3SO3C

Structures of fab-protease complexes reveal a highly specific non-canonical mechanism of inhibition.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
225
structure length
220
Chain Sequence
EVQLVQSGGGLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCVKDLGIAARRFVSGAFDIWGQGTMVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDTKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Suppressor of tumorigenicity 14 protein
publication title A reverse binding motif that contributes to specific protease inhibition by antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 41
structure length 220
sequence length 225
ec nomenclature
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3so3C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3so3C01
1T20B 5E70A 5D5MF 3AMKA 2R9HD 5DI8B 3S34H 3I2CL 1WIOA 2GSGB 3DI3B 3HN3A 1KPUB 4ZNCD 3MV9E 2VWEE 1OW0C 2CO6B 1KF9B 5FECB 5FV1L 2QADB 2H26A 1CIUA 3T0DA 3WDIA 5EOTA 3NAAH 3QRGL 4OLUH 4TTDD 1QRNE 1N3NA 4UBDC 2D7NA 1BVLA 3GKZA 3QP3A 4CKVX 1LP9A 1MH5B 1A1OA 3NA9L 4PUBL 3LIZH 4NO0B 1JGEA 3WNMA 2VR9A 4H20L 4HWBA 1TZGL 5IESL 1X4ZA 2YRZA 5E2JA 4MNQA 1MLBB 4LKXA 3CFIC 4HD9A 5SWZA 1KCUH 5DEFB 5IEKA 2EDKA 4S2SA 2FJFA 3QHZH 4JEGB 4JM2B 1FZKA 3IKCA 1G7MB 1KLGA 4M7KH 4XMKH 1HI6B 5E4EB 2NY1C 2EYSB 1MUJA 4EQ2A 2WK2A 1MFCL 1GHFH 1INQB 3QPXL 3C5JA 5D6DC 3FAWA 1DL7H 5CBEB 4NN5C 3OB0H 3V4VH 1KCVH 3OKKA 5C09A 5EG6C 3I3DA 4LOUD 3X14B 4LDOB 4GXUN 1DLHA 4D3CL 5IMKA 4Z78A 4LSQL 1CFBA 3QQ3A 1ZT4B 5B22A 3B2UD 3IS0X 4OZGB 5DD5L 4I2XE 4GAJL 2R1YB 4G7YH 3VI4F 1QP1A 2AV1A 2A9ML 3OAYH 1OWWA 5T1LB 3UBXI 2VC2H 4PRBB 1FJ1A 5E8OA 2X40A 1TZIA 5M94B 3EYVB 1UC6A 3S35X 4PJCF 5I6XB 4YEFA 1NCWL 1ED3A 2JIXA 3DVGB 3K1KC 4BK4A 1MEXL 2L0DA 4ZO9A 1OQXA 4P5TC 4OSUH 4ETQB 4P2YA 1NBQA 4KI5F 1HYSD 5JW5B 4DZ8B 2IH1B 1FSKB 3QEUA 3Q5OA 4NO3A 3TN0B 2A38A 1RIHH 4CU6A 5ISZE 3GIVA 3BRFA 3F6IA 5DR5H 3T65B 3V5KB 3EGSB 4HAGA 3TCLB 1QFUH 1A9EB 1HWGB 4NFCA 1X5ZA 2OR7A 3TVMB 3EJYD 4Z6AT 3MRGB 1NGZB 4Y16D 1R3IH 4WUKL 5F88B 4PB9H 4LCUB 5C0EA 1EJOL 3G6JF 4MQXD 3BPNC 4X5XB 4MWFB 3VXUA 1S8DB 2C9AA 1RIVL 5IK3A 4I5BA 3IDUA 4U7MA 3R4DA 2R2EA 4NFBA 4JQXA 1HE7A 5TF1L 4YE4L 1MAMH 3RTQB 4YBQC 3BDYL 1T0NA 3NN8A 4PBXA 1IL1A 3PIQB 2B0SH 3C87A 1NBVL 1QNZH 2OQJA 1KLUA 3SDXB 1IKFL 2QSTA 3QEQE 4G3YL 3PF2A 5BRZB 1CFVH 5D2LF 4GQ9H 1MJ7H 4AY0A 1XGYL 1CFSB 3DX8B 1QFWM 1RZ8A 4TUKH 2G5RA 2P46B 4PJBE 5J0BA 1FL5B 4PG9B 4XPBL 1MELA 3RPIB 3UZQA 1F4XH 3NABH 2UUDH 2Q87A 3UJTH 1DQQB 3KPRE 3OKNA 3T8XB 1U3JA 1AXTL 1YN6A 4QT5B 2UY7A 3DVNB 3KXFE 4RFEA 3SE8L 1PKOA 2V9QA 3TBVB 5IB1B 4WFED 5EO0B 4P9ML 1ZTXH 1IGJA 4OBRA 5KSBE 3LSOB 4CUCA 2KL6A 4I3SL 3VWJD 4D0CA 1CDCA 1EHLL 4S1DC 3JSSA 3DROB 3I84A 5CP7B 1BFSA 3TM6A 2FD6H 1PQZA 3VRJB 4NOFA 2VAAA 4YQXL 2DLTA 4KUCF 4J3OC 5LXGH 2HVJB 1I1AB 4I0PC 5E95B 5CEYA 2Z35B 1CGXA 3LEVH 4LLDA 1U8MB 4W4OC 15C8L 1MIML 5DO2D 5BS0D 3PWPB 3GSXA 3NBNA 1JGDB 1FNFA 3KPMB 4TSCH 4X7CC 3K8LA 1T3FB 1LNUA 1A4JA 4LGRB 1VGEL 4MCZA 4X9HA 4F33B 2RIKA 3U0WH 1NMCC 2C26A 4LQFL 1RZFL 2HT4D 1BP3B 4JREB 4D0BB 1C1EL 2IBZY 5EU4B 3TJEL 1QO3A 1H3PL 2R4RL 3F5WA 3G08B 4Q0XH 2DM7A 1JRHL 1BBDH 1FZOB 5JNYA 2IADA 43CAB 3QH3B 2LTQB 2C1OB 3MRPA 4A6YL 3MRCA 2JB6A 3I2CH 4H1LA 5GGUB 3ZE2E 5B3NA 1W2KT 1DQML 4NUGH 4HDIB 5GGTL 1IM9A 1IGMH 1LVEA 2XXCB 2O93L 3EOTL 4OF0A 4EDWL 3B9KA 1UB5A 3D87B 3QUZC 2CGRL 4L4TB 4YEEA 4KKAD 3SKNA 2AKRA 1PKQA 3QQ4B 4QWWD 5F70A 4IIQB 3NA9H 4PUBH 4WU5B 5D7KD 1KPVB 2AJVL 3BPLC 4M61B 2ED8A 1TZGH 5IESH 1S7QA 5LGJB 5DFVC 1AXSA 3O3BB 3GJEB 4M7JL 2QL1A 5MHSD 5K9OB 4D0DA 4LLVA 1A8JH 1MAKA 3ROLA 5ACLA 1S9XA 3HE7B 3IXAA 5C07B 3BXNA 3VG9C 3CK0L 5DURD 4PB0L 3ZDZF 1II4E 4EI5D 2Y4SA 3QPXH 5D93B 5HJ3A 2R0WL 2H2PD 3WS6C 1EAPB 3O2VL 3BGFB 3QG6B 1G6VK 4D3CH 4O2CA 1NCBL 1T1ZB 3B8YA 4LSQH 3WUWG 3EO0A 4PJ8C 3SGDH 5DHYA 4H5SA 4X9FA 1T1WA 4PIRF 4TUOB 5DD5H 4GAJH 1JFQL 1WBZA 1EFXD 2A9MH 3OR7A 3OAUL 5C0CB 3BEWB 1J8HA 3MJ9L 1G7IB 1JYNA 3KJ4C 4YFLI 1NFDA 3WXWL 2P5EB 3VGEA 4NKMA 3MNVB 1E6JL 3CFBA 4PLKD 5FA3B 4Z7QF 1MEXH 5C0JB 3QO0B 1YYLL 1GRWA 2A6IA 3GMMB 3ET9F 2RHEA 4M93B 5T5NG 2VDKL 5JOPD 4L4JA 4RDQG 2RCSL 5TGBA 1AC6A 2X4UA 4HKJA 4U33A 3D85B 4Y4HB 1F13A 4GBXD 3O9WD 1N59B 4DN3L 2Z8WC 4QXTB 3HB3C 1CIDA 2X70B 4WI2A 4JQVA 1A5FL 1NGXA 4GW1B 5I8EB 5C86A 5IB4B 1SQ2N 5TQ0L 5IMMB 2QTEA 4F7PA 4WUKH 4PRHB 4JQIL 5E99L 4H25B 4LPWA 3LQAL 3B4NA 4MJ5A 4X9GA 3LN4A 1SJEB 1BQHA 2NY7L 4HS6A 4YK4C 3F58L 4M7ZC 1RIVH 1E6OH 2P7TB 1BJ1H 3AXLB 3STBA 5L8JB 3BESR 4S11A 4BKLA 1CGYA 4G6KH 5TF1H 5E94B 4YE4H 4HH8A 5JW4M 1YEJH 4WTZA 3BDYH 3EDFA 5E8NB 2EDJA 3D39E 3HCVA 3WIHA 3T77A 4X5WA 3ISWA 4GSDH 3ZTNL 5GS2H 4F9PA 4NQDD 4LHUB 4RAVB 1RZKC 3GI9L 2CO7B 3GSNH 1IKFH 1FAIL 3EKCA 3FONA 4G3YH 5E8EA 3K46A 2HFEB 5F7YC 2XQBL 4JFZL 4JO1L 4NDMA 5CAYB 1XGYH 3RZCC 4N0UE 3L5JA 3G6AA 2CIKA 1MJ8L 4XPBH 3MR9B 5IQ7L 5IR1A 1VB9A 2HLAA 4O02L 3MRLB 4UDUB 5C08A 3KLAA 4L4VB 3SE4C 4HIEB 2P8PB 3ARVA 1AXTH 3MA7B 2NY2C 3AS1A 2O5ZL 5DEZA 3SE8H 5ABDE 2CLVA 4P9MH 4RIRA 3CMOL 4QXGH 2DDQL 1AO7E 2CXGA 1OLZA 4J7RA 1EHLH 5E9DD 1QVOA 1P7KA 1KACB 1U92B 3FRPG 2GJZB 3IDNA 4YQXH 1BD2D 1EEZA 1QKZL 4QRQA 3HUJE 1KTRL 4HWEL 3DJ9A 5D71H 4JGMA 4HUVA 1BAFL 5DRWB 1MIMH 4J3VA 1XH3B 5EIIB 3MMEA 5DRZB 3E6FB 4XNUL 5L2KB 4F9LA 5I75B 3SCMB 3RL1A 4MGXA 4ELME 3VXMB 1VGEH 2AJZA 4POUB 3LPWA 4AIOA 1HXYB 4LF3B 4NQEB 4IJ3B 4LQFH 1RZFH 3PE9A 4JAMA 1C1EH 1V7ML 3P73B 3OR6B 4KQ3L 2I07B 4Y0GA 1H3PH 2R4RH 2BVPB 3W9DA 1FGVL 5BW7C 3RVWD 1UJ3B 4Z5RB 3WHE1 2OZ4A 3H9ZA 3W2DL 1DBBH 4A6YH 1NAMH 4ZUTA 5GSRB 1PVHA 1DQMH 4F15B 3T0XA 3C60D 2JJSA 4KKBD 3SKJL 3CLEL 3ZLQC 3EOTH 2GITB 4EDWH 4GW5A 4HLZH 2ZSVB 5JPMA 4N5EC 3TC9A 3KWWB 2CGRH 4X8JB 5A16B 2F74A 1NCTA 3I6LD 1U8HA 3QWOB 4JFEE 3DIFB 2WNGA 3VXRD 2A6DB 4QRRB 5C0GA 5AG9A 3W5MA 4KZDL 1BEYL 1FYTA 3M1BA 5JHDA 2AJVH 1Q1JL 4JFDA 4FOMA 4BK5A 2H32A 4YPGB 1G6RL 2A6KA 4M7JH 2YR3A 4PRPD 4JFYB 5JO5A 1QSFD 4O51A 3ARWA 2SEBB 2Y23A 3EJJX 4LSVL 4XX1G 3RWDA 1XIWC 4GS7B 3CK0H 1B88A 2VLKA 4PB0H 3JVGC 4L8BA 1X5IA 4OIBA 1XGPB 3NFSL 4NNYB 2IPTL 2ED9A 4MXQC 3O2VH 5D96B 4QHLB 1M4KA 1OTTD 3V6FB 3ARUA 4LASL 1JF5A 2ARJA 3AREC 2NYYD 3MLPA 1FGNH 3QDGE 3LKOB 1RJLA 4X6DE 4R4FH 1YDPA 1NCBH 3QCTL 1J7VR 2O61B 2GEEA 1BIHA 2RFXB 1PGRB 4QTIL 5M95B 2QQQA 5ANMB 5IOPA 1JHTA 1FVEA 4L8SC 1JFQH 4ESKA 2Q7YB 1CDHA 5I8CA 3E0GA 3PDOA 3OAUH 5T5FL 3RAJL 3OJDA 4EDXB 3MJ9H 4HC1A 1TVHA 5T1KB 5JOFA 1MREL 1N0LA 1DVFC 3OJ2C 2CLRA 2G75A 2N7AA 2QR0A 3U2SB 3MLUL 1E6JH 3GM8A 5T1DH 1KB5A 3FO2B 1LO0L 1YYLH 3G9VA 2DF3A 4ORGA 3PV7A 5HHXL 1EO7A 5BRZE 1HHHA 4OFIA 5JPNA 2XKSA 1DBKH 3SJVA 4NQXB 3L3OA 4PJ7B 5B8CC 4Q9QH 3BO8B 4Y1AB 3PV6A 4GMSL 4LEOA 3OKDA 2EYTB 3KPSA 3VXNB 4RQQA 4KPHL 3RL2B 4HG4J 1P5VA 1KGCE 4DN3H 5H94A 3HPLB 5ICYA 1QD0A 5KANG 1L0XA 3U6RA 2FR4A 2ESVA 1A5FH 1HEZB 3ILPB 4Z7VA 1BWWA 3ZZ1A 4QYOA 4KDTC 1GC1C 3CC5A 4QOKE 2VABA 5D7LA 1SM3L 3CX5J 1AP2B 4JQIH 5E99H 5L6YL 2YN3A 1IEBA 5C6PB 3LQAH 1OSPL 3LHPL 5DQJB 3U9UB 1I1RA 3ILQC 3T0EC 1N6VA 4WV1C 2CUMA 2NY7H 2IALA 2F54A 2AXFB 3VFMA 2NY6C 4X7EC 3RVTC 4ZTPL 4PGCB 3BPOC 3PWPE 5FOBA 4MNQD 1GSMA 5SWZD 1P4IL 4MD5A 1JCKA 5D2NA 4YBLC 5F96L 5SV3A 4ZUUB 1CXIA 5C6WH 5KSAC 3ZTNH 4LLUB 1FAIH 3ARSA 1TLKA 3BWAB 4ONOA 2XQBH 4JO1H 3ECBA 5IQ9B 2AK4A 4A2MA 4M1CD 5E6IC 3QCUL 5B38A 4NWTL 5C09D 2R56H 4MQTB 5IQ7H 1FNSL 4UQ3A 4M5YL 3MBEB 5FAAA 3N1GC 3WDJA 4O02H 2CH8A 1YUHA 3D1MC 4R2GD 1I8MB 3TBSB 4S1SL 1YPZA 5HGBB 3O6FD 4E42A 1CLOL 2MQ0A 4L4TE 3SPVA 2OJEB 1F58L 3QXDB 5C8JA 4GAGL 4L3CA 2EE2A 3CMOH 2DDQH 5HVGB 1JNHB 3QR2A 3EYFB 2ITCB 3ULSB 1SMAA 5DJ8A 3EYOB 5DRNB 3V6ZA 4U2ZA 3TH2T 3F7PC 1QKZH 3LN9A 3DMMA 4KJYB 1X3DA 1Q9KB 1EMTH 4WEUD 5F1IB 2DWDA 5AUMB 4HWEH 5GGVY 1HHKB 2X1OA 1BAFH 3QNZA 5IJVB 4DJMA 3M17B 5INDA 4XNUH 4ENED 3VFSB 2WBJA 4J2XA 5HHVL 5F97E 2XN9A 1OSZA 4ORZC 4KRLB 4G9DA 2Z91B 3VFOB 2ID5A 1I9EA 4B7IA 2ADIA 4IHOB 1V7MH 4XNMB 3SDDA 2NZ9D 4KQ3H 1T1XA 1DUYB 4GKSA 1RV6X 2JJTA 1FGVH 3AY4A 1AD9B 4UMGA 1XCQA 3W2DH 3BZ4A 3SBWC 1A47A 3HE6B 2CLZB 3QULA 3L5XL 3FTGB 2HG5B 2J5LC 4YXLL 5MEPA 1XGRA 1A0QL 4OJFH 4GLRI 3SKJH 4E41E 3CLEH 3QIUC 4LSPL 4YHNA 4M4PA 1EXUB 2GAZB 5F8QC 1PDKA 3MACH 1F11B 4JGUA 4ZYKB 5C0CE 3IB4A 3QIBB 4WGVB 4CW1B 1KYOJ 3O6ML 4P5MA 4KZDH 1BEYH 4EI6B 2VE6A 3V0VB 2P5EE 3GSRB 1Q1JH 4QF1A 1KN4H 1QG3A 3PWNA 4UIMA 1MCBA 3OKMA 3P9LB 7FABL 5DK0A 1G6RH 4HIJB 5DJZA 2MCPL 2X4SA 5SX5K 1CK0L 4R97C 1NC2B 5KG9A 3C9NB 1FO0A 4NCDA 1JF1A 2WWMD 1BIIA 3U7WL 4PJEB 4DCQB 4LSVH 2CMRL 1TVBB 4XCYB 1JGUL 4RMWA 5CZXD 5C71A 5DVLA 2EDBA 3PJSA 4CGTA 4KTDL 1YQVL 4PGZA 3RWIB 4MXVE 2XQYG 3NFSH 4G5ZL 1R3LB 2GJJA 1P7QB 4QHUB 1GXEA 2CPCA 1AI1L 1BECA 2H2SC 4LASH 3HNSH 4AM0B 4Y19D 3BIKB 3RUGA 4KQ4L 2Z31C 4L1HA 3V6OC 5L2JB 1B6DA 4PRHE 3MUHL 5D1XA 4HGWA 5TDPA 4W6WB 2G2RA 4XBGA 3LQZA 1KCRL 1L4IA 1IQDA 3L3HA 3NIGE 3QCTH 4HUUB 5CMAA 2JTDA 2HLFD 3I02B 4QTIH 3MUGB 3L3JA 3VGBA 5KS9A 1U3HC 2IJ0C 5BVJA 5EO9A 1JTTA 1CICB 2A6JB 1C5DB 2W38A 4LCCC 4XRCB 5T5FH 3RAJH 3D0LA 1WWAX 1MREH 2F15A 3OXRA 4CJ1A 4LRNL 5KN5A 1MF2L 1EHAA 5D1ZA 5T3XE 3ZO0A 3D3VA 1HH6A 2X9WA 5F7WC 4X4YA 3MLUH 2V7HA 5GGSY 2VISA 1LO0H 5FYKE 5HHXH 3N85L 5J9PA 4PRNA 2YUVA 4ZO6A 3T0BA 5TDNB 3PXHA 4MSWA 4XI5C 5JQ6L 1MWAL 3SGJA 3PQYD 3TO4C 3VGHA 5HI3C 5I2IA 1KNOB 4KPHH 1M05B 5B39A 4JZOB 2APTA 3D69B 4HUWB 1EZVX 5EO1B 3QFJB 5F9JB 4L4VE 1FFPA 5HGGS 5I1GL 4XZUB 3QZWA 5E1AB 1WSST 4MB3A 1SM3H 1YEDB 1WAAE 1U8LB 5KVDL 4JRWA 5IFAL 4EUPG 5FKPA 4HUNB 1OSPH 3LHPH 4RAUB 5EUOA 3WLBB 3FKUS 3BH9A 4RMRA 1WCBA 4WFFD 1MPAL 2HN7A 4YHPB 4ZTPH 2EDTA 5HHOA 5HGHB 1LK2A 2PYEE 3ARGB 4RSVA 2EDLA 2CRZA 3CZJA 4WWKB 1WFOA 1P4IH 1DBJL 5F96H 3VXME 1RUML 2AW2A 1S7UA 1GZQA 4HWBL 4TVPD 4PRAB 4TVSa 2PCPA 3J8F7 2ZSWA 3IAQA 1KT2B 3X11B 4F58L 1A2YA 1J1OL 4N0YH 1QPXA 1S9VA 2VDNL 4KHTL 1WZLA 1H3TA 5M7QA 2QKIB 5F1OB 1NDMB 1IQWL 1UM4L 3SGEI 5MENA 1GAFL 1HZHL 4M3KB 4BSVA 3ARDC 4EOWL 4NWTH 4FQIL 4U1KA 3GRWH 3QQ9C 1FNSH 4PJGA 4M5YH 3RU8L 4J6RL 5DMGD 4YDJA 5IG7B 3FO1A 1CN4A 4TYUA 4S1SH 2P24A 4NFDA 5IBLC 4M43L 3KNBA 1CLOH 1DZBA 2OYPA 3GGWB 1F58H 3H3BC 3LVEA 5F3HB 4M9PA 4GAGH 4QHMB 4QRRE 1CFNA 2APVA 4JRYA 1OWRM 4YHKL 1OAKH 3GSQB 4XCEA 1J8HD 4NUJA 4MLIA 1AGBB 3FN0L 4MAUL 4OZHB 2D0GA 5T3ZE 4JM2F 4JCMA 5DDHA 1FNEA 2NXZC 3MYJA 4ONGL 5C0AA 4OM1H 1E4XI 4GAFB 4XXCA 1YMMB 4ZQKA 5CEZE 3ULVL 5IMOB 3S9DB 1J88A 2GIYA 2VWEC 4JJHA 4X4ZA 1KIQB 1CYGA 4WO4C 5A2LH 4HIXL 3LRGA 2A74A 4K7PY 5GGSA 3GSNB 4Y4KB 2OL3A 1YEIL 3ZKMD 1U0QA 5C0BA 1PY4A 2PN5A 2WBKA 1H0DA 4JKPL 4LRIC 1OGAD 3RPKA 3DHMA 1I7UB 4OZGF 5EPMA 5IVZA 4YXLH 2XXMB 5C0NC 3JWOL 1UQSB 1A0QH 4WHDA 5ANME 1D9KB 1CG9B 1DE4A 1J05B 5J7CC 4APQC 2NPLX 4HCRL 1Z9OA 3CU1A 1C12A 1NUFA 3CSBA 3O3DA 3O6MH 3A67L 3EOAA 4KK5D 5DVNA 5ACZB 4ZAKC 1CXKA 5D7JC 1RZKL 1WC7B 1L0YA 4EUPH 5CBAB 3HMXA 1B0RB 3AU1A 3C6SA 7FABH 3RA7L 3QJHA 3WUWB 2MCPH 2VJXA 2BNQD 2XWJA 5DJCB 3PWLA 3JBG7 1BZQK 4F7MB 3MRFA 3O4LD 3JV0A 4ZDHA 3FQTA 1RZGB 1WBXA 2VXTL 3MRQA 3U7WH 4ZXBB 4Y4FA 2CMRH 3T0AA 4XBEL 4ZFZA 1JGUH 5JDSA 3ALWA 4PJ7E 3OB0K 4Y1AE 1YQVH 3TBTB 1F6AA 4YHYC 5KSUA 3TA3A 4W4OA 4PG2C 2LU3A 4Y8DC 4G5ZH 35C8L 4QRSB 1MQKL 1QFOA 3JUYA 4JPIA 1Z5LA 1AI1H 1MNUL 2DQHL 2NX5B 3MCG1 3NPSC 5C08D 1LEKA 3CUPB 2EDRA 4XVSL 1VFOA 32C2B 3HG1B 4A6YB 1NAMB 3FFCA 1MY5A 1KCRH 3OHXB 3OAYK 5I71B 1CR9H 4W6YB 3QPQD 5EU3B 4OKVA 3SE3A 4WEBL 4PTTB 1NL0L 5BJTB 1E0OB 4L3EA 4GFTB 1OPGL 4JLRB 3QA3A 2Z92A 2PW2A 1PSKL 5E5RB 4LRNH 3MUZ1 4WWID 1MF2H 1JPGA 3SGKA 1JHLL 1OGTA 5SX4H 1QLRA 1Z9SA 3SDXF 5CGYC 5FM5O 2FNBA 2IAND 2A83B 2NW3A 3LKQB 4HMEA 3HR5B 5F44A 4PJ5B 5EBLB 3ZDXE 4JFQB 4MJ2A 3WNOA 4BQBA 1RK1A 3O3UN 3F12A 3C09C 1MWAH 4MVBC 3HZYB 5D72L 1YNLL 2EZ0C 1KIUA 3DXAA 2AV7B 3DUSA 1S7VB 1K8DA 1TTUA 4PFEA 1ZSDA 2G5BA 1E4KC 1HDMA 3B3IA 5IVNA 1UWGL 1IBGL 1KBGH 3H42L 3MO1A 5I1GH 3THML 2RQ8A 5I1DA 3EBAA 4FQ1L 2GHWB 4Y2OA 5EWIL 5IFAH 1LEGA 5KVDH 1JZ4A 1VACB 5IB3A 2HT3C 4FQXC 5CGMA 3CDYA 3MJGX 1FYTD 2YPLB 2IQ9L 2A1WL 4P3CL 2FJHB 4AIZB 1NKOA 1GIGL 1JYVA 5L8LB 1MPAH 3Q6GL 1EX0A 3SN6N 5EU6A 5KAQG 3CFKB 1TITA 1FIGL 3H7LA 3IJHB 1BVKB 3G6DL 1DBJH 2BVQA 4K2UL 1RUMH 4WHYG 4ZSOB 5FOJA 4ZS6C 4HWBH 2BHYA 1JI2A 5T1MA 5FKAB 3FCTA 3UTZA 2VLKD 4U3XA 4F58H 2VDNH 4V1DD 2BNRB 2EXWD 4KHTH 1TJIL 1IQWH 1UM4H 2I24N 4X6EA 1QFWL 2X7LA 2UUDK 1GAFH 1HZHH 1IGIL 2MKLC 3ARFC 3UDWC 5CSZA 4KVNL 4EOWH 2H3NA 1I8LC 3I6KB 4FQIH 5H35A 1RJCA 2N56A 1CTOA 2BOCB 3F7YA 2XWBB 1OAYL 1VHPA 2VTFA 4XCNB 4J6RH 1NJ9A 5FYLD 4XP6L 1SYVB 3SDAB 1HWHB 3ROOA 4M43H 1UZ8A 2FBJL 1T83C 2VQ1B 4ZS7L 4KMQA 3RVXD 4YHKH 2AXGA 4MJIE 1F5WA 2DQIL 3MOAL 3HFML 3MV8D 4DZBA 1URLA 3FN0H 4NCC2 4MAUH 1ZGLP 2EEDA 4O9HL 4HS3B 4ONGH 2PTVA 2DL2A 3ULVH 4AG4L 3P4OA 5EZJA 2FLRT 3HTLX 5KANI 4D8PB 4R3SA 1ADQA 2XTJB 3TV3L 2EICA 4L3AA 3P40A 2FB4L 1WWBX 5KVEL 4PRIA 4HIXH 1XEDA 5K33A 1N4XL 2EKSA 1J11A 1RPQA 1FVDB 3SJVD 4MAYC 2OLDA 5DJ0A 3B5HA 1YEIH 3PGCB 2GJ6B 2ERJB 3KPSD 5ILTL 4JKPH 4TQEL 4RNRB 5K9KB 4KHXL 2HFFA 3PHQA 3LS4L 4TULH 3FHQA 3UTPD 3OKOA 3MRNA 2ESVD 4H1LG 4PP1C 4K71B 4H0HB 2Q86B 3EO1B 3IDJB 5D7LD 3JWOH 1CGUA 4IS6A 4U1SB 4U1LB 2NTFA 2APBA 5HHMD 4P46C 2B4CL 1ZANL 4JKLA 4JG0L 1IGTA 2E8YA 4UOW0 4Z0BL 4HCRH 2F54D 2NY4C 2YMXL 3BVNA 4POYA 4I0KA 1NUDA 4D9LL 4PV9B 4NNXB 1RZKH 1QPPA 2IEPA 5F9AC 3EDJA 2DD8L 4KMLB 1LWRA 4QKXB 4B0MM 3RA7H 4TNVK 3MJ8A 3V5HB 4K55A 4NM8L 1KJ2A 3D9AL 3UAJC 4U0RC 2VXTH 3KPLB 3FQUA 1LE5A 4BH8B 3M45A 2MQ3A 4XBEH 4U1HA 5FO7A 2Q8AL 3C5SA 3CLFL 1JP5A 1NC4A 1MFEL 12E8L 1AIFB 2IAMC 4CVZA 2AJ3B 4HIIB 3C2AL 1S9YB 35C8H 3GFUA 3S96A 2VXUL 3MNWA 1MQKH 1WIUA 2NQCA 5D5MA 3QNXB 1CXEA 1MNUH 4I13B 2DQHH 5HD8C 4CDGC 4U6HA 5EUKA 4GRLC 4WI6A 1JGLL 1CF8H 3CJJA 4I18A 4LCIL 4HPOL 3T1FB 1VEOA 4M6AA 1NBYB 3L7EA 4NP4L 5BW7A 4WEBH 3WL9A 1NL0H 4P2QE 2EC8A 4E0RB 3PWVB 1OPGH 3S37X 1LO5B 5DK2A 3TNNB 3ZHKA 3CFDB 3SDYL 3IDGB 1QUNA 5DMJB 3F6LA 3TYFA 4C56D 2FHFA 4OQ1A 5HDLA 1D6EA 1JHLH 1DTUA 1T89A 1YNKL 1G6RB 2YWZA 5GRVL 2WBJD 1OL0A 3FOLA 5DJ6A 5MERA 2XN9D 3VFNA 3LKRB 2DQGL 1YJDC 1A6TA 1MRDL 3SDDD 3C8KA 1UEYA 1QA9B 1YNLH 4JO2H 1BZ7B 5I74B 3BUTA 3EFFA 2XT1B 3C08L 3VCLB 3MRJB 4MNGB 4YFLF 1HQRA 1UWGH 1IBGH 1J1XL 1S78C 2HH0L 4S1QL 3W82A 3H42H 4Q58C 1IMHC 3THMH 2BRRL 2W65A 2QHLA 4GUPB 3FQRB 5IHZB 2A77L 4FQ1H 5EWIH 1WLHA 1Z0MA 1WZ1L 4H1LH 4HGKC 2E7LC 1IJ9A 4YC2C 2PW1B 4TUJB 5DMKB 3RX8A 2IQ9H 2A1WH 1R5IA 2DIJA 1GIGH 2DQDH 5F72S 4ALAL 5F7LB 2OS7A 1CI5A 3FQWA 1FLRL 4X6CE 4XWGL 4PJCA 5HHNB 1FIGH 1GH7A 2CRIA 1VKXA 4P4KA 4L8SA 4GG6F 1YEGL 3G6DH 4R90L 4K2UH 1TJGH 3WSQL 2QADC 4KRMB 4CNIB 5I76B 2GW5A 3SDCB 1HQ4A 3DYMA 4D2NA 3R8QA 4Z9KB 3LKPB 4P2RB 3RWGA 3UTSA 5J6GB 1EJ6A 4XC3L 3VRLE 2F53E 1TJIH 4G42B 1QFWH 1IGIH 3LEYL 4OLYL 4YR6A 3MRHB 1JWUB 4KVNH 3RWHB 1MQ8A 4MA3A 1OAYH 5FGBC 4WJ5B 3WLWD 4ZUSA 3QEHA 1OTSD 2VLJA 3L9RB 2CQVA 4XP6H 4M4RA 2V5TA 4FFYH 4JM2C 1K3ZA 4BH7A 4FTVB 1EGJA 2FBJH 4ZS7H 4UAOB 2DYPD 5JXEC 1Y0LA 3G6JA 3P30L 1S7TB 4PR5B 2DQIH 1P9MC 4O2EB 1Q9WA 1KEML 3CFEA 3MOAH 3HFMH 1FLTX 3OPZL 1G9NC 5DD6A 1NGQL 2ZOLA 1P2CB 2CR3A 2ADJA 3RBSA 3RY6A 3KPQB 2ZUQC 4O9HH 3D3VD 1C16A 3ARBB 2NY1B 3RHWK 4Q7DA 3VXSB 2XZQL 1W8OA 2D03L 3T0EA 4IDLA 4LCWA 4WV1A 5C0RH 4HK0A 4HC1L 3CDGA 3TV3H 1YY8B 1ETZB 1N4XH 4ODWA 5D2LA 2DM4A 4NN5B 4TOYL 1ZWIB 3STZB 5ITBL 4PJAB 4DKAA 3HZKA 2E9BA 5ILTH 1B9ZA 2NX5E 3ALPA 4K7FB 3UYRL 3TZVB 4TQEH 3MRBB 1YYML 4QTHB 1N2RB 4KHXH 5EBWA 3LS4H 5I6XC 5GGRA 4KMTL 3X12B 1JHKL 3IVKB 2VDQL 4YXKL 5DMIL 3GKWH 3P4LA 2B4CH 3RWJA 4U1JB 4JG0H 5ID0A 1FSKC 3TN0C 2MKWA 2Y5TA 2W60A 2YMXH 4KROB 3BISA 4NYLB 5ERWB 1D5XB 4D9LH 4W4NA 4OZIF 2DD8H 3PWJB 4LCYA 2FHBA 3PDGA 2V9TA 3MGAA 4HLJA 1B2WL 5EBMA 4HUXB 1BLNB 3TVMC 2XA3A 3MRDA 1IZKA 3LKNA 2IG2L 2CDGB 3D9AH 4NM8H 4OFYA 4XCCH 4PJ7F 3IDYC 2EXYC 5GRWA 2OSLB 3ZDYF 3RI5K 3AB0B 2BZDA 4XP5L 5HYJD 5C0DA 1B0WA 4OTXL 5AZEL 4S1RL 2CRYA 4JFPA 1FNHA 1HINH 1HN1A 3C2AH 2IBZX 2VXUH 2CRMA 4GQPH 3WFHB 3WYRA 4JRXB 4P5TD 1LE9B 4I9WD 2FL5A 3QFDA 1I9JL 1CFQB 1UACL 3FZUD 1W0WA 3RTQC 1YEEL 3EOBB 4MQ7B 3BPNB 2CR6A 1JGLH 1K4CB 4YO0B 2EE6A 5D1QC 4ONHA 4LCIH 4HPOH 2I9TB 5IFHL 4NP4H 4ZOBA 2YPLE 5A1AA 2E9WA 1A6AB 4LLYB 8FABB 5H2BB 3SBWA 2I9LA 3NFPA 1GGIH 2CKBL 1VFAB 3H9SA 3P11L 3BSZL 3SDYH 1KFAH 3EZJB 4MA1B 3BJLA 1Q0XH 1MFBL 1FRGL 5BZWA 4EUPB 4PJHE 2EDXA 2V2WA 4XVJL 4ZNEE 1YNKH 1BWMA 5FUCE 4OZ4B 4KKLC 5FDWB 4WVRA 4OFVA 2DQGH 4D9QD 4JM4L 4WUUB 1MRDH 3BP5A 5A3IC 3MSPA 4PTUA 1PFCA 4MD0B 4YBQD 5C0BD 4NQCB 1PZUB 5DVKA 1AGFA 1I1AC 1PAMA 3GMOA 5DJDA 3C08H 1MVUB 1HHIA 4R4BA 1W72A 1F2XK 1J1XH 4S1QH 3O2DA 2BRRH 2A77H 1T22B 5ICZA 5FHBL 4QRTA 3MV11 1WZ1H 2AJXL 4E5XB 4QRPB 4OIIL 2E5EA 3L3GA 4I0PB 4JREC 3DI2B 1KPRB 1S7XB 4IMLA 5INCB 1G7PA 4K94C 3O45A 3CZFA 4BYHA 2UWEB 4YNYA 4N0FB 5E03A 4ALAH 4AEFA 3IU3A 2F8XC 4FG6C 3LS5L 1T1YB 2LABA 3HS0B 1FLRH 2LTQC 3PABB 4XWGH 3VJ6A 3N1MC 4W6XB 2R8SL 1U3HA 2XTJE 5I19L 4R90H 4DTGL 3WSQH 2L7UA 3G5YB 3DOSA 4U1NB 1GOHA 3SY0B 4G9FA 1FFOB 2GJ6E 3O11B 4LVEA 1BOYA 3TA3D 4XC3H 4ZPTA 1FO0L 4R7DA 3WFBL 1I1FB 5HSFA 3LEYH 4OLYH 1MWAB 4XX1E 1ZE3C 5GQBA 4OLVL 3T4AB 5DEGA 3Q6FB 2PR4L 3SE9L 1UJTA 3BUYA 1GGYA 1HH9A 3HE7C 3LN5B 1GVIA 3VI3E 5IFJA 5HHQA 2Y9RT 5DYOA 3CVIL 4Z7UE 3I3BA 3P30H 4L3ED 2BVOA 5AZ2L 4HKZA 4BZYA 1UVQA 2MSPA 5D93C 1KEMH 4HKBB 2DMBA 3OPZH 2J6EA 4RGOL 2UZYB 5SWSD 1NGQH 4I4WA 4ZFOA 1AQDA 3BGFC 4N5UA 1M7XA 4HF5L 5IW1B 1VFBA 3FT3A 4PJEF 5D8JL 2VLRA 1CE6B 3IRPX 1G0DA 1IAKA 3QUZD 3FQNB 5LBSL 2XZQH 3UTTD 2D03H 2D4FA 6CGTA 4CBPA 4HAFA 1AJ7L 3TT1L 5FHAL 3TO2A 4HC1H 1LP9B 1FBIL 1A1OB 1JGEB 1FL3A 3DX7A 3QI9B 3DGCR 4TOYH 5ITBH 5J6HB 4N1HB 4DGIL 2NLJA 5EN2B 4LKXB 4WNQB 3DXAD 1RAMA 3ES6A 1YYMH 5GGVL 4K9EC 2ADGB 3FB7A 4PJ8B 1AGCA 2NY3C 4KMTH 1JHKH 4YXKH 4LKCB 2BHUA 5DMIH 1KJ3L 1DR9A 2G60L 4BZ2L 2HJFB 1CLYL 1Q94A 3MLYL 4YIQA 3VD4A 2ZUYA 2VSDA 3ARDA 1A7RL 4M93C 3O8XA 2BK8A 3U0TB 1RZIA 2FEDC 4UINL 2H8PB 3F7VA 3ZE1E 3OQ3B 2VAJA 2ZG1A 3SQBA 5IMKB 4DK3A 3CPLA 4GRWH 5AG8A 4WW2B 2AXJA 4XAWL 1B2WH 3QQ3B 5EOCJ 5E08L 4PJ9C 2IG2H 3FFDA 4GRMB 5ADOH 5D7KE 1HSAB 1D5MA 1NCDL 2AV1B 3BT2L 4J4PA 4DN4L 5J06A 4Q9RL 4XP5H 2H6PA 4OTXH 5E8OB 3I6GB 5AZEH 2ICEA 4S1RH 4KGJA 3BEVB 3IJSA 3TESA 2JIXB 1ED3B 1TXKA 4MNGE 3LB6D 3TF7C 1I1YB 1UACH 3BMVA 4WO4A 3MX0A 3U46B 5CD5D 1JPSL 3ELAT 1YEEH 1C5BL 3RX5A 5BXFA 3QEUB 1GOFA 5ELIA 1CFTB 5IFHH 3BGMB 4RMUA 2FO1A 3C6LC 2EEAA 1TNNA 3HB3D 3UCRA 2CKBH 1ROWA 3GBML 4R0LA 1JPTL 3BQUA 3P11H 1T5WA 1OTUC 3BSZH 4I0CC 5J1AA 5E2VL 4DKDC 1FRGH 4P9HL 2Y36L 4XVJH 3DSFL 3UROR 2PO6A 5I1JL 4X7FC 2BOBB 4P2RE 4PRID 4LK4A 3VXUB 3T3MF 4MYWB 4JM4H 4CVWA 1QSZA 4P2OA 5IK3B 2XRAL 2EDWA 4XPAL 3L7FA 2IPKA 1XR8B 2EH7L 3BE1L 4X7TA 1KIRB 4JVUA 3P0YL 1T0NB 2NY2B 3HNVL 1F3RB 4BFIA 2OQJB 4FTVE 1LEIA 2OL3L 3EFDL 3RBGA 4R4ND 5JOPE 2IQAA 1VEMA 3JTTA 5I75C 3RZCD 3NCEB 4PP2B 4YLQT 1F3DH 1RI8A 1A7NL 2AJXH 1ONQB 4OIIH 4Y5YA 4IJ3C 4OZHF 5E00A 4RMTA 3S36L 3N9GL 5IVXB 4LFHG 2BSSB 4WDIA 2R23A 3TPUA 2LAAA 2YXFA 3U36A 2J8UB 1UJ3C 4QEGA 3LS5H 1BZ9A 1IGFL 5SV4A 1YN6B 1XZ0B 2R8SH 5C2UB 2FEEL 1E4WL 4JFFB 5I19H 1IGJB 1NFIB 4DTGH 4NWUL 5EFIB 4XNQA 2QSCL 3IETA 1VSCA 2DWEA 4OZFG 4PJAE 3HMXL 1NC4D 3VRLF 2A9NL 1D5IH 1F3JB 5DC4B 1MLCB 1CXLA 5CP3A 3RY4A 5JR1H 3HKFA 3WFBH 4LLDB 2XQYK 3MA9H 4OLVH 4NQDE 1CL7I 1Z9LA 2PR4H 2ZUTA 1OP9A 1U8JB 2IMMA 3SE9H 2YEZA 1A4JB 2BVTA 1E4JA 4Z0XB 4UZGA 4FFVD 3CVIH 4GS7C 5F71A 1BJMA 3BKYL 3NPZB 5AZ2H 3MV7D 2ORBL 2IADB 1E4KA 3FO9A 3MRPB 4H1LB 4RGOH 3RY5A 5AAMA 1IM9B 5D96C 4HF5H 5D8JH 4IM8A 5FA4B 4ZO8A 1XIWB 3B9KB 5LBSH 4UNTA 4FQXA 3Q1SL 3QEQA 3KPPA 1AJ7H 3SKNB 3TT1H 5FHAH 1K2DB 1FBIH 2G9HA 4HSQA 4RMQA 3GMLA 4PS4L 2BVEA 5IM7A 2ICWI 2J1KA 1S7QB 4MCYB 3U4AA 1AXSB 5DUBB 2ENYA 3CDFA 5GGVH 4XBPB 1S9XB 4RDQF 1WIPA 3IXAB 3ZHDA 4U4BA 3QDJA 1GJIA 1KJ3H 5DFTA 1YC7A 2NXYC 5F7DB 3ULUL 1FZJA 2G60H 4BZ2H 1MCFA 1CLYH 1ZT7A 4OLZL 2BMKA 4Y5XA 3ARFA 5HJ3B 4L8DA 4MXQD 2X2YA 3BW9A 1IAII 3X17A 4Z7WF 4GKZA 2Q76A 3ARED 3PGDB 1DDHA 2WQRA 3G5XA 4U1IA 2V2TB 4P23A 3WD5L 4UINH 5DJAA 3V8OA 3SKOA 3WE6A 1RZ7L 1NGPL 4FP8H 3NZ8B 1S7RA 1I9IL 1I8KA 1TPXB 5DHYB 3TEUA 4H5SB 1JIBA 4UILL 2I27N 5FFLA 5TE6L 3VXRE 3S5LG 1DQLL 5B8CB 1NCDH 3PL6A 1R5WB 1DVFD 3E2HB 1JWSA 1HHJB 4DN4H 5HYIA 4Q9RH 2WP3T 3DX6A 3UTSD 1DSFL 4NQCE 1M7DA 1XR9A 4U0QB 2Z4QA 5IVOA 3WMSA 3GSUB 1J5OL 2FGWL 4FFWC 4G6ML 2LVEA 1F97A 2A6IB 3IGAB 2DTML 1JPSH 2VLJD 5H8DA 4ZPVA 5EZOL 1C5BH 1IGYA 1KC5L 1CQYA 2HP4A 2P8MB 4FXKB 5SWQB 2X4UB 4L29A 3BPOB 3HMWL 3LAFA 1DEEA 3GBMH 4YDVB 1JPTH 1NGXB 1OHQA 1Y6NR 3OL2A 2XZCL 5KSAB 3E3QE 3LY6A 2X42A 1AHWC 1F00I 3FJTA 3MBEC 4P9HH 2Y36H 3T0ED 1WBYA 4LCWD 4WW1B 4NT6A 3DSFH 5I8KL 3LN4B 5I1JH 2NY6D 3RVTD 3BP7A 1YNTB 1Y18A 3KDMB 1IFHL 2J12B 3ESUF 1T6VN 4XT1C 3TNMA 4F8TA 2YZ8A 2XRAH 1NGYB 4XPAH 1JNLL 1MI5A 4NBYB 1EEQA 4BFBD 2WIIA 2EH7H 2HMIC 5C0IA 1ADQL 1U3YA 4YX2L 1FN4A 3P0YH 4BUGA 2VLMD 4BM7A 3QUYA 3T77B 3HNVH 4HFWA 4G8GA 4HMDA 3IFPB 2OL3H 3EFDH 3BPCA 2IAMA 1L9NA 4HZAA 5E8EB 1H5BB 2MHAA 5E6ID 4EQ3A 5HDQL 3RX7A 3CSYB 3DX9B 1ZXQA 1JWMA 1QEWB 3S36H 3N9GH 4UB0L 3S4SA 2X4NA 4KJWC 2FZ3B 1SJXA 5IR1B 4JZJA 2HLAB 2DI7A 3KLAB 1JN6B 4R7NA 4XC1L 4NBXB 2AEPL 3CFJB 1HHGA 3HE6C 1IGFH 1PLGH 4LDEB 1H3GA 1E4WH 1JJUA 1LP9E 1X5HA 4DUXA 2GTWB 4JFOB 2QSCH 1DANT 4J12A 3KJ6L 4KRNA 1CD1A 3HMXH 5D7IB 3QQNA 4IOIB 3X3GL 2A9NH 4DK6A 4HK3J 4QRQB 1EEZB 5SWZE 2X41A 4LLMA 1WISA 3GJFH 3MLZL 4PV8B 3QIUB 3NIDF 5F3BA 5DHXB 3BH8A 3MFFA 1G0XA 3NVQA 5EU7E 1SEBA 5FEBA 1OOAA 3RL1B 4YHIA 4X6FA 3OG4B 4NC1E 3GUTA 2DQFA 5JW4R 3QUXA 5I1KL 4G43B 4WHTB 1UKQA 3BKYH 5JXAL 5C09E 3VGGA 1P84J 2ORBH 3UTQA 3VH8A 4ZUWA 3RP1A 1FE8L 3G04A 3OTTA 5ID1B 2P5WA 2JB5L 4N1EA 3NFNA 1JPFA 3MLTA 1JPST 4GW5B 3Q1SH 1X5FA 3ULVE 1XGQA 4BQCA 4NHCL 1D5ZA 1XCTB 4RGNB 5DXWA 1U8HB 5A2FA 2QEJA 3PG2A 2GSIA 5JHDB 1T20A 4PS4H 1FG2A 2QV2A 4JFDB 4OQTA 5DI8A 1CICC 1NBZB 4KXZH 1KPUA 2DKUA 2Z31B 2ZCHL 1E28B 5FECA 1R5VB 1M7IB 1W8NA 1XF3A 5F7HA 3ZKNC 4UIKL 4C4KT 3RWDB 3VMPA 4K94L 1MCWM 3QCVL 4YHML 3GI8H 4P0DA 5CJ5A 3ULUH 3MNZB 3OXSA 4OFDA 1U58A 1WZKA 4OLZH 4K7PH 1BREA 2H2SD 4PJXF 5IHBA 4FXGA 4PJFB 2ICWJ 3BP4B 3U9PL 4AYFA 3WD5H 4ZFGL 2ARJB 3GZKA 5B3JE 4JM2A 1RJLB 1RZ7H 2EDDA 2GK0A 2Z93B 4KK9C 1HI6A 2EYSA 1U3HD 1I9IH 1QLEL 1TZHB 4GO6B 1ZHLA 2EDFA 3QUMA 5ESAA 2FECI 4UILH 3PP3H 5TE6H 3VXUE 3IDIA 1P9MA 4AK1A 2X09A 1DQLH 4XPHL 5TH2B 3TO4B 4D9RD 5CBEA 4N0CC 3RGVB 2VB5A 1RFDL 5DD1L 1DSFH 4YDLC 1DBAL 4XHQA 1R3KB 3X14A 3FB6A 2G75B 1JYWA 1SVZA 1CGSL 5AD0B 3MGTB 1J5OH 2FGWH 5IROC 1A7OL 3ARGC 3ZKQD 4P5KB 4X6BB 1ZT4A 4XTRC 4ORGB 5MEOB 4OZGA 2DTMH 2ARWA 2X05A 1HHHB 2UY6A 2DQEL 4XI5D 1TTFA 2R1YA 3ARRA 5EZOH 2WUCL 1TTGA 5JPNB 1KC5H 5T1LA 5HI3D 3L3OB 4X99A 4F7CA 1HXMA 3OKDB 5BOZG 3EYVA 4I48B 4JO3H 3HMWH 1XFPA 2FWOA 4OM0H 5H94B 4M6NL 3DVGA 3RGHA 2FR4B 3QDMB 5C0FB 3LMJL 5CILL 1ZV5A 1G7HB 1JZ2A 4ETQA 2VLRD 2VABB 2PXYB 4DUWA 4TRPL 5JW5A 1IEBB 2IH1A 4YBHA 1NUNB 3P9MA 5GZOC 4GRWB 1WTLA 1G1CA 5I8KH 4KAQH 1MHPL 3W39B 1WF5A 4X98A 3VFMB 1IFHH 3H9YA 1UZ6E 3TCLA 5JMOC 1A4KB 1A9EA 1T66C 1JNLH 3SOBL 2BHZA 1NGZA 3RDTC 3ETBF 4YX2H 1NLDL 4P57A 3VW3H 1KB9K 1CDYA 1MCJA 1ZHKA 3R0MA 4OI9A 4X5XA 1K3IA 1INDH 5LG1A 1QFPA 3F62A 3ECBB 2AK4B 1FV1B 3ARDD 1MFNA 1EZVY 3QQ9D 5K59F 2CD0A 5LKNA 1T5XB 4G7VL 4UB0H 4Y4KC 3PDDA 2DQJL 4UQ3B 3RTQA 4ZTOH 4JGJA 3CXHJ 3EHBC 3MQIA 4WGWB 5CJ8A 5IBLD 2CKBB 1YUHB 2OI9B 3FMGH 2Y72A 4XC1H 3OJMB 2AEPH 1YPZB 3MV9B 4HJJH 4E42B 3SDXA 1BQUA 4ODTL 3QIWB 3SPVB 1KULA 1PKQE 5C8JB 4LQ1A 5BRZA 4P3WA 1CFSA 1D9KC 3DX8A 3QXAA 3CVHL 4WFFE 1QRNB 3CH8A 3KJ6H 4O5LL 2WLZA 4CDHA 4PG9A 1I7TA 4DVBB 5DJ8B 5T3XL 5GRJL 2QBWA 2NXZD 3X3GH 2ICES 5EOQL 1KG0A 1MJJA 3DMMB 1HILB 4B41A 3GO1L 4M3JA 4FABL 2HYMA 1F02I 1L7IL 5BS0A 2AQ1A 2VXSL 3JV4A 1NSNH 3QNZB 3T8XA 3MLZH 1N0XL 2GFBA 3JWNC 3M8OL 3TBVA 3DVNA 4WO4D 5IB1A 3BN9C 5EO0A 5FF6A 2VZVA 3F7RA 3LSOA 4APQB 1OSZB 5I73B 4G9DB 1GZPB 2NY0D 1G9EA 3DROA 4R9HA 5L9DL 5I1KH 5CP7A 2NR6C 4NJAL 3VRIA 4ZAKB 1T1XB 5JIKA 1I1AA 5JXAH 2Z35A 1U8MA 3U48A 1H3UA 4LSRH 5C0ND 1FE8H 3QULB 1JGDA 1H3VA 2JB5H 1T3FA 3UC0L 1SYSB 3T2PA 4XXDB 5TFSL 4F33A 4YHNB 2D3VA 2VXQL 2PO6D 4NHCH 5EU4A 1J8HE 1FNGB 4YHYB 5I71C 5D7JD 3OZ9L 4P5MB 2OP4L 4RZCB 1ZLUH 1IC5L 1FZOA 5I30L 2UYLB 4Z76B 1NFDE 4RRPA 3QG7L 3OF6A 4P2OD 3QH3A 3FL7A 43CAA 2XICA 2C4FU 4NKDB 3PWNB 3OKMB 1SEQL 1MHCA 5J3HC 4HDIA 3IDMA 5DJZB 2X4SB 4PGBB 3O6KH 1NANH 5KG9B 2HJLB 3NMEA 5HVFB 4QHKJ 2DBJA 4UIKH 2VUYA 4HW6A 4Y5VA 1INEL 4K94H 3QQ4A 4YHMH 1BM3L 4IIQA 3PJSB 4K8RD 2DRUA 1EERB 4G8IA 1UM5H 3HRPA 1OP3H 3D48R 5ISZB 3ARYA 1ULVA 3K4AA 1W72L 3O3BA 3GJEA 1OAZL 3O2DL 3TIEB 3U9PH 5K9OA 4ZFGH 3RUGB 3PNWA 2R1XB 3C8DA 5D1XB 5TDPB 5C07A 3LQZB 4PLJC 5I1HL 1IQDB 3L3HB 4YWGL 5HYQB 4R96A 4PJIF 1R0AL 2DS4A 4OI7A 5HGAB 5BVJB 3RJQB 4WY7L 1MHEA 1MCSA 4XPHH 4KRPB 4N90E 1OVZA 3UYPA 4N9OB 3W9EA 5KN5B 5D1ZB 1DBAH 4JHBA 4JKWA 3GSOB 2F19L 1IGCL 1CGSH 1T1ZA 1X4YA 1A7OH 2VISB 1A3LL 2P42B 1U2CA 5HY9A 3B2UC 4N8VG 5E5MB 1QTYT 2DQEH 1TJHL 5I17A 1SBBA 4ZD3L 1KIPB 2WUCH 5IEHA 4MVBD 4MSWB 5IKCB 5C0CA 3BEWA 2EZ0D 1C8PA 5LAXA 3H9HB 2UWEF 1G7IA 5FUCC 3P4MA 5FYJL 5H37G 2P5EA 4PJBB 4OCMC 3UPAA 3MNVA 3MXVL 4M6NH 1UGNA 4FZEH 4MA7L 5C0JA 3QO0A 1IEHA 3LMJH 5CILH 5GRVK 1FC2D 9CGTA 4M62L 4AZ8A 2CDFA 2HT3D 2OMNA 1ZGLA 4TRPH 1ACZA 4FQXD 4N68A 4U6YA 4OUUA 2HT2C 2JCCF 4X5LA 3U0PB 3KXFB 3QEQD 3GB7B 3SDAC 5D7IE 2J6EL 3W5NA 3KAAA 3VD3A 1MHPH 4ZFOL 3D85A 3BH9B 4Y4HA 3LKSB 1N59A 1ZHBB 5HHOB 1LK2B 1JV5A 4GW1A 3SOBH 5IMMA 4ZS6D 3JXAA 2X1QA 3KPRD 4H25A 3NIFF 1NLDH 1DFBL 4Y16C 1S7UB 1SJHA 2EKJA 2IBGA 1GZQB 5FYKU 3QDJD 3O2WL 4OZFB 2PCPB 1SJEA 1KEGL 3UJIH 1A2YB 2XTJC 1S9VB 3S35L 3ARFD 2HJKA 3FT4B 4KV5E 3NCYS 5MENB 4FMFA 1NCCH 1AY1L 4XNZB 4G7VH 1B6UA 4U1KB 5E94A 3V79C 4P23D 3BKML 5DS8A 2DQJH 2ERJC 1S3KL 3D25A 4LGSB 4GH7B 2B7DT 5HTSA 3MUY1 4N9GA 5I0ZA 4L9LA 3FO1B 5KTEL 4RAVA 4JZNB 5DLML 1K4DA 3QDAA 4RGNE 2HFEA 4JRYB 1FYTE 5JHDE 3CVHH 5E9DA 5KW9L 5FO8A 4WI9A 3PL6D 4JFDE 1P4LB 2VNCA 4ISVB 4NUJB 4PY7B 5GRJH 5T3XH 5KJRL 2XKNB 1AR2A 5MEQB 1BD2A 5EOQH 1VESA 4U7KA 5CINL 5DDHB 4UUJB 3MRLA 3GO1H 1RZJC 2E6PA 3QXWA 5C0AB 4FABH 1L7IH 4MNHA 2VXSH 4L4VA 1HIML 4HIEA 3EAKA 1MRFL 2P8PA 1N0XH 3WFEH 4Q9CA 3AGVA 1IEAA 3MA7A 4P46B 4UTBL 3L5WB 2VLKE 1IRAY 1IM3B 4MAYD 1RHFA 3R06B 1CE1L 2DMCA 5IWLC 2A74B 2JE8A 2ZNXA 3VWJC 1U92A 4NJAH 2OL3B 2A0LC 3W0WB 2GJZA 4PLNC 4DFHA 3RIAF 3O6LL 3T2NL 2NY5L 1OAUH 2BY0A 2YPKA 4PP1D 1P6AB 1F45A 1CDIA 4WW2F 2BJML 5DRWA 1XH3A 5EIIA 1GOGA 3GMQB 5IVZB 5L2KA 1HSBB 3SCMA 3BZFB 4YGVB 2ATKA 3DYPA 5TFSH 1UWEL 1HXYA 4LF3A 4NQEA 4YZFF 4X4XA 5DFWH 4KZEL 2ZUUA 2NY4D 2YD8A 3P73A 3H3KA 1YZZA 3OR6A 4NZRL 3UYOD 5BV7L 2WP3O 1C12B 2I07A 3OZ9H 5HPMB 3O3DB 2OP4H 1IC5H 4Z5RA 5I30H 2N4IA 1I8IA 3QG7H 3EDKA 4B53A 3STLB 5I1AB 3AU1B 2X1XR 3C6SB 3QJHB 4NZUL 3UAJD 3MV01 4GRLB 4PRPA 1MFDH 1PG7X 1QSFA 3QUYD 3S5LB 1X6NA 1U8NA 7CGTA 4G8GD 5ALCL 3GJFB 2LU4A 3WEXB 1KJMB 3KWWA 4Y4FB 5A16A 3IAPA 1INEH 3QWOA 3SJVE 2IAMD 1L9MA 2CXKA 1BM3H 4ZFZB 1JK8B 2A6DA 4KKAC 1LO4L 4M03A 2W9LA 5HVHB 3KPSE 4LP5A 5F6IB 4Z18A 1RJYA 3BD5A 1W72H 3UTPE 1Z5LB 2ESVE 4Z7VE 1OAZH 3RWCA 3O2DH 1U8PB 5D7LE 4JFYA 4K8RL 1LEKB 2CK2A 2SEBA 4LGPB 3FFCB 5I1HH 5GIRB 1A6WL 4XCFL 4GRWE 1UKSA 1V3MA 3DYOA 1RJZA 3Q5YA 2WV3A 3PP4L 4HJ0D 2F54E 1WWCA 4WY7H 5KAQF 1TCMA 1XGPA 2F5AH 2DQCL 3QA3B 3VE0B 4EI5C 3K8KA 4NSKB 2H2PC 4CN4A 2PW2B 3BZEA 2AGJL 4QHLA 3V6FA 2X9YA 4Z7OF 1JPGB 5D2NE 1AGDB 1T7VA 3LKOA 2F19H 3AS3A 1IGCH 1OGTB 2BC4B 3WJJA 1VADB 2DIAA 2O61A 2RFXA 4FRWA 3VXTB 5ANMA 1A3LH 4OD3L 1BF8A 3QBTB 5D7SL 2AK4E 5FIEA 4ZD3H 2Q7YA 3F12B 5IVXF 3CDCA 4EDXA 1U41A 1RVFH 5DZLA 3SDCC 2X4TB 5T1KA 2J8UF 5FYJH 1FYHB 4N0UB 3L5HA 3NCCB 2DOCA 2ZUSA 3TBWB 3DUSB 1OB1B 3U2SA 3MXVH 1ZSDB 1HDMB 3B3IB 2P5WD 1YPZE 4KJPC 4OZIA 1AGEB 2EE3A 3MO1B 5J4MA 3D39D 4M62H 3D2UB 2ZJSL 5JORA 3K0WA 3EDEA 1N6QL 2YD6A 4PJ7A 2J6EH 4TNWK 1AO7B 3BO8A 3WDHA 1OM3H 2EYTA 2FH8A 4UAOC 3RL2A 4GBXC 3HPLA 2V5RA 5K9QG 5EU6B 4OD1L 1HEZA 4K3EL 3HUJB 1R24B 4LLWB 3U7YL 3RKPA 5HBBA 2QADD 4PJDF 2FO4B 2XN9E 2BVQB 4NZDA 1DFBH 1U95B 1YMHB 2WWKT 3ARBC 5DQJA 3O2WH 4AJ0A 3FCTB 4IRJB 1QBAA 2HKHL 4ELMB 4NO0D 3OGCB 5DC9B 2AXFA 3S35H 4RISH 4PGCA 2IF7A 2BCKB 1AY1H 5CSZB 1H9VA 2ZUQB 1A1MB 4OCWL 5DMYA 3BKMH 2Y7QB 1OT1A 1FPTL 1S3KH 3GSWB 4JM2D 1IKNC 4ZUUA 3TZVC 2KUTA 1UM6L 3KS0J 4LLUA 5D6CB 3ROOB 4ERSH 3O6FA 5KTEH 1S7SA 1XMWA 2DM3A 5DLMH 1UZ8B 5K9JL 2YSSB 3BWAA 4FQ2L 5IQ9A 3NA4A 4JPKH 2E7MA 5KW9H 4Q6YA 4JFEB 5IIEB 3HPJA 4DZBB 4M8QB 3JZ7A 1KXTB 2CJUL 3B8SA 1UXSA 3K4DA 3QO1B 4KROC 5CINH 4FQJL 2DI8A 1I8MA 3TBSA 5D70L 1HIMH 4C4KO 3P4OB 1MRFH 4NQVB 2W9EL 1FZMB 2OJEA 3QXDA 4R3SB 1UENA 4UTBH 2OR9L 2DKMA 2WM0A 1JNHA 1KTLB 1SY6L 1CE1H 1K9TA 2J88L 3QISA 2EKSB 3NH7L 2ITCA 3ULSA 5T1LD 2VERN 5DQDL 3DNKA 5DRNA 3AB0C 3U83A 2D2OA 3EOYG 4KJYA 3O6LH 3T2NH 1Q9KA 2NY5H 5F1IA 5AUMA 3RUGE 3JTSA 4GXVH 5CJXC 1HHKA 3PHQB 1R3JA 2BJMH 3BKCL 5IJVA 4QY8B 3OKOB 3M17A 4HV8B 3VFSA 1A6VL 2YOCA 3QDGB 3DRTB 4X6DB 5KS9E 2NTFB 3IDYB 5CUSL 5DUML 1UWEH 4X83A 1CDGA 3VFOA 1OAXL 3TN0D 3DPBA 4Z7NF 3CXDL 4KZEH 1B4RA 3HZMA 5BV7H 1DUYA 3L3DB 3K1DA 1AD9A 3D3VE 3HE6A 3RVWC 2CLZA 3RKDD 3TVMD 2HG5A 3MJ8B 3LD8C 4NZUH 1C08B 4OCRH 2B5IB 4MHHG 1AKJB 4MA1C 3ZE0F 1EA9C 5D1QB 2EXYD 2X4QA 3FQUB 5ALCH 3KLSA 1F11A 2DQUL 3QIBA 4CW1A 2QSVA 3TPKA 3ZSTA 1LO4H 4EI6A 3V0VA 3GSRA 5ITFA 3HRZA 4EBQL 1EBPA 3A6CL 3S96B 3MNWB 4KKNA 3P9LA 5D5MB 3RTQD 4Y19A 5E24E 5EZLB 1EUUA 3C9NA 1G7LB 4U6HB 1ZMYA 4PJEA 4DCQA 5BQ7B 1K5NA 1A6WH 1IC4L 1ZLVH 4XCFH 4AEIL 4I18B 4QOKB 4XCYA 5EUOE 5BRZD 1A6PA 3WL9B 3PP4H 3RWIA 3H0TA 3SO3B 4YHOL 3V5DA 1R3LA 5HHOE 4QHUA 1E27A 2AGJH 2HFGL 3TYFB 1D6VL 3Q3GB 5AWNL 5TF0A 5L2JA 2XPGB 1CLCA 3IF1B 3REVB 2NYYC 1RU9L 4HUUA 4XMPL 4UTAH 3FOLB 3I02A 5DJ6B 3KHOA 3MC0A 3E3QC 4OD3H 5EIVA 5JW4Q 4U31A 5D7SH 5CP3H 4FQQB 2IPUG 2A6JA 1C5DA 3PGFL 5F9OL 4XRCA 5MENE 4OT1L 3HZVB 3C8KB 3T3PF 3PQYA 1I1AD 4HEPG 4K3HA 4LSTH 4JHWL 3UPCA 4PJGE 5CIPH 3Q2CA 2E9IA 3G5VB 3EFFB 3N1FC 3PWPD 1U8KB 4L8CB 1FHGA 1IZJA 2GKIA 3FB8B 2JK5B 2ZJSH 4JRYE 3QRGH 3FRUB 5D7IF 3DV4B 5EB9A 5TDNA 1N6QH 3BP6A 2ZUWA 1KSRA 4BA8A 2D7QA 5CHNB 3AMLA 4FG6D 4H20H 1KNOA 1M05A 3OF6D 4HUWA 2ARJQ 2FDBP 5C0AE 2QLVB 4TN9A 5F9JA 5EO1A 3QFJA 4F37F 1A6ZB 4PJCB 1JZ3A 4K3EH 3U7YH 4CU8A 1VKXB 4P4KB 3VFRB 1YEDA 3N0PB 4NPYA 3B9DA 3PWUA 4L4TD 4D9QE 4OQTL 1PZ5B 4RAUA 3MZTA 3CX2A 2HKHH 2IWGA 3W0WE 1MFCH 1XAUA 3RWGB 4KV5F 4XGZB 5F7KC 4NIKB 4JPVL 4YHZL 3C8HA 4YHPA 3EJZC 3QI9C 5HGHA 5IROA 4YR6B 3HLAA 2YD4A 4WWKA 4Q2ZA 4UU9B 5TDOB 1AQKL 2FX9L 3UX9B 3HE7D 3QEHB 3V4UL 2C3VA 4JKKA 1UM6H 5C07D 3DGGB 4PRAA 1ITBB 4E41B 5K9JH 1I85A 3X11A 3R1GL 4ODSL 5EU7C 1Y0LB 4FQ2H 5DHVA 3IRZA 3N1QC 2GY7B 2QKIA 1NDMA 5HYSA 4GT7A 4NC1C 3E6HB 2D7MA 3GJFK 2RR3A 1NLBL 1Q0YL 2ZOLB 3OKYA 1OLLA 2CJUH 4XNXL 3QUML 5ICXB 3L95A 2M8XA 2NY3B 1NFKA 1NCWH 4FQJH 1RUQL 3S6CA 5D70H 1S9WB 4HK0B 4R2GC 3GGWA 1KN2L 2NTSP 4WW2C 5F3HA 3T09A 2X4PB 1SY6H 5C9KA 4PJFF 2J88H 4B5EA 3GSQA 3NH7H 5D2LB 5C0CD 3ULVC 4UDTA 5DQDH 1AGBA 1BFOB 3HZKB 4OZHA 3VGDA 2P5ED 4HLZG 4U6XA 2IH3B 1OGAA 1V7NL 4H26B 2XG5A 3OX8A 1WT5A 1YMMA 3BKCH 3GIZL 3FFCE 1IE5A 4PJ9B 3VXQB 4LAJH 4ZOAA 1KIQA 2YD9A 5MI0B 1CXFA 5I1LA 5DUMH 1AFVL 1EJOH 3F65A 1OAXH 1T21B 3C5ZB 3AM8C 3B83A 3GSNA 5ENWB 3D85D 4JO4L 4Y4HD 2EYRA 1C7TA 3JWOC 4JN2B 3RIFK 3CVHB 1QQDB 1MJUL 4Q6IB 5HYFA 43C9A 2BNQA 5DJYA 5GS0D 4BELD 3HAEA 4PRHD 3O4LA 1D9KA 1H8NA 3LKNB 4GAYA 3JUZA 4JB9L 5L7XL 1CG9A 1NBVH 1J05A 2YS4A 2ITDB 4JDZB 3OSKA 5CJOL 4MDJA 2R0LL 2DQUH 1HCFX 3C6LB 5E2UL 3VMOA 3ULUE 5ACZA 3QHTC 1DQDL 5FV2A 2EC9T 1VCAA 3GHBL 2F5BL 3DXAE 2Q3AA 3KGRA 4EBQH 1EDQA 5CBAA 3A6CH 1X4XA 1B0RA 3K80A 3WUWA 4WHCA 1J86A 2FL5B 2NNAB 4F7MA 4ODUB 2UZIL 3BRGC 4N8VB 3PP3K 4LHUD 3MJ7A 3O3AA 4ZXBA 5FYKD 1IC4H 4AEIH 2J7LA 2WWMC 3DRQB 4ONHB 3G5ZB 4QLRA 2VN7A 1MCIA 1RZJL 4I3SH 5HYEA 3TBTA 1GCFA 1NGWA 2I60L 4U1GB 4WU7B 2I9LB 4YHOH 3NFPB 1OTUD 4HWUA 4QRSA 5EU6E 4EJ1C 3QWQB 3H9SB 2HFGH 5AWNH 2WUBL 4QHNB 3CUPA 1T03L 15C8H 2PYEB 1AC0A 4L4VD 32C2A 3HG1A 4A6YA 5L88L 1NAMA 2IANA 3KLDA 3OHXA 1RU9H 4LPYA 4Z77A 3MTRA 1W0YT 3FHAA 4XMPH 4M8VA 5EU3A 1RQ5A 3KG5A 4PTTA 2HLFC 5HDBE 2WANA 1MCOL 2RBLA 5I15L 4JLRA 3PGFH 4WFGD 2R69L 5F9OH 3TJEH 4OT1H 1I4FA 3U7AA 3Q48A 1JRHH 3R8BB 4JHWH 3WFZA 1CT8B 4Z7WA 4YPJA 1Z2KA 2R0KL 4P2CG 5GGTH 2BSED 1W72B 2X4OA 5L2KD 2MJWA 3LKQA 3SCMD 3HR5A 4PJ5A 1MCWW 1PJ9A 3VXMD 3NZHL 1UT9A 4JFQA 4NQED 2H41A 4H88L 5ICZB 1JUFB 2DIBA 4IMLB 3D18B 3H8NA 3HZYA 1NKRA 1DQJA 1CLZL 1UH4A 3FQXB 3VFWB 2VSCA 1MHHB 2AV7A 4LAQL 1WFNA 4I77L 4DGYL 5EC2A 1NUGA 3IFOB 3RZWA 2ATPB 3B9KC 4S0SD 4JHAL 4G9FB 2YRLA 4ONFL 2C3XA 4QRRD 2FJHA 4V1DA 4AIZA 2R0WH 2AQ3A 4JPVH 2CK0L 4YHZH 3O3EA 4BQ8A 4V2CB 4R7DB 4LSUL 4ELKB 4P3DA 5T3ZD 3TWCL 2LAGB 1AQKH 1TVDA 4K3JL 5I1CL 1BVKA 3V4UH 5CEZD 4ZSOA 3BUYB 2VQUA 1HH9B 5IFJB 4NN6C 4XWOD 1BQLL 5FKAA 1NCAL 3FRPA 1U8IA 3R1GH 4ODSH 2YPVL 2W0KA 2BNRA 2PTTA 4HKZB 1UVQB 5F21B 3MV8A 3PXJA 3BHBB 3I6KA 4ZFOB 5JMRA 1NLBH 1J1PL 1AQDB 1Q0YH 2XWBA 2BOCA 4XNXH 1KOAA 3WXWH 3QUMH 4XCNA 1VFBB 5CWSB 3IJYA 1SYVA 1RUQH 1A14L 3B9EA 2W9DL 3LV3B 3UBXG 2NXYB 2FHCA 1CXHA 3TO2B 1KN2H 1TPXC 5DF0A 4LVNC 3EO9L 1HYRC 2X9XA 3S98A 2VDKH 3GBNL 2DQTL 2RCSH 5T1KD 2XZAL 3E2HC 1LHZA 5D5ME 2NLJB 3IKKA 2UV3A 1V7NH 4NN7B 1AGCB 3GIZH 5TQ0H 3WN5B 4D8PA 2ENSA 3MGOA 4BFGA 4UT6L 3NCYP 1ZAGA 1ZLUK 1AFVH 5DJXA 1FVDA 4MDIB 4DUVA 2DJ4A 3UPRB 3O8XB 2DAVA 4Y1AD 2GJ6A 3F58H 4U7SA 2P44B 1RZIB 4HKXB 5HDOA 1HKFA 4JY4A 4RNRA 1EV2E 5K9KA 2B4CC 4ZO7A 1JZ7A 1MJUH 5GRXG 1KTDB 3WNNA 3MRMB 3IDJA 2I5YL 4U1LA 4U1SA 4DW2L 3WO3B 2HWZL 2HTLD 4JB9H 5EU5A 2H9GB 4OLXL 5L7XH 4JHZA 3GI9H 1OP3K 5CJOH 2Y07L 3BYTA 4PJBF 5E2UH 4JFZH 2H6PB 1FNAA 1DQDH 2JELL 3GHBH 4NNXA 2F5BH 1MJ8H 1J0HA 4NKOB 4KK5C 4F7TA 2ADFL 4FFWD 3QJFB 1GGUA 3OBAA 4HGMA 1AHWB 3S8WA 3KYNB 1XF2B 2UZIH 2LVCA 2PYFB 3P4NB 3KPLA 4TTGA 5KSBF 2O5ZH 4F9PC 4PLOB 3VI4E 1OQOA 1RZJH 1YEFL 1LDPL 2Z0BA 2AJ3A 1H5BC 4HIIA 5KZCB 2I60H 3F7QA 3BQUB 5BV7B 5FXCH 1T5WB 2MMXA 4PJCE 4C56A 4P4RA 3MBED 1FQ9C 1TDQA 2WUBH 1T03H 4PGDB 1SBSL 4OCLC 1ZA3B 4ODXB 4JN1L 4KI5E 4OCYL 1NBYA 4P59L 5DD0L 3QPQC 3UTSE 4N8PA 4E0RA 1MCOH 4HWNA 1J0KA 5I15H 1LO5A 3TNNA 2R69H 5ESQB 3CFDA 1X6LA 4PJXA 3BN3B 4X7TB 4KKCC 3ZE2F 2BERA 4M7LL 3DECA 4J3SA 2YA2A 1Q9LB 2VLJE 4G8EB 1OP5H 2R0KH 1B90A 3MRRA 3WXVL 1HK6A 5DRXA 1LEIB 4EZMA 2YHGA 4F9LC 3G6JE 4LMQE 3DTXB 1EAJA 2F58L 4NNPL 4UQ2B 3ABZA 5C92A 2IGFL 2VIRB 5E00B 1AR1C 2VYRE 1QSEB 1CLZH 4MJIB 1ND0B 4WDIB 2R23B 1BZ7A 1LD9B 2KH2B 3U36B 4LAQH 3HE6D 3VCLA 3MRJA 3REWB 4I77H 1BZ9B 2R2HB 3SGDI 3T0EE 4LCWE 6FABL 4GUPA 2BXYA 1MCDA 5E2WL 5IHZA 4DGYH 2JJSC 1CDUA 4NRXB 1BVZA 1DCLA 5D2LE 1JZ8A 3QIBD 3IETB 4JHAH 4ONFH 3U79A 4RGNC 3IFLL 5DMKA 2Q1EA 4YAQA 2CK0H 3DVIA 2IPTH 3PHOA 5IW6A 2QSQA 4LSUH 2D0HA 5HHNA 2X1PA 3TWCH 1RULL 4K3JH 1NC2D 5I1CH 5CIPB 4YXHL 2ZG3A 2J8HA 3ZKXC 5I76A 3UO1L 3SDCA 1ORQA 1NCAH 2AEQL 3MRKB 2GUOA 2DYPA 3LKPA 4P2RA 2YPVH 3V0AC 5J6GA 1W0VA 3MCKB 2C1PB 4JE4B 3KYMA 2VZOA 1YN7A 2GY5A 4GG8B 1P7QD 2EXWC 4MJ6B 1OW0A 1RIUL 1JWUA 1Q9OA 2AABL 1J1PH 4JDTL 4LARL 4ACPA 4WJ5A 5ESVA 2ZNWA 2W9DH 3KPTA 1Z3GL 4HBCL 3GMRB 1NDGA 1F42A 4WI8A 3KPPB 3ARZA 1KCSL 3AS0A 1JMZA 3L3IB 4QGYA 2G9HB 3EO9H 1CICD 1ORSB 3GMLB 2R2BB 4O2EA 3GBNH 2DQTH 2XZAH 4GMSH 2LU7A 4QXUL 3QUKB 3RNQB 4IRSB 3RGVC 4EN3B 3VDBA 3BWUC 3KPQA 4J3XA 1OD7A 3ZKND 4J1UB 3V7AG 2HRPL 3VXSA 4OLUL 2ZWLT 3HR6A 3BMWA 1AE6L 2DN7A 3IXTA 4UT6H 4JCLA 1YY8A 5D6DA 5L6YH 1SJVA 1ETZA 2BMKB 3SKMB 1QRKA 1JTOA 1ZWIA 4YDLB 3H9SE 4P2QB 1T4KA 5DGRA 1KCLA 4K7FA 3MRBA 1CD8A 2C3HA 4QTHA 1N2RA 5DJAB 3WE6B 3QFJD 3QHZL 3NCJL 2OCFD 3X12A 4M7KL 3GRWA 4C55A 3VWKB 1I8KB 3VD9A 1TCRA 2HWZH 5GISL 2PXYC 1S5HB 4OLXH 4U1JA 3ZDZE 2IFFL 4N0CD 4RFNC 1NCNA 1T0MA 3ULUF 2Y07H 4O58L 5L0QB 5HYJA 1KCVL 5D9SA 1M7DB 3VXOB 2JELH 1H15A 1KCKA 1FNLA 2Z4QB 3ARGD 3QCUH 4XTRD 4JDVB 4P5TA 4WWKD 4HUXA 1N7ML 1BLNA 2CDGA 5EDXA 1T7XA 4OCNC 4U6VL 5D2NC 4LLAA 4Y2DB 1T2QL 3MRIA 2Q6WA 2OSLA 1FVCB 3AVEA 3H7BA 5IV2B 4FQHB 1YEFH 1LDPH 5CJXA 1ZLWH 3FT2B 4HEME 3HUJF 3WFHA 4JRXA 1LE9A 3RDTB 4BUHA 4YGAB 3OKLB 4OSUL 4Z7QE 4AENA 3EOBA 1SBSH 4X6CB 5GZOD 5E2TL 4ELMF 1WBYB 2OI9C 1K4CA 4YO0A 3LCYA 4NT6B 4OCYH 4G9FE 5HHVH 5CD3B 2I9TA 4D9RE 4OF6A 3QIWC 4HX1B 4XH2B 4P59H 2C4FT 5DD0H 5I16B 2B2XL 4RAHA 4LLYA 1Y18B 3BI9X 5H2BA 5F9WB 2DLIA 1VFAA 3BZDA 3DLQR 1MI5B 2WIIB 2F53B 5FYJE 1R3IL 3LPFA 1FN4B 3ORJA 3DMMC 1YMMD 4EUPA 2P45B 2AXHA 3L5XH 3WXVH 4UI2A 2PETA 2KDGA 2FLBT 4LSPH 5FDWA 4PJIA 5I66A 5GS2D 2AAVA 2MHAB 3CNKA 5I73C 4WUUA 1IAMA 2F58H 4Y4KD 1ZT1B 1JWMB 4HUKB 4F2MA 2IGFH 2XYCA 3EHBD 2X4NB 5JUEL 1LO2L 2JJTC 2DBLL 4JZJB 2VLRE 1O7VA 1EHNA 2VL4A 1MVUA 2B0SL 4QCIB 4XVUC 2OM5A 1I9RL 1CK0H 3A6BL 1U8OB 3X13A 1V3JA 3CSPA 5ECJE 2CIIB 4FA8A 1D9KD 1EFQA 1CQKA 4ZFFA 2OXHA 4HBQA 3EUUA 3S37L 4WCYL 4G6FB 4QRPA 1JBJA 3MOQA 4JJ5B 4I0PA 3NCMA 1KPRA 1S7XA 5INCA 4KTDH 4G6AC 3IFLH 4JY5L 2W91A 2OBGA 1F4XL 2UWEA 4N0FA 1XGTA 4IOFC 4KI1A 1FG9C 4LLMB 3HS0A 2XWTA 3KPOB 3BN9D 2CSPA 4X6DF 1RULH 4AQ1B 4KQ4H 3BH8B 1ZTXL 5E8PB 4YXHH 4ODVL 3RVVC 1CD9B 1RHHB 4WEMB 4X6FB 4KK8C 1CS6A 2NR6D 4ZXBD 1A64A 3SY0A 2FIRT 3UO1H 3GUTB 2YUZA 1FFOA 3QUXB 2OTUB 2AEQH 3L3KA 2JCCA 4BSWB 3O11A 4NHUA 1G7JB 1VEPA 3LRHA 1RK0B 4HIHB 1BX2A 1XF5B 5TPWL 4ZUWB 1RIUH 2BNUB 5GHWL 3G04B 5SWSA 2NX5D 3Q6FA 4TSCL 2AABH 3NFNB 4JDTH 4LARH 2NW2B 3QUZA 1G9ML 3B2VL 3HG1D 3UTTA 1X5JA 5D1XC 3LN5A 1Z3GH 4JFXA 1QHOA 3N85H 1KCSH 4F7EA 2GSIB 3QEGL 5JQ6H 1FG2B 5J3HD 4HKBA 1JE6A 3U30C 3FOMA 4NUGL 1ZS8A 3WHXA 4QXUH 1IGML 4URTB 4KRPC 5F7MC 5IW1A 1PD6A 5E8DL 3WNKA 5FDYA 5IMLA 1CE6A 4Z95L 5D1ZC 4CRPA 3L1OL 3FQNA 4EVNA 2PF6A 1XF3B 3B6SB 3I75A 2HRPH 1X7QA 3RQ3A 1KENL 4PJ5D 4NZTL 1AE6H 4X0KB 3M07A 4XP1L 3WS6A 2Z9TA 5JZ7C 3OXSB 1U58B 2ZPKL 3QI9A 3DUUB 3DARA 4NRZB 5J8OA 1JZ5A 4AMKL 5J6HA 3MLWL 4FXGB 4NRYB 5EN2A 3VFVA 5J13B 1BJ1J 4WNQA 3SGJC 4M7LT 5GSVB 1Q38A 1H8OA 4PLJD 2ADGA 4PJ8A 3NCJH 4EEEA 2GK0B 4F3FB 3T4YB 2J3SA 4LKCA 1I75A 1ZHLB 3QUMB 3OAZH 5ESAB 4PJHB 1N26A 2HJFA 3D0VA 3OGOE 5GISH 2VZ1A 3IDIB 5JTWA 2VITA 1KV3A 2IFFH 1KXVC 2BDNL 4O58H 4MJ4A 4QRUA 3WBDA 1J1OH 2YPLD 1EEYB 3U0TA 3OMZA 4LVOB 2H8PA 2EIZB 3O41B 3FB6B 3MREA 4MZ3A 5E4IA 4TVPL 4PBVC 1X5KA 4WW2A 3INUL 5FK9B 1ZLVK 1WQVT 1N7MH 5EULV 3RU8H 5HGDA 4GRMA 4HXAL 2QJDA 4NM4L 3WS3A 4U6VH 1X5AA 2FATL 1HSAA 1T2QH 4PD4K 1B0GB 4OKDA 3LDBB 4NCC1 2MWCA 3I6GA 1EBAA 1QSEE 1HXMB 2BNRD 4X99B 4F7CB 1YY9C 2JLLA 2GYSA 3BEVA 2FWOB 1T04B 1VPOL 5DTFB 4DKFL 1I1YA 4XNZC 5IUSA 4Y16B 3U46A 2Y06L 4N8CL 2B8OT 3MBXL 2HT2D 3SDAD 3FZUC 5E2TH 3AM8A 3P9MB 4NQSB 1PYWB 1CGWA 1U91B 1CFTA 4DVRL 1TQCC 3BGMA 4G8FB 2B2XH 2E8ZA 4X98B 2XOTA 4U1MA 4PGJA 4P9HC 3VFUA 2VKXA 3GDBA 4HCRA 3MROB 3KLHC 3VD7A 3BGAA 4LBEB 4CL7A 5C70A 4P57B 4XXCC 3QT2A 1ZHKB 4OV5B 2XTJD 4K23L 2BOBA 3RZCA 1XGUB 4NQUA 3P0VL 2DJSA 4UV4L 2WLYA 2FJGA 1E6OL 1P6FA 1KUMA 1VGKB 4Z7UB 2GJ6D 2PTUA 3A67H 4LPCA 4G6KL 1XR8A 1GPOL 1KIRA 1YEJL 5JUEH 1LO2H 3VFTB 4X7SL 2DBLH 3SE4A 2BFVL 4GSDL 2W59A 3IAGC 3S3SA 1I9RH 3A6BH 3U4BL 5FO9B 3GSNL 5IHUL 4FQCL 5IF0A 3VWJB 4PP2A 5E7BA 2Y6SD 3QXAB 3S37H 4WCYH 1ONQA 1ZHNB 4MXVF 4L5FL 2VQTA 4DQOL 1I7TB 2FH6A 1MCHA 5ETUB 4JY5H 3K3QA 3VFPA 5IVXA 2BSSA 4FZ8L 1KG0B 1TIUA 3WIHL 1MJJB 1MVFA 2YD5A 2J8UA 4PGEB 2DJUA 5BS0B 3JV4B 3UBXB 3ZYZA 2GFBB 3QDJE 1XZ0A 4N1CA 4JFFA 5EC1A 3NIGF 5FF6B 4XVSH 4QXGL 1NFIA 4ODVH 1U42A 5EFIA 4EIZC 3TBYA 2A0LD 3VXPB 1A3QA 3VRIB 4Y4FC 5IB5B 5IT2L 1F3JA 1MLCA 3MV7A 1IARB 2IMNA 5D71L 5HVHC 5F6IC 5HYSG 1ZEAL 2P8LA 3TA3C 5TPWH 3G9AB 5GHWH 1PSKH 2D9QB 2YC1B 1RMFL 3HC0A 2EO9A 4GW4B 1U8JA 1G9MH 3B2VH 2X4RA 4PJDA 4Z0XA 4R8WL 2XACC 1ZA6B 3P77B 4AL8L 3SE3C 2R4SL 2ZCLL 3TIDB 3QEGH 5BOPA 4M1GL 1DBBL 1NAML 5DSCB 5GGRY 5D72H 3ZYJA 1MHCB 2IPUK 2P4AB 3IDMB 3MUJA 5E8DH 1FIEA 2V7NB 5FA4A 1E4XL 4Z95H 1Z6JT 1UG9A 1XIWA 2X44D 3L1OH 4LL9A 3SGKC 1WAAF 3FB5A 3ME0A 2OXGA 1KENH 3JVGA 4HWZB 4Y5VB 5DURB 2BSRB 3NCBB 1K2DA 4NZTH 4OAWA 2E7BA 4XP1H 4EI5B 2OZ4L 4FMKA 4G8IB 1UB6A 2ZPKH 4JG1L 3KPNB 4OCXL 3VFGL 1V3KA 2AERT 4XAKE 3MLWH 4AMKH 4CU7A 3V6BR 1X5XA 1TENA 4MCYA 2HVKB 1BQHG 3AREA 4P3CH 5DUBA 3DV6A 1T0PB 3Q6GH 3ULUC 3PNWB 4XBPA 2A73A 4R96B 1TMCB 4WTZG 4HMCA 4GLRH 5F7DA 3HAEG 3RWEB 2MOVA 1NAKL 2FYYB 2XA8L 3OV6A 1WK0A 5KVGL 1IAIM 1MCEA 3FN9A 1EFXB 1MHEB 1DVFA 2BDNH 5J89A 4C57C 3PGDA 2V2TA 1MI5E 2CDEA 1IVLA 1GL4B 3W9EB 3BDXA 3EYQC 1FGNL 5J56B 4HHAA 1QLFA 4R4FL 4TVPH 1OY3B 3DETC 2YBRB 3NZ8A 4G8GE 3INUH 5IW3A 4HXAH 5HY9B 4NM4H 4CN6A 2FATH 5I17B 4NC0B 3ZSSA 5IEHB 2YXMA 5B8CA 3CCHB 3SDCD 2XTLA 1R5WA 4KJQD 3GSVA 4P2RD 1HHJA 5LAXB 4IRJC 3P4MB 4GBXB 5F8RC 3O9WB 3LOWA 3CH1A 4MXWL 3T1WA 5FYLL 5TQ2L 4X4MA 3WIFB 4KJPD 4KDTA 5T1DL 3GSUA 1VPOH 5CJQL 4DKFH 4C83A 4CMMB 3IGAA 3LB6C 2Y06H 3GK8L 4J3UA 4UV7L 4N8CH 3MBXH 2CDFB 5DHVH 1ZGLB 4PY8I 4UBDD 4AG4H 5CD5C 4IEFB 1FFQA 4U6YB 4OUUB 4FTVD 5C9JA 1DBKL 2P8MA 4FXKA 5SWQA 4DVRH 4Q9QL 4PRDB 2FB4H 5KVEH 1G7QB 1F2QA 4MMZC 4FQLL 1KB5L 4OD2A 1MCLA 2FIKA 4YDVA 4YUEL 1Q72L 1JV5B 5C3TA 4XP9L 2C4XA 5KSAA 1ZVSA 2R1WA 3ARBD 2NY1D 2ICWA 1LILA 2JKXA 3VXSD 1SJHB 4NQDB 5DD3L 4FHBD 2ZOKA 4WW1A 4HQQL 1N5AA 4K23H 3S3JA 2XFXB 1IT9L 1YNTA 5FB8B 5E6IA 4JVPA 1ZANH 3KDMA 3P0VH 4UV4H 2HJKB 4Z0BH 5F89B 2E7CA 2GCYA 5EH1A 2BY3A 1NGYA 2EIEA 3RWFB 1GPOH 2P5WE 5DS8B 1J10A 3TZVD 1AH1A 4LPTA 4X7SH 3D25B 5GS1B 4N9GB 2BFVH 2XG4A 3HI5L 4L9LB 4GKNA 3U4BH 3IFPA 2DLEA 1K4DB 3ARQA 5IHUH 4FQCH 1H5BA 2OK0L 3I50L 5DJ2B 2CUIA 4R4NC