFBD 3GSVA 3BDXA 3MODH 4N90D 3KDMB 4XNXH 4MA1C 1HHJA 3HI1B 2ZUYA 3O3BB 3G6DH 3IAPA 2I27N 2BNRE 3C60C 2HT3C 3QWRA 1SHMA 1EMTL 3HZMA 3JV6B 3MRJB 3FKUS 5JQ6L 4JKMA 5K33A 2WMPA 1CQYA 1S7TA 2DQTH 2GTWA 5E8DL 4MXVF 4HPOH 5GSRA 4UUJB 2DDQH 4O5LL 3TBTA 5ISZA 4Y5VC 1G9NC 1H3GA 3L3JA 2ZUWA 4F9LC 3P30L 1NFIA 2AJZB 3VFVB 4OAWA 4UV4H 3RY5A 4UBDC 4LQFH 1S5HA 4MNQE 1J7VR 5E5MB 1XIWD 3MV01 1XCQA 5DYOA 3G5VA 2R2BB 4I77L 3HC0B 3IDMB 1EGJL 4Q6IA 3Q48A 4XBGB 2CXKA 4Z7OE 5CGMA 3DNKA 1CE1L 4RNRA 1ZLUH 5TE4H 4M5YL 4MA7L 4F58L 2W65B 2VLJB 4UT9L 1Q94B 5KSBB 2PETA 1B90A 1HHGB 4DGIL 3KYOB 5FM8A 3MLUH 5TFSH 4JRXD 1SVZA 2I60L 4GJTB 4EN3A 1UM5L 2H9GB 4FP8L 1ZLSH 2PCPA 3KPMA 4NJAL 4S1RH 4KKAC 1SYSA 4HS8L 3QEGL 1D5BB 4L1DA 2PW1A 4MJ6A 3RX8A 1NANH 1Q9LA 2IG2L 3VFWA 3WUWA 1B6DA 5ADOL 5B38B 3HAEH 4UI2A 4HGWB 2APTA 1FCCA 4XPAH 4MAYA 4HS3B 3QDHA 2AJSH 4JAMA 1X5KA 3RWCA 4XMPL 4O2FA 5J1TC 1G7HB 4KRLB 2H2SC 5IVXA 1BPVA 3I6KB 3MGTB 3EDEA 1B0RA 3N1QC 5E2UL 4MMZC 1QBML 1CD0A 4FQCL 2XA8H 4PJ8D 4PJ9B 3TA3C 2J12B 1DL7H 3RUGE 5L6YH 1N5YH 4KROB 3PV6B 4G6FD 4WTWA 2L0DA 4HC1L 3HR5B 3V7MA 2AERT 4U49A 4XZUA 5DJDA 4HJGB 1EA9C 4S1DD 4CVUA 3ILPB 1R3IH 5IEHA 5DUMH 1QFUL 1CGVA 2DQUL 4I4WA 1RHHA 5JIPA 3NH7H 4J8RA 4OM1L 4G7VL 3CCHA 5GISL 5MEPA 4PP2B 1KJ3L 4GW1A 1F90H 2HJLA 4HCRH 4HH9B 4LSSL 3RGVC 5IGXL 3BX7C 1CL7L 5DD1H 1I3GL 4KJQD 4X6EB 4K71C 1R5IA 2BFVH 2XKNA 3T77A 1MI5B 3DX8A 3ROOB 2RCSL 3V6ZA 4HQQL 3BZFA 1BMGA 4X6DE 4F7TA 5JPMB 5KSAC 4LSTL 1QSFD 3C08L 5HYJA 3BGFB 4V1DE 5CZVL 1CT8A 1QSFA 5F1SA 2LVEA 1WWCA 3OAUH 4NN5C 4DUWA 5EN2A 1ZV5A 4XVSL 5T33H 4BFGA 1Q9KB 1I9RH 1WBYB 1LO4L 3RBSA 4NRZB 3HC4H 1BOGB 3MRPB 4F7PA 4ODVH 5T1LB 2R0KL 1CLOH 3DX6B 1U95A 4OCSH 2YUWA 4PLJD 4Z7UB 1MFEL 2VOTA 4XHJD 5D7SL 5C0BD 4R2GB 4YHKH 4RMUA 1NGXA 2VWEC 3TO4A 1KENH 4QY8A 4DUVA 4BH7B 1NFIB 2VDLH 1N64H 4JHAH 1M6OA 5JHLL 4PGEA 1WITA 2QR0A 4X9BA 3DGGA 3B2UC 2DLTA 1T2QL 5D2NE 5HYQA 2XYCA 4FQIL 3S5LB 4U1IA 4M7ZC 5E94A 1GGBH 3SKNB 3D3VD 1FFPA 3D85A 2VERN 3NFNA 4Z7QE 4RFEB 3JV6A 1NPUA 5FKAA 4MGXA 4KVNH 2OK0L 4RAUA 3ZZ1A 1UEYA 4HBQA 3QIBD 3ULVH 2VXVH 3GMNA 2UY6A 2V5SA 5I8OH 1CR9L 2AV1B 2A77L 4BFIB 4CVWA 4I3RL 1FBIL 1QBBA 2R1WA 3TJHD 1BQHB 1RZ7L 5C08B 3VWKA 1D6VL 2JIXB 3UTOA 5JMRA 1IC4H 4BK5A 4HXBH 4PRIB 3QUXC 1PLGL 1A3LH 5C0BE 4X9GA 5H37G 3OX8B 2X9XA 2Q20A 3WD5L 1BBDH 3LIZL 2D7QA 5FM5O 4KKLC 5C08E 3UJJH 2G5BB 3TA3A 4H0IA 4HGWA 3NCBB 1OGTA 1YEIH 2XZQH 4WU7A 4QRUB 5I19L 5HPMB 2YD7A 1BJ8A 1MJ8H 1LP9A 3FFCA 3O0RH 4Z7UF 3CVIL 1ZTXH 1FGNL 1G6RH 2I5YH 4M7JL 5TPWL 2NY7L 1RPQA 3EJYC 4N0UA 4JE4B 4K71B 5F1OB 4MNHA 4O58L 1X5JA 3CFBA 5CJQH 5D7KD 2DQIH 4YFLF 3LS4L 5ID1B 5B8CA 3FQWB 3DLQR 3NABH 5GGRA 3RVUC 3ARYA 1FDLH 3DGCR 4G8GA 3LEXA 3CSPA 1NGYB 1IM3B 2JJTA 3JTTA 3F58H 3O4OC 2DI7A 4G42B 4P3DA 2R23B 3QDAA 3GHBH 1IGIL 1ND0B 4R2GC 5MHSE 3QDGA 5E9DE 4MDIB 5ISZE 1MJJB 4K7PH 1T21A 5E5MA 3TFKD 4M62L 1NJ9A 2ICES 2IPKA 1NDGB 3DO7B 3AC0A 5T1DH 3S36X 1GGIH 2DICA 4KTDL 5IMLA 1DVFD 4QRTB 4HDIB 1FGVL 5C8JA 3EGSB 3IDYC 2VYRE 3U2SB 5DZLA 1A6TA 1EO5A 4PJ9A 4QNPE 2XV6B 1UZ6F 4NQCD 1T6VN 3A6CL 2IC2A 1HINL 3FTGB 4PY8J 3VFRB 5HHOE 1MCFA 2GK2A 4E0RA 4LGPB 1NAMH 4JLRA 5EG6C 4XP9L 1HSBA 3TZVC 1NL0L 4M8QA 2XTJE 3QFJA 1AHWB 1S3KH 4EI6A 1VENA 4KUCD 4V2CB 1J1OH 4JRWA 4UIKH 2FWOB 4ZOAA 5BS0B 2KZ1B 5IQ7H 4ZQKB 1A9BB 4R7DB 4RZCB 1FNSH 1R24A 1UENA 2X1XR 1OB1A 1JHKL 4P99A 3SKUD 5ICZB 3C9NA 1G7JB 1BVZA 2YUXA 2NNAA 5EUKB 5HGDA 2B39A 1CIUA 3CMOH 3SKJL 5HI3C 4PJEF 4TQEL 3TBSB 4A6YA 4G3YL 3X3FL 1V3KA 3PABB 4R90H 2DQCH 2VDKH 3PUCA 1EIBA 3WFEL 4ZS6C 4HJJL 1F45A 4QRQA 3RHWF 1DSFH 3EYOA 4YIQB 4PRDA 5JLZB 3VFTA 1A6UL 1DBAL 2VZUA 1GH7A 1DBJH 1KCVH 2BCKB 5JXEC 4Z0BL 2GIYA 3DV4B 5EBWA 4IRSB 3MOBL 2GJJA 2YA0A 5D5MA 2E8ZA 2APVA 2V2XA 3SDXE 1HXYB 1YEJL 1R3LA 2FEEL 2OXHA 2UWEF 4HX1A 2IPTH 3FMGH 3C5ZA 4G6AD 3T3ME 1YQVH 4N90E 3FQTB 1AQKL 3PGCB 1YYLH 4NUGH 4RMWA 1U3HB 3H2WA 1RJYB 3OAYH 1CICD 3KPSA 5LGKA 5C08D 2H32H 1HILA 1JWSB 3FB5B 4U0QB 4RRPA 3L3OB 1TQCB 1KFAL 3L3HA 1VGEH 1ZLUK 5FCUL 1NC2A 3CVHL 2FR4A 3U36A 5I66A 2Q7YA 1P4IH 1YEGL 3N85L 3I6KA 1M71A 1EFXD 4PRHE 4FQLH 4QY8B 5F6IB 1WFTA 3K80A 5JW4M 1J1XH 1GL4B 1RZFH 2F74A 1P7KB 4JG0H 1B0GA 4Y5VB 5I15L 1XF3A 1NKRA 3H7BB 4HEME 4DFHA 4NQSB 1QSED 5DMGD 5CILH 3BZ4A 5TF1L 3GFUA 4HGMA 4I13B 5D9SB 2XQYG 4P3CL 3TYFB 4KV5F 4OLYH 3MLWH 5KS9F 2MHAB 3KYKH 3K3QA 1KYOJ 5EU3B 2DL9A 3UTTE 1AIFB 1BD2D 2UUDK 3QNXB 2QSQA 2ZCKL 4MNHB 3S36H 2WINB 4R0LA 3IVKB 4NO3A 2UWEB 4XBEH 4NT6A 1FFQA