3SO5A

Crystal structure of an immunoglobulin i-set domain of lrig3 protein (lrig3) from mus musculus at 1.70 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
98
Chain Sequence
FPPQITVQPETQSAIGSDVSFTCSAASSSDSPMTFAWDNEALQDAEMENYAHLRAQGGELMEYTTILRLRNVEFTSEGYQCVISNHFGSSYSVALTIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of an Immunoglobulin I-set domain of Lrig3 protein (Lrig3) from MUS MUSCULUS at 1.70 A resolution
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Leucine-rich repeats and immunoglobulin-like domains protein
total genus 20
structure length 98
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3so5A00
2P5WA 5TH2B 3AAZB 4NQVB 4QHMA 3GM0A 1T5XA 2VDKH 5DEZA 2YZ8A 3DXAB 1MCCA 4BQ9A 1T1ZA 3MLVL 1X4YA 1FNGB 3L9RA 4KXZI 5K9KA 2R0WH 4MA8H 5HD8D 5ID0A 1A6AB 4P2OD 2HFEB 2OR9L 4OCWL 2WSKA 4MAUH 3GSVA 4PJFA 1I75A 3FRPG 5HYJD 5JIIA 2PCPB 1MI5D 1CGYA 2A6DB 5F1NB 3E6FA 3L3JB 4MS8C 5FV2A 1QO3B 2ATKA 5ISZA 2YKLL 3IDJA 1RUPL 4P2OB 4AK1A 4Y19E 1HH9A 4HG4K 2V2WB 3CU7A 2XPGA 4G8GB 4XNYL 5HYJB 5TGBB 1C5DA 1YQVL 3VGBA 3BN9C 5K93A 1RHHA 4EXPX 2FX7H 3ZT5A 2HWZL 5FUOH 4XP9H 2EIBA 3VWKA 1RZ7L 1ZANH 5ESAB 4YC2C 5IVXB 3B6SB 5ISZB 2JB6B 1HDMA 3F7PC 1JGDA 3ZDZF 1NGQH 3W39B 1JHLH 5EIQA 1DEDA 4XC1H 1EGJA 1YN6A 4JB9L 5JXAH 3HE6B 4WV1A 1ZOXA 2X4OA 4P46A 1T0NB 5EPMB 3MXWH 5DRXB 4YZFF 3N1MC 1MOEA 2ILLA 2C1PB 4KRPC 3V4PH 3QJFA 2I60L 4HAFA 3DX9B 4Z7NE 4M7JL 4KK5D 1K2DA 3WEXA 1AGEB 1EAJA 1HXMB 3MOQA 5C09E 3BZFA 1ONQA 1XCTB 2VLMD 4YUEL 2BY0A 3O2DA 2XZQH 4UV7H 1NMCB 4OAWA 1GAFL 3FO0H 1GRWA 1KXVC 5IHUH 3CDCA 1FIGL 1FVEA 1XF3B 5DJZB 3FONB 4XNQA 3FT2B 1OCWH 3VXUD 3AFLA 4Z9KB 4Z7VA 3BO8B 1HCVA 4M93B 1IL1A 3BZ4B 3CFEA 1U8IB 3K74B 4K07A 3BKYL 4J3VA 3T3MF 4UT6H 5DQDL 5HHOA 4DTGL 5KVFL 1RZKC 4YHYC 3S98A 5ICYB 3QXAB 3MV9D 2W38A 4QGTA 4NP4L 3G04A 2GFBA 25C8L 5LWYH 2IPUK 4JAMA 1F58H 2ED9A 5DUML 3PNWB 4JKMA 2AEIT 2IMMA 4GOSA 4JFHD 4LARL 4JZJC 1DUYA 3OGCB 4S0SD 4KZEH 1SJEA 3B9VA 4MNGA 3MLZL 3VJ6B 4PJHE 4CKVX 3O9WD 5ACZA 4QHUA 4JVPA 1NANI 3D69A 1IAOB 2NXYD 4J6RH 2VQUA 3BP6A 4L8DB 3WUWG 4FZEL 2P5EB 1OAZL 1T20A 4M5YH 1RHFA 5I8CB 1I1AC 2XYCA 1PEWA 2VDLH 2XKSA 1MRDL 3VRLF 1UADC 3ARTA 2D03H 3S97C 1H15A 2C7UA 1JHTB 3HC4L 3ARYA 5DS8B 3T0WA 4XCCL 5J6HB 1TZIB 1TJHL 4L29A 1VSCA 1SM3H 4JLRB 1C16B 4ONHA 4OLYL 4YO0A 2NXZB 3OKMB 4NOBA 2Y07H 4Y19D 5GGSB 1TJGH 3ARBD 3MV7D 2QHLA 3CZJA 3FB5A 2Q20A 4POUB 4Y4FA 4LPTA 4J3OC 4P5TC 1AQKL 2HFFB 3N9GH 1AY1L 1LEGB 1FGNL 4PJ8D 3KPPA 4AJ0A 1E27B 2Q6WB 3WN5C 5EZIH 4RRPA 2COQA 3LEYH 5DJ6A 3FFCD 2VUYA 3MA7B 3OAYH 3BD4A 2MSPA 3CFIC 5ID1B 2BNUB 4JFOB 5LBSH 1XGYL 1G6RL 5IWLC 3WN5A 2A38A 1Y0LA 2XRAL 4QHNB 3GSUA 4PJBB 4CMHB 4Y2DC 4U1SA 5E9DE 2Q7YB 3HRZA 3NAAL 2VXVH 5AAMA 4OZHA 3U36A 4LF3A 3EFFB 2V2XA 3RWIB 3P30H 3OKOB 5GISL 3V4UL 4OZFG 2IGFL 3MRJB 4HGMA 2P4AB 4U4BA 2EDHA 5FYKE 4NFBA 1FZMB 2HTLC 1ORQA 4K94H 1R5IA 4GBXD 4XGZB 1KTRL 5C2BL 5A16B 2X1QA 1BFSA 4F2MB 5IF0B 2X4PB 4KZDL 1T3FB 4U1GB 2EKSB 2GITA 3PQYA 5D2NB 3IJSA 2BZDA 5HGDA 3K8LA 4DTGH 3JZ7A 5F9WB 3EOBB 1KCKA 4DK6A 1ZEAL 4ORGA 3NAAH 4WTWA 5CWSA 4LOUD 2CGRH 3KYMB 5EBGA 3IDIB 4ZPVB 3ZE0E 1IAKB 4CUCA 1UJ3B 4UZGA 4PLKC 3B83A 1CYGA 1OB1B 5F9AC 4JFHE 1VFUA 4XZUB 4PLOB 4IOSD 3LV3B 3WD5L 3VXME 1CLCA 4C54A 2ADGA 4I77L 4DVRH 1FHGA 4MMZC 2OJEB 4JZJA 4Y7MA 1WQVT 3QIUA 5F7DB 2OLDA 2DLGA 1AGCB 1DVFB 1JGLL 1CQKA 3ZDXF 1INDH 4GMTL 3BDBA 4X6CA 2CJUL 5I8KH 1KN4H 5T1MB 5DEFA 3LQAC 4F7PA 2DI9A 3HNSH 4HMCA 3EYSH 1OTTD 3PDGA 5HI4C 3KPRE 3KPMA 2JIXB 3K80A 4KK6D 4HF5L 2JJUA 4ODTL 4Z7WA 5HHVH 4G9FB 4WTZG 5TH2A 2WBJA 4K3EH 1ZVSA 4XAWH 2KZ1B 3V6ZB 1TZHA 2A1WL 3P4OB 1S7QB 1V7NL 4GAYA 4QHKJ 5EZIL 1HKFA 1D5XA 4JFDB 3VFGL 3VD7A 1ZT1B 1CG9A 2UZYB 5D5MF 2ZPKH 1CVRA 3HLAB 4QRUA 5L8KB 5KN5A 4HWUA 3KLAB 1KJ3H 3HFMH 4GAFB 5ERWA 1BLNB 3CC5B 5D70H 5IMLA 3VD3A 1UA6L 5ADPH 2P8LB 2B4CL 4NHCH 5ETUA 2J5LB 1U8JA 4Z7OE 1DQDL 1XIWC 2R69L 5GS2H 2YD4A 4DCQA 1T1ZB 1TLKA 3CU1A 4KFZC 1EBAA 2NY0C 4PD4J 2XIDA 3VWKC 4WFFE 1FBIH 3D39E 1YEEH 5CD3B 4NPYA 5DR5L 1AD0B 1MCNA 3FHQA 5EU4A 5EBLA 4CADA 1RZKL 2EE6A 4KKCC 3WIFA 2PUQT 4RRPG 4JO2H 4HC1A 4ZSOB 5CEYA 4OCLC 3O6FC 3D0LA 3RVWD 3MROA 3PHQA 5DRZB 1GZQA 1ULVA 1XGQA 2C4FT 1MCKA 4AM0B 2Z31B 1EEUA 4Y19B 3S34L 1QNZL 1Z9OA 4L5FH 3VDBA 1JZ2A 5GRUH 3TJHC 2D9QB 5B39A 1K5NB 3P4NB 2A73A 4KUCD 2MCG1 2NX5A 4ODHL 3VU2A 2R0KH 5E6ID 4OM1H 1KG0A 2OQJB 2A6IB 3T2NL 1DBKH 4WEMB 4ZAKD 2HN7A 3HNTH 5FUCC 2WM0A 1WIUA 4ODVL 5D72L 3SCMA 1E6OH 1UZ6F 2BMKA 4RNRA 3OTTA 3MRHB 4GUPA 2OL3L 3MXVL 1D9KD 3MRBB 4I5BA 5AWNL 1W8NA 1Q94B 4NC0B 2WLZA 2GAZB 1S7RB 4WI7A 3D85D 5GHWL 1YEDA 1CDCA 4Q6IB 5LQBL 5E24E 4RBPK 1MFBH 2YD3A 1KB5A 1P69B 3OAYK 5F9JB 1FFQA 4NDMA 2C3HA 2UZXB 3GMPA 4KGLA 3SDYL 2R0KL 1K6QL 1MIEH 2FJFA 3GJEB 3REVB 2YA2A 4CADB 1F3JA 4GT7A 4H88H 4NO0B 1NAKL 1VADB 4MNHB 2VDRH 3GSUB 3BHBA 5I15H 3CX2A 1U2HA 1C5CL 3SKOA 4N0UB 1CGSL 4H25B 3SEPA 3TJEL 4TTDD 4PJHB 3ELAT 5D6DA 2AJUL 3OAZH 3WLWC 2DQGL 5B38G 4DZ8B 4IMKA 2DQJL 4GFTB 2C26A 4F8TA 2A0LD 5DJ6B 1K85A 2A9ML 2CK0H 3EW3B 5F97E 3RA7L 1G84A 4P3CH 3IYLW 3GEWB 5DJXB 4EXKA 5J1SC 4NM8H 1EFQA 4OD1H 3TLRA 5ITBL 4MD5B 3W11D 5IBTH 1AGDB 2HA1A 3TFKC 3S88L 1Q94A 1LQSR 5I1GH 3WFBL 3U7WL 3W81A 4CRPA 2PW2B 3QQ3B 3RZCD 3NA9L 2NY4C 4N90E 4QRTB 1QSFE 3LZFH 4TRPL 4JDTL 4MQXC 1RULH 2VAJA 4HIIA 5CLTA 2CR3A 1D6VH 4WI9A 1BIIA 4CMHC 2F15A 2DQDL 1FCCA 1WBYA 5D2LA 1AKJD 4ELKA 2NY3C 2C3WA 5IOPA 5D1ZD 3O81A 4Q2ZB 2NNAA 1J8KA 5CIPA 4JFEE 5EBMB 4NZTL 1BM3L 4UTBH 2AXFA 4QXWA 3RDTD 4LNRB 2MCPH 3LPGA 4G9FD 2HKHL 4U6YA 2HMIC 2ZG2A 4OZIB 4HJGA 3U4BH 1RU9L 4HFWA 3RJDA 1EZVX 5DTFA 1F6AB 5HI5D 5EWIH 2G5BA 4GXUN 3BIKB 5IBLD 3B2UC 4G80B 1EVUA 2ZCHH 5FGCE 5INDA 4D94A 1P7KB 3QNYA 4WUUA 5GGQH 1KCUH 3MMEA 3TVMC 4XMLL 5BQ7B 4YBHA 1EVTC 5B38A 1HKLH 1BEYL 3QNZA 3QEQE 1OP5H 1LHZA 4XVUC 1SJXA 1L0YA 3WMSA 3P0YH 3QO1A 4NNXB 5E5UB 4PREB 3EDDA 3QUXD 4U0RC 4NO2B 3PQYB 5D2NA 5L0QB 4XNMA 5DQDH 2PR4H 2QSQA 1RMFH 4IM8A 4RSVA 4KHXH 2Z92B 4R96A 1RK1B 3DIFB 4WO4D 1CDHA 4M9PA 3GJFA 1HIML 5EUOB 2EO9A 3CK0H 1CE1L 4NJAL 5T33H 4UMGA 5C0CB 3MRJA 3DRTB 4V2BA 3QIWD 2Q8BH 3OMZA 2NTSP 5H37H 2JELL 3MRGB 4YDVA 3T2NH 5KTEH 5F9DC 1R24A 1VGKA 1KPUA 2BX5A 2VKWA 4TPRH 2DTSA 1DE4B 2XTJD 5BS0B 4M6ML 3SDDD 5CEZL 4LRNH 4XH2A 5KVMC 1NDMA 5D7JD 1BJ1J 3LMJH 1C8PA 1FN4B 4NQSB 2XQBL 2XTJB 5SWZE 3HAEG 4CDGC 2X4NB 4HBCL 2CPCA 2XA3A 4JY5L 3WE6B 2JB6A 4U6XA 2ZZUT 5FHAH 2EH7H 3ISWA 5ESAA 3FOLA 3UCRA 4JPIA 2CIKB 3CSYA 5T1DH 1GHFL 1KT2A 2AJVL 4GKSA 2HLFD 5IROC 3RNQB 4MD5A 3AM8A 5D7IB 4RWHA 1FSKC 2Y1VA 4XP5L 3DI3B 5B22A 5I15L 4P49A 3GSXA 3O6FB 3EOTH 4HS6A 3P73A 3MRQB 4KUZL 1M7DB 3QXWA 2VDML 3MBEA 4FQQB 4GW1B 1WTGT 4OD3L 4P3WA 4M5YL 2BVEA 1T5WB 2I9TA 1XGRB 1W72A 5DSCB 4LHUG 1MY5A 3OKMA 5MENA 5INCB 2WZPD 4QCIA 1O0VA 3SO5A 3G6JF 4P9HL 3RX5A 1UJTA 2VB5A 3TNMB 4HDIB 5ICXA 3RAJH 2SEBB 4ESKA 1I4FA 1WEJL 4R3SB 5JO5B 5DJYA 4LEXH 4QKXB 4BFIB 5C3TA 4DWHA 4FQ2L 4MJ2A 3TH2T 5IFHL 2BY1A 5IVXE 1IC7L 1R5WB 3VFNB 4WU7B 4MQ7A 1OSPL 4FN0A 1OTSD 4P4RB 1CFQA 3L3IB 4KK5C 4WJ5B 4XAKE 2CLRB 5JDSA 1T03L 3BE1L 4CVXA 5CJ8A 4JCMA 5B8CA 4Z95H 2CUMA 2OJZL 2V9RA 3BPLB 1RUAL 4RAUA 4WHDA 3QEQA 4OM0L 5CSGA 2CO6B 1IM9B 2VXQL 4PP2A 3U9UB 4YUEH 4B7LA 1FFPB 4G6JH 5FUOL 2YD7A 4RISH 4HD9A 2AI0L 5AG9A 3SCMD 1XGRA 4PR5B 3BQUA 2P8PB 1YNLL 4L8CA 3HUJE 3REVA 1MJ8L 1QRKA 1PKOA 3KJ4B 1NCAH 1Z0NA 2ZCHL 4I77H 4DVRL 4S1QH 3MLTB 4P2YA 4Y4HA 1R3KB 5DUBB 4NNPL 3L5HA 2R9HD 3HMXA 4I5BB 1QLEH 3O3BB 4R90H 5MERB 5JNYA 5F8QC 2P5EE 5EUOE 3FB5B 3O4LA 4PP1C 2VXQH 1OLLA 5TE7L 4AG4H 4I8DA 3SKMB 3NCBB 4U1LA 4C83B 1YNTA 4M3JA 4M7LT 4BM7A 4XWGL 2Y6SD 3JV4B 3MBED 3CVHL 2I9TB 4F37K 5IKCA 2JF1A 1A6UL 4JM2A 3KG5A 3X13B 3CZFB 4PJXB 1YDPB 4URTB 1U6AL 3NN8B 3WUWA 3ROLB 4B41A 3BGFC 1A4KB 3QPXH 3O2DH 3PL6A 4NQXB 3D18A 2DBLH 4XWOD 4ZDHA 3G6DH 2IPTH 4IRJD 3QQ9D 4WWID 3ARRA 4XPFH 1MCRA 2E7CA 2EXWD 2GJZB 3DURA 3RGVA 4UU9A 1HINL 5T1KD 4YPGA 1MRCH 5B3JF 1HHHA 2I07A 4FQHB 5IJVA 1A7PL 2ZWLT 3ARXA 3GSVB 4PJFB 5D5MB 5IQ9A 1DFBL 3KDMB 5BJTA 2AV7B 1IL1B 4TULH 5L2KB 4LLVB 4KK8D 4ZUVA 4Z7VB 4J23A 2BRRH 4EDXA 1D5ZA 3U0WH 3MFFB 4P59L 1OSPH 5EIIB 3VGEA 4E42B 4NC1C 1FFRA 5DEFB 1SVCP 2FH6A 3TT1L 2NY4B 4XAKD 2VZVA 1MHPH 4BH7B 5F9OL 3MCLH 3BESR 5IMMB 4J3UA 4YHPB 4F58L 2OMNA 2NY5L 4OLYH 4CW1B 3MFFA 4X7SH 2LVCA 2HRLA 2HLAA 4HLZG 1E6JH 2VN7A 1K8DB 3LV3A 5C0EA 3T4AB 1X5GA 1PLGH 1ZE3C 1B4JH 4KH2A 1BJ1H 4TUOB 7FABH 4LVNB 3O6FD 4KK6C 1FGVL 3RVTD 1J1PL 1P7KA 1XF5A 4WUUB 2ATPA 1GAFH 3ZHLA 1U93B 2G5BB 3KYNB 4QTHA 5FYKD 4JQVA 4N5EC 4KK8C 3FFDA 1I8LC 4OT1H 5T1MA 1QZ1A 1IVLA 3G5ZB 3I3BA 4MLSA 2NCMA 4HEPG 4NNYA 3EAKA 4NQDB 3KLHC 4YDKH 3ARSA 2MPAH 4M7ZB 4WHCA 3WFEH 3WHE0 4PJ7B 3DX7B 3OHXB 4WW2C 3KS0J 4QGYA 2WWKO 4NT6B 3TIEA 3U9PL 1EHNA 4XZUA 4ZXBB 3T2PA 3DYMA 3WFEL 3LQZB 1YYLL 1QSEA 3TCLA 3WFHB 1R3JA 1SMOA 2IAMD 4RISL 1F11A 2JK5B 1I1FA 3B3IA 4UUJA 4PYHA 3MRKB 5CEXA 2XZZA 3GI9H 5D5ME 1C5CH 5CZXC 1B2WH 1AHWC 3VXPB 5D96C 4JHBA 2AJSH 5C09A 2BNUA 3FO0L 2C1OB 4Z6AT 1T7XA 1PJ9A 3VFVA 5JW3H 4NN6C 2XWBB 1MLCB 3H0TA 4BZ2L 3GRWH 4QEGA 4KDTA 3O4OC 4PY8I 5DMKB 1JYXA 4OUOA 4UAOC 4KGJA 1EUTA 3MREB 4PJCB 1GGUA 3BKYH 3S36X 3T8XB 3CCHB 5AUMA 2YMXL 1JPFA 3D6GA 3KPRD 3IFOB 4ODTH 3GB7B 4U1HA 1FO0B 2BNQB 3S35X 1FJ1B 2CRIA 4JPWH 1CE6B 1LEKB 1A1MB 2CLVB 2WP3T 5FO9B 2WUCL 4JKKA 2JJWA 2YD1A 2BDNH 4P23C 1A9EB 3BP4B 1UVQB 1ZS8A 3S6CA 5C0IA 3JVGC 5FF6A 2UUDK 1T6VN 1T22B 3N9GL 4WU5A 4LHUA 4YH6A 3GSNA 2Q86B 2NQCA 4PJDA 4P4RA 3P9LA 1EJOH 1RZFH 4PD4K 2Q87A 3DROA 4G5ZH 3P4NA 3CDGB 1NSNL 4RFOL 1SYVB 1I7UA 1TVBB 2DLFH 2W91A 5KW9H 1JWSA 1FO0H 4UQ3B 2BDNL 2ZPKL 1QP1A 3IU3B 5EBWB 3AXLA 2VDOH 1U95B 2IAMA 3PWJA 2GJ6A 3UDWC 3ES6A 5IK3B 1KLUA 3FN0H 4E9LA 3MJ7A 3PJSA 2NR6C 1Z6JT 3E2HC 4TQEH 1P4IH 4Y16B 1MCWM 5GJTL 3RPIA 4FQQA 4GW1A 4R0LA 5IEKB 2BXZA 4JPKL 2EICA 2O5YH 5IW6A 4YXHH 4KJPD 3EDKA 2BOBB 4XPAH 5E5MB 2FX8L 5TE6L 3VG0L 3SDDA 2VAAB 3VD9A 4KDVA 3T1FB 5I19L 5HVHC 2OR8A 5C0CA 4JHWL 3JTTA 1OP9A 3PP4H 1IM3A 3BZFB 3GHBL 5C9KA 1OF2B 3BI9X 5E9DA 4PPTA 4I0CC 3RTQA 5DR5H 1WICA 5J6GB 2FH8A 4U6HA 2IQ9L 4GS7C 3L7FA 4NZRL 1LE9A 3O3EA 1A7RH 3V6OE 2ZJSL 1I8MA 4R26H 1ZVYA 2RCSL 3TIDB 1HEZB 3LMJL 5F3HB 1L4IA 1N59A 2R1WB 4YDKL 1QBLL 4PS4L 2X2YA 4L5FL 4XPHL 1KN4L 1P9MC 4F7EB 2DKMA 3LKSB 1JNHA 2Y7QA 4XCEB 3ULSA 3MGAA 5C7XL 1BBDL 2NY6C 4OGXH 5GJSH 5HHXL 1FNSH 4XC3L 5JR1H 8FABB 4FQLL 1CE1H 3TBYA 4CJ1A 4HT1H 4NKQB 4IRJC 1U3JA 1UZ8A 3CZFA 2YBRB 3DETD 3IJHA 2EDLA 3CPLA 4M61B 3UJJH 4PREA 3CLFL 2L7UA 2A9MH 2CDEB 4F57L 2X70B 3JBG7 4JR9H 3HE6A 3OF6A 2QLVB 5ISZD 4XX1E 4KKBC 3TEUA 5C0DB 2G75B 2NMSA 3BKJL 3IDMA 3MLXL 5D1XB 2DM3A 5I8OH 5INDB 2ZSVA 3RAJL 5I8KL 1A6VL 4HBCH 3IDYB 1QR1B 4KKNA 1MVFA 2EKSA 2GITB 2NY0B 3BKJH 4MJ6B 3OAUH 5F1KC 4RMUA 1MEXH 3HMWH 2HJFA 4W70A 4KROC 4PRHA 5FOJA 3RVUD 3GHEL 3SE3C 4NWUL 5ACLA 1OARL 4JO4L 3ROLA 1BFVH 1WBZB 1B0RB 3HE7B 4Q2ZA 2Z31C 3LKSA 1M7IA 2D7PA 2FHFA 1FZKA 2CRYA 1PD6A 3OSKA 1MWAL 3ETBF 3GBML 1LO5B 4BH8B 1A6AA 1G0YR 3CXDH 4NZUH 2G5RA 3QDME 1MFEL 1KJVB 1SY6A 4R4FL 3GMMB 3NFNB 3QA3A 1NGZB 1MJUH 3QWRA 4Y1AB 1IZKA 3CNKA 2XG4A 1DANT 1X5AA 4NN7B 5TE6H 1Z5LA 3VG0H 4D0BA 3T0XA 4NZJA 3E3QC 3OV6A 3JTSB 5CKAA 5TPWL 2W9LA 4EI5A 4F33A 3H3PH 2W65A 1YEGL 3AREA 4PBXA 4TOYH 1Z3GL 1UH3A 1M71A 3QEUA 1IGYA 3MCKB 1R0AH 2EEAA 4PJ5A 3DBXA 1YEHH 1S8DB 1ZK9A 3BYTA 3GMRB 3PIQA 3WO4C 4WU7A 5DUPL 3RWIA 3QPQD 3ARFD 2G9HA 1NC2D 3T2QA 3U36B 1FORL 4KVNH 1TQCB 4PIRF 4YAQB 4YHIA 5BXFB 1OGTA 3BE1H 4R90L 4JQXC 5FK9B 2HT2D 4PP2B 1AR1C 4JO2L 4YK4C 4GXVL 4H25A 3MRHA 1BM3H 3QDGA 4GUPB 3AREC 3V4VH 4JFYB 1I1RA 1EJ6A 3EIFA 5GS0D 4YO0B 5LKNA 4OM0H 3MC0A 4JFOA 2UY7A 3QUKB 4G6FD 1Q72L 4F8QA 1MCOH 1YC8A 3CVHB 1JF1A 3BEVA 4ZAKA 3DYOA 4LCWA 1CFQB 2AEQH 2FJGA 3NIGF 4FQJH 4H0GA 2AI0H 4EBQH 5KZCD 1BGXL 4G6MH 2QHRH 4XP1H 4XMLH 3WJJA 2Q3ZA 5EDXA 3IGAA 1S7VA 3IFLH 3W0WA 4X5WA 4YE4L 4BFBD 4AL8H 4KMTL 5IHUL 3VFTA 4O2CA 1QTYT 4KV5F 2AJ3A 2FRGP 5D7LE 4HJJL 4JY5H 1JNLL 4U0QB 4WCYH 2GFBB 1WVZA 1VFBB 5JHDD 4Z7UB 5JW5A 4LVOC 3RA7H 4J8RA 2VABA 5F7EH 1T1XA 3HAEH 4IIQB 1INEH 3G08B 1OTUC 3HMWL 4RDQG 3VFRB 3W0WD 4Y0GA 5KS9B 1BIHA 1MREL 4ZUTB 1K6QH 1EBPA 1MIEL 5C1MB 5GS0C 3MRIA 1FNSL 5FK9A 2P8LA 3HE6C 4OFYA 3B9AA 4XNQB 3G5YB 3ZYJA 4R97C 3VWJC 3QEHA 3MLZH 4Y2OA 5F71A 3REWA 2X4SA 4CBPA 3DGGA 3MZGB 4KRPB 3KXFA 1S8DA 3GMRA 5EBLB 4MNQD 3F6LA 5FHBL 3DYPA 3QXAA 4H0IA 1E4XH 1I1YB 3QDGD 3BWAA 3VMNA 3JWOC 5D7LA 2NW2A 3HC4H 4K71C 1FPTH 1QFWM 3VXUA 1DANU 3S5LB 1VHPA 3BPCB 2AV7A 3L95A 2OI9C 1K4DA 2WLYA 2A83A 3SE9L 4GAJL 4FTVA 5IMLB 1X5LA 3FT2A 5SV4A 1I9IH 2O5XH 4YDIL 5DMIH 4X6CF 2QBWA 4CNIA 4GRWF 2OTUA 1ZLUK 5HI3C 2UVFA 3MV8B 2QSCL 4M6NH 2GT9A 3E6HB 3KJ6L 4LQFH 4EI5D 2FX7L 2V9TA 2W59A 4JFDA 1FNEB 3VA6A 3VFSA 4WGWB 4JEGB 3U2SA 5JZ7C 4HV8A 4Z7WF 4RMWA 4PTTA 3WO4B 5TF0A 3V4PL 1PW3A 1ACYL 1QOKA 3J7HA 5DGQA 3VGAB 4X7SL 3MRLB 4YIQB 5F7YC 4W68A 1Q9LB 3RRQA 1FG9C 5IVOA 1HIMH 4M1GL 3FT3B 2E5EA 4AQ1B 5BRZA 2W0PA 3MRFA 4PJXF 4PJ5E 2Y72A 4RA3A 4TUKL 5DLMH 3K81A 2W9EH 5KANG 4G8EB 4Z95L 4FQCH 1HXYA 4LRNL 1BOGA 2IAMC 5CSZA 5BCAA 2MPAL 4XWGH 3MV8A 1I9JH 3UPRA 2GCYA 3OF6D 1HQ4B 3QEHB 1T66D 3WKMH 2I60H 1JWMB 2VMFA 3QCUL 4KROB 1JNHB 3WIIL 4OF7A 2ADFH 4M1GH 2E9JA 3EFFA 4BQ8A 4N9OB 3KYMA 1IEBB 5FCUL 3T0EE 3U46B 1A1OB 5EN2A 5ID0B 4EOWH 1QLRA 4QRPB 1RV6X 4HMEA 1LE5A 3GKWH 4FHBD 1T2JA 3HI5L 1MJ7L 3O2DL 1HOCB 3H9HB 2B1AL 2YPLD 1VFMA 4G6ML 2IFFH 2FNBA 3CPLB 4HIEB 1OSZA 3U6RB 5ID1A 3JVGA 4JJHA 2A74B 4TYUA 5IW1A 3MX0A 1NMAH 4ZPTA 4U1JA 1W72L 5D8JH 1S3KL 2NXZD 3FFCA 4F37F 4O2CB 3ARGB 2VC2L 5L88L 4HGKC 3UAJC 1ZXQA 3VW3H 3FB8B 3PV6B 3RL2B 5TDNA 3B2VL 3LKRB 3GSWB 4V1DB 5C8JA 3BZEA 1MRCL 4KDTC 1N3NA 4YXKL 4Y5XC 1I4FB 1WZ1L 2QSVA 5EC2A 3CVHA 2B4CC 2OYPA 3QQ4A 4AIZA 3NMEA 1RUKL 1FFNA 3HAEA 4L3CB 1FH5L 5A1AA 2DJUA 3FQNB 1G6RB 4JLRA 1UXSB 2EYRA 4D9LH 5E8OA 3ZKNC 3D85A 4L3EE 1BFOA 1MRDH 4XXDA 5CZVH 2BVYA 1R5VA 2AEPH 5HGGS 5ACMA 4CMMA 1W0YT 3GSOA 4X99B 2VLJD 1I85A 2ZKHH 1G7MB 1G7QB 2DQFA 4XPAL 3T1FA 4ZD3L 1IAOA 1D9KB 1KCLA 2VIRA 4P3DA 1QFWI 2Y06H 4Z5RA 1HHGB 4OUUB 4ZUUB 3EJYC 3RWDB 5FM5M 4PYGA 2X42A 3FTGB 4L4TE 5IHZA 3K4ZA 4M5ZH 2VLJB 3DX6A 4CMMB 3BGMA 2BVUA 1XR9B 3FB7B 1JFQL 1JPGB 1HWHB 4PBVC 2QQNH 1OAKL 2IPKB 1C5BL 1TJIH 2YC1A 5GQBA 3W9EA 3SGDI 1CF8H 2C7UB 5HHOB 1ZLWH 2XN9E 3LEVH 3L3HA 4NQDE 2P46B 1NFIA 3RIFK 5BXFA 2VLJA 5C07E 3MCLL 4GAGH 4LVOB 4QYOB 3B43A 1NGQL 4OF5A 5T5FH 3IU3A 4QHUB 2ERJC 2CLRA 4WHYH 3QWRD 4JHZA 2EC9T 2V9QA 5LBSL 4YBQC 1MHEA 1GPOH 1DBJH 4HWBA 1C08A 5ALBL 2AABL 4XVUD 1IGYB 3B8YA 3KLDA 2X09A 1HILA 1I3VA 4KZDH 3HG1A 4V1DE 4RX4A 2AQ3A 5I71B 3C08H 2VQ1A 5D7SH 4YQXL 2K7PA 2VLKE 3V6ZA 1DBJL 5GRVL 4DZBA 5CD3A 2AJSL 4IEFB 1QYGL 2GJ6E 2IGFH 4NQUA 3BH9A 3TCXA 1CT8A 2JKXA 2YPLE 3SE4C 1J1OH 3RBSA 2AJYH 2A6JA 2HYMA 5JQ6L 5DA4A 5B38B 4R4ND 2AEWA 1L7TH 1F11B 4ZFGL 4GKNB 1A1MA 1J1OL 1OCWL 1G6VK 4Y4KB 1OQXA 3QUZA 2BVQB 2VUOA 3O2VL 3MRRA 3EZJB 1BP3B 3UPRB 2J6EL 4HHAB 2OP4L 2EDDA 1IZJA 1DFBH 1G7JA 4JREC 5FCUH 1FV1A 5D2LF 2JLLA 3QXVA 4AY0A 4MWFB 1IC5H 2MQ3A 3RDTB 3S9DB 1CXLA 4FFVC 5EUKA 1C12B 3PL6C 4YHLH 2IFFL 4L8SB 2CXKA 2X70A 1KTDB 1ADQL 1FN4A 3U0PA 4ORGB 3G6DL 3MV01 2F19L 4HIXL 3EZ8A 4ONFH 5F8RC 5IESL 4XAWL 3QEGH 2AJXH 4OI8A 4YR6B 1G9ML 5CGYD 1V5JA 3MLUL 3MRLA 3RU8H 3CAFA 3V52L 1F4WH 4DKAA 2P44B 4XGZA 4GRLC 4CW1A 3T0VA 1PZUB 5C0ND 1JZ5A 5IMMA 2XPGB 3DOSA 2R15A 3TO4C 5GGUA 1T04A 2DQUL 2XWJA 4JG1L 5E00A 1TQBB 5J8OA 2BCKA 3H42H 1FFOB 5BRZB 1J1PH 4L4TA 1K8IA 3WV0A 2XZAH 2PO6A 5DD3H 1IE5A 2BRRL 1UZ6E 4M1CC 4JG1H 4U1SB 4Y4HC 5E5MA 3V6OC 4F9PA 1AQKH 3MLYL 1XF5B 5C0CD 1JTTA 4PGJA 4X80L 5C3LD 4K3JL 5DF0A 3L9RB 1FNGA 5C07D 2X5PA 1YJDH 5GGSY 1IC1A 3GMOA 4PRBB 2W9DH 3RTQB 1KIRB 4F58H 1SEBA 4LQ1A 3C9NB 3LS5H 2QADB 4LSTH 4YXLL 5EOTB 3AB0C 5IJVB 4RAHA 5DA0B 4YQXH 3UBXG 4JZNB 5B8CC 3CH1A 4WI6A 1A0QL 3KS0H 1S7RA 2EIEA 3Q0HA 3F5WB 4JFZL 4IHOB 1ITBB 3OPZL 3QUYC 5CD5C 2NNAB 5I66A 5EU3B 5E8EB 4OM1L 1RZ8A 3MJ8A 1L6ZA 4K3DH 4H20H 3X3GH 1W0VA 1CICA 5I71C 5K9OA 1WFNA 5DJAA 2IALA 2IQ9H 2F53B 5EO9A 4J8RB 1MCFA 5TDPB 1Z0MA 2FEEL 2FGWL 2NZ9D 4OBSA 3V0AC 2YZ1A 1X4ZA 5DHVB 4N0YL 3ES6B 4LVEA 4B5EA 3O2VH 1X5ZA 1CDJA 5C0FB 5KSVB 4NO0D 2DL2A 4U1LB 4C83A 5I17B 4HKXA 3P11H 4MAYC 2VXTL 2DDQH 4Y4FD 3NVQA 3ARDA 3R8BB 3TZVD 5E8NB 1N8ZA 2GSGB 2H6PB 1S7SA 2FEEI 3BT2H 5FGBA 3DVGB 4JM2D 4KKLC 3PE9A 3LSOA 1QYGH 3NCJL 4D8PA 2QHRL 1I7UB 4Y4FB 3OGCA 1M05B 5H37G 3LKOB 2M8XA 4RFEB 1NH6A 5JHDA 4H88L 3JV5A 1BFOB 4XXDB 3C60B 1LP9B 4P5KB 4F7MA 1KIQB 5CFHA 4X8XA 1NFDB 3BMWA 3I6LE 4FABH 2DS4A 1JF1B 5DK2A 3GSNB 1GSMA 3OB8A 3CLEH 4N1EA 4OCNC 2UUDH 5KVEL 5GRZA 3WNLA 4KUCF 3BZ4A 3CFEB 3QQ9C 1KV3A 3EUUA 1QPPA 2DI8A 5J11C 1IGML 1WC7A 2DQJH 5HHME 1EEQA 3WFBH 1FRGH 3MA9L 4YBLC 4POZD 4DQOH 2O5ZL 1YECH 2DQCH 1ETZA 1MREH 4ISVB 3I3DA 1PYWA 4JN1L 1IM9D 4X5WB 4QOKA 2XXMB 5F6HI 1GH7A 3VXSB 1MPAL 3LKQA 4Z8FL 2R2HB 3H42L 4KDWA 4FFYL 4C58B 2FL5B 3QI9A 4NDMB 4NCC2 3T77A 5AYQA 1RY7B 3BAEL 1HXYB 2NY1B 3LKPB 4X80H 4IRSB 3V5KA 3N06B 4Y5XB 4BJLA 5BZDA 3PXJA 3GJFH 1CDGA 4NKOB 3O4LE 4N0FA 3QG7L 3IVKB 3U9UA 4IJ3B 3MOBL 5DQ9A 3WDHA 3UX9B 1ZGLP 1MFAL 3O8XB 5AZ2L 5C0RH 2RR3A 5J1TC 1JP5A 2CRZA 5IBTL 3HZYA 1H8NA 1XGUB 4GAJH 3FT4A 4HXBH 1FO0L 5FYKH 1T2QH 3DARA 3AU1A 3B6SA 1A7OH 4ZS6D 3MBEB 2EDJA 4ZOCA 3UC0L 1N5AB 1M7DA 4WW1A 4RGMB 5K33A 2DB8A 1P4BH 3QB7C 3OKDB 1B3JA 1A3RH 4TSAL 5GS0H 2W65B 4C4KO 2BSRB 4QNPE 2R2CA 2P8MA 5FYLH 2GY5A 5I1JH 5IFJA 3T3PE 5JA8B 4MHHG 1WZMA 4X5XA 3CFCL 5I73C 3MLPA 2NY2C 5DJ0A 3SE8H 3KXFE 5EU4B 2MKWA 5EOCL 3W2DH 4P2QB 4PGBB 2FR4A 2G60H 3U1SL 3CFCH 1RU9H 5MI0C 3KPSD 3FMGL 1BWWA 3E3QE 3SPVB 1M6OB 1JZ6A 4M7KL 4M7JH 1HDMB 1T5WA 3DXAA 3ZHDA 4Z7QE 2F5AL 3GI8L 2JCCA 1Z9MA 5HPMA 3CMGA 5IVXA 1U8KA 1DJSA 1WK0A 5KSBA 5D7JB 3HS0A 4PB9L 1TPXB 3VRLE 2YUXA 1E4WH 4QF1A 3N1PC 4WY7H 2F5AH 3GI8H 1JPTH 1JNLH 3ZKMD 5L9DL 4WI5A 4UU9B 2AJZB 1N5YH 3PGCB 5DZNA 4W6YB 4LLWB 3CSYB 4YE4H 4EQ3A 3JV6A 5F7FA 3L3DB 4FFWD 3TN0A 5MENE 3N1QC 1IGJA 1NCTA 5FHAL 3FQRB 1S7TA 2ZUYA 1EHLL 2CQVA 5F96L 2J8UF 2Q76A 4XMPL 5KG9A 5CJ5A 3FOMA 1LK3H 4EBQL 2VZUA 4EVNB 4P2CG 5I18L 4M4PA 4IMKC 4OFYD 2V2TB 4XVTH 1ZHNB 5HDQL 4K3HA 5KBNC 5HTSA 4F15C 1KB9K 1PY4A 4JANB 5DD5H 2P7TB 4WRLA 3SKMA 3OKEB 3ARPA 1GGBH 4MNQE 3DX8A 3AS1A 3HR6A 3V5DB 5SX5H 2IPTL 4XPFL 4WGVB 2AJUH 1YMMB 4XVJH 1RJCA 4ZTOL 3KYOB 4R4BB 3C6SA 3GMNB 3HS0B 5DXWA 4YPJA 1XR8B 4JRXA 3S7GA 3IKCB 4JM2B 4ZNEE 1QEWB 4RMQA 4HXAL 5J3HD 2P49B 2R0LH 5GZNC 3PDDA 5BVPH 1AXSB 2XNAA 4GRLB 1NKOA 2E8ZA 2YKLH 1S5IH 1YNTB 1TIUA 1OF2A 2BHUA 4HGWA 4X9FA 3OB0H 3BGAA 3P2TA 4ZUWB 3WS6C 3RZWA 1LMKA 2PN5A 5FYLL 5IF0A 3QUMB 2D0HA 5HI4D 4ZMAT 2VZTA 5D2NE 1ZWIB 1NBYA 2V5YA 2BOBA 5EA0L 3HZKB 2NY5H 4XRCA 1DSFH 3LD8C 1AGFB 4XVSL 4GW4B 1CR9H 3PNWA 4ZG1A 1T6WA 4TVPE 2GUOA 3HI1A 4XC1L 1I1CA 1NFDF 5IT2H 2BVOB 4PJDF 1NAMA 3KPSE 5CJXC 5IB5B 5FA3A 1FE8H 3U30B 4PJ5D 3MJ7B 3PJSB 2W9EL 4PRHE 4KI5F 4WTXA 1BHGA 4U1NA 2PTTB 1EFXA 3KR3H 3FCTA 4DKFH 3ZDXE 4A6YH 4NJ9L 4GLRI 1KTLA 2AK1L 3RWFB 5SX4H 3SKOB 3BEWA 5EFIB 1L9MA 4K8RC 1A3RL 5IB5A 5JXAL 1XF1A 5GRVK 1KIQA 5JOPD 3RUGA 3VWJA 2N7BA 4IRSA 5F1OB 1MVUB 4PRIB 3BD5A 4Y5YC 3P73B 4WCYL 1C08B 1XCQB 1BVLB 3H2WA 5F9JA 3K8KA 2XWTA 4LU5L 1CFVH 7CGTA 2HVKB 1SVZA 5T3XH 3SGEH 4PJGA 4MA7H 4PJIA 2F54E 2FZ3B 1UYWH 4X7EC 3UZVB 1QBML 2Z8VC 3RVWC 4J6RL 2FBOJ 3Q6GL 2SEBA 2ARWA 2EDRA 1U8MA 4LP4A 5TDOB 3P4MA 5DUMH 1XF4B 2OI9B 1G0DA 5DURB 2D3VA 4JJ5A 3T08A 1HSAA 4OD3H 4F7MB 4P2QD 3TCLB 4MD0A 4YHML 1SM3L 4D9QD 1A2YA 2N7AA 1KYOK 5CJBA 4YBQD 1A8JH 4O4YL 2D7QA 3UTSB 1BD2D 4Y1AE 2VDLL 3WFCH 1HINH 2HJKA 3HA0A 2WIMA 2E8YA 1FZJA 2ADIB 2EH7L 1NLDL 3LPFA 1YEFH 4HCRA 4JPWL 1QO3A 2P45B 1OW0C 4JM4H 4WW2B 3QIUC 4L4VA 4JQXA 2EDFA 4KWUA 4TULL 4JKWA 1XGPB 3ZHKA 1S3KH 2IALB 1QSEB 4MXWL 1K8DA 3STZB 5B3NA 5FDWB 2K7QA 1JN6A 5AZEL 4QXTB 1KACB 2R4RH 2AJXL 3NH7L 2W0FA 4ZTOH 5DVOA 5GSRA 2QR0B 4S10A 3TN0B 1MHPL 5DMJB 3WBDA 1MNUL 4EI5C 1YA5A 3NFSL 4N5UA 1CDBA 2GIYA 3FFDB 3C2SA 2X9XA 2N56A 3ULVC 1KN2L 1F4XH 1HHJA 2JE8A 4KV5E 1J8HB 2XN9D 2R9HC 3U4EB 5ANMB 4NQDD 2QQKH 3LD8B 4GKZA 3O6LH 3VFOA 1U8LA 4YR6A 3VA2C 2W1NA 1GOGA 3K8MA 2R1XB 5K59F 1PVHA 3EHBD 3GMOB 4LOUC 5C0EB 5FYJD 1EMTH 4O5LL 2HRPH 1U92B 1A3QA 3BPNC 3KDMA 5IM7B 2I9LA 4WWKA 3IU4H 3GIZH 4P2RE 3CC5A 3D3VA 2CMRL 2IAMB 3PWJB 5EA0H 1C12A 2C3VA 3MLRL 3WHE1 5C2UB 2EO1A 1FFOA 3D1MC 3RI5K 5ECJE 2VLKD 3M07A 4GRLD 1FIEA 3D0VB 4EUPA 3GZKA 1AGDA 4WFEE 3ULUL 1IGTA 4NP4H 5HYIA 5IG7A 1Y18B 4HJGB 4XMKL 2EDNA 3LH2L 4UNVA 5TQ2H 43CAA 3UO1H 4XBPB 5EU6A 4PG2A 3MRIB 4PV9A 4NBYB 3NCYS 3IAGC 3SKJH 1ZMYA 3I9GH 3LHPL 5EC1A 3QFJA 1A6TB 2YHGA 2ZP0T 3KPRB 3MACH 4IRJA 4G6AC 4P23B 3QUZD 4P2QE 5EZOH 5FGRA 1N64H 1LEIB 4H1LA 4D9QE 3MACL 3OXRB 4GRWB 1HN1A 3KVQA 5D9SB 4F9LA 1BMGA 4LU5H 4Y1AD 5CGMA 4UQ2B 1CFVL 1BVLA 1FL5A 4EN3B 3GK8L 1FG2A 5FCSH 1JTPA 1P9MA 3DMMC 2XWTB 1KLFA 3B9DA 3JSSA 4FQPA 1U58A 2P24B 3G6JA 3N85H 2X9WA 2OBGA 2VJXA 4PR5A 4ONFL 3IFNH 1QHPA 1B6UA 4L8CB 2UYLA 4CNIB 4N0CD 2EH8H 3ZMRA 3QHTC 4KJPC 4ZYKB 3RVXD 2Q7YA 2A9NL 3G5XA 5JW4M 4FZEH 2NY5C 1VDGA 1BZQK 1OAZH 4C55A 1JWUA 5I76A 3CLEL 5A3ID 4KJWC 1MF2H 4FZ8H 3LN5B 4X9HA 1H0DB 2XZCH 3FQWA 4JQIL 3QO0A 3BQUD 2X4PA 3VXMA 5JTWA 1KBGH 4XWOC 2FB4H 5ITBH 4NT6A 3TIEB 5IHZB 4QOKD 2EYTB 4PJ7A 5HJ3A 1QHOA 1CIDA 4Z5RB 3REWB 1CXEA 3MZTA 4K3EL 4PY7A 5DURD 2ZUVA 4FFYH 5AG8A 4M4RA 5E6IA 3HZVA 3I2CH 4R0LC 4X4YB 1LP9F 2B4CH 4BSVA 1B0WA 2GHWB 3QUML 2NY6B 2ZNWA 4OZHB 5D9SA 3ZT6A 1QRNE 3GBMH 1CXIA 4LEOA 2CSPA 2IANE 2GSGA 4OIBA 4QTHB 3UPAA 2GJJA 2E9IA 1C7SA 3FRUA 5GSVB 4D3CH 5F89A 2GKIA 4ZS6C 4LSTL 2DBJA 2X4UB 2VR9A 5DJDB 4PUBH 2APXA 5E2WH 4AEHL 5IV2B 3QFJB 3FL7A 5EC1B 3DVFA 1HI6B 4ZNCD 4P46C 4WFGD 4N8PA 4PRDA 1YEGH 3MJ8B 4TOYL 4NKDB 2B0SH 2HKHH 3DSNA 4WFED 5J1AA 3S34H 4NZRH 5F7UA 1FQ9C 4FQXB 1YEEL 5DJCA 2IBZY 2PW1B 3KLAA 1FL5B 1BFTA 3LHPH 1F6LL 4RCAA 5CJOH 1NMBH 2J8UB 5GS2D 1SY6H 5E8NA 3KYNA 1FZOB 1KB9J 2ITDB 2QKIA 2OK0H 4M48H 1CIUA 1LVEA 3OXSA 4AT6A 1N64L 5EU6D 5CGYC 4OTXH 3OKYA 3B9KB 1LK3L 2ZG3A 3L3OB 3MRCA 4MCYA 4AENB 1LE5B 1CICB 5K9OB 3PDOA 1X5JA 3O3DB 1R24B 1VGKB 2RAMA 5IMKA 4WTZA 4YHIB 4ZFFA 4G3YH 5TQ2L 4OGAC 2Q8BL 3C6LD 3VXSE 5DGRA 2HFTA 3HB3C 3MV9A 1H9VA 1QFPA 3BT2L 2XA8H 4PJ9C 4ZDHB 1N6VA 2CUIA 4PG9A 1OP3H 2Z92A 1WBXB 4NFCA 5DZLA 5EIIA 2IANA 1ZVSB 1QRNA 2F58L 4EI5B 2NY0D 1MFBL 3D5OF 4R96B 4ENED 2VLKB 2ZCKL 3IXAB 3MUY1 2C1PA 3PL6D 1TQCC 1DQQB 3DVNA 4UBDD 4EVNA 3HNVH 4S2SA 5EORH 4PJ7E 4FQLH 3K4AA 5GGTL 1Q0YH 4CDHA 1J0KA 2NR6D 3ZYZA 4X4XB 4LLAA 4WW2A 4LRIC 5KJRL 2ITDA 2VITA 4KQ4H 3HMXH 3KPSA 4L4VB 4ODXA 4P5MB 1CGSH 1CD9B 4LLWA 1T83C 4L3EB 3QZWG 5DD0H 3HCVB 2BCKB 3QUYD 5CD5D 4JPVL 4Z77B 2VDPL 2Z0BA 4UTAL 1A02N 5CILL 5GJTH 5HHOE 4JQVC 1KOAA 1P84K 1PZ5B 2PW1A 1GXEA 2H2SC 3O4LD 4KJYB 4OCRL 1FZMA 4FQXA 2FGZA 3ZE1E 2ESVB 2MFNA 4U2ZA 1JN6B 4GS7B 3H6JA 4FFWC 3WO3B 1RPQA 2FO4B 4FP8L 2AXGA 4H5SA 4GBXA 5E99H 2LAAA 3BP7B 1PKQB 2EECA 3G6JE 5DD6A 1I1AB 3I84A 1RIHL 3MNWB 1NC2B 6FABH 4S0TD 1TETH 4A6YB 1MFAH 5AZ2H 5C0RL 2OSLA 5FKAA 4X8JA 1FORH 4DKFL 5DQ9B 4MWFA 1N4XH 1X7QA 2IH3B 2ITCA 3S4SG 4LLQB 1DQJB 1ED3B 2D31B 1NL0H 3O2WL 5C0GB 2UZIL 3NCCB 1G7LB 5E2UH 9CGTA 2ADJA 4R26L 3G5VA 1TTUA 4FP8H 3SGEI 3ILPB 3OB0K 4GG8A 4MB4A 4JRYE 1REIA 4R97B 3IDJB 4P2OA 4UOW1 1DN2A 3I02B 5EU6E 1H3GA 2ICEB 4MNQA 5SWQA 2YN3A 4NJAH 4Z7NF 5T5NF 5HGAA 2RHEA 1RIVL 4E41B 1D5MA 3LN5A 2APFA 2ZUTA 1ZA3B 2I5YL 2PTTA 3WN5B 3IVKA 3C09B 4WVRA 1EEZA 3GBLA 5H94B 4RGOL 3RGVC 1YNLH 5DO2D 2CLVA 3VGFA 4R7NA 3B9KC 32C2A 4PFEA 2HTLD 3CFKA 1VADA 4MNHA 4X0KB 1ND0B 3VWJD 1NEZB 4OCYL 1A7RL 4JY4A 2UWEB 5MEND 5F96H 4D8PB 1E4WL 5KTEL 4HPYL 4BUGA 1UCBL 2L7JA 3VGGA 2HTKC 2JB5H 5FKPB 3G5YA 4QY8B 4HKZB 5E94B 3V5HA 4GRMB 4JGJA 5F72S 3VI4E 3VXOB 5M95B 1OHQA 1DUYB 4OCMC 2AJVH 1P1ZB 4OZ4B 3P11L 2DDQL 1MUJA 5J11B 5GGRA 4ZUWA 3ZE2F 4PB9H 1I8IA 5IVZB 1O7SA 5B39G 2IH1A 3C8KA 3FN3A 4YBLB 5DVNA 2WQ8A 3QDAA 5INCA 3MNWA 1DP0A 2AK4D 1H3PH 4FG6D 2OQJA 3BUTA 3C8HA 4O00A 3L5WA 1NFKA 3KPQB 4GW4A 5KSAC 4YFDB 5HHOD 4MXVF 4QRRB 5EU3A 2ARJB 3DUHA 1Q9WB 3DX7A 1HHGA 3SDAA 3BQUC 4UNTA 1GZQB 3Q1SH 5DK0A 1EO8L 3KNBB 4L4VE 1E4XI 1NAML 4JFFA 4WUUE 5DRZA 4M93C 5FYJU 1YEKL 1NEZA 2E9WA 1DEEB 5D1QC 4GG6A 2YD6A 3ARFA 4JO1L 2A74A 5DD5L 5EOTA 1EV2E 3TA3D 1N0XL 3H7BB 5DHVH 4DCQB 1G6RA 1EUUA 4U1MA 2VDKL 4JO4H 1KG0B 4UT7L 2Y5TB 5EO1A 5BOPA 1VKXA 2XFXA 4DVBA 1UVQA 4JO1H 5GGVH 5EPMA 4NYLB 5F7MC 5IGXL 2PF6A 4A2LA 2PYEB 4S1RL 1MWAH 4D2NA 1QLRB 4QRPA 2MMXA 4GG6F 3RWHB 3RJQB 2MJWA 3BIKA 4P9HH 5CMAB 3MRMA 3TYGL 4NO5B 5T1KB 1GGCH 4ETQA 4JRYD 1J11A 3NGBB 5FFLA 1QSFA 2X41A 5E00B 5DMIL 3D9AL 1Q72H 1MAML 4NSKA 3RL1B 1KB5H 1ZLSL 4ZPTB 3NCYP 4EEEA 5HBBA 3H3PL 1F90H 2MCPL 3RWCB 5E03A 5DZOA 3MJ6A 5DT1H 1EHAA 5C09B 4P46B 3WXWH 3E6FB 3L3JA 1L6XA 4DUWA 4OZGA 1U8KB 3FO1B 2DIBA 2PYFB 1BBJA 2ESVD 2XG5A 4N68A 4ALAH 5KSUA 3OJDB 1A1OA 5EN2B 4LLUA 1EO5A 3O3AB 2ADFL 4HPYH 3MUJA 3AM8C 5GRXG 1CD8A 1MI5A 1I1AD 1S9XB 1P7QB 2ZCLL 1H3TA 2FYYB 1A1NA 2ESVA 1KIPA 1OP5K 1G7HA 2PKDA 3VWKB 1PG7H 2NY2B 3DXAD 3ARFC 2DQTL 1RUQL 4HUNB 3MR9A 3BVNA 4MDJB 5DJCB 4QHLB 1GGYA 5J1AB 2CIIA 4FA8A 4DGIH 4AIOA 5LGKA 1S9XA 3VFUA 1CL7I 2ATKB 4XBGB 5F1NA 3RWEA 4Z76B 3BD3A 1YZZA 3U0PB 1QLFA 1QLEL 3HI5H 3Q5YA 4P5TD 5KSAA 5IJKC 4N8VA 1NEZG 1QQDA 5HYSG 4O9HH 4OI9A 3WKML 5AEAA 3RI5F 3QPXL 2FLBT 3EOBA 3IXAA 3CIQA 2YUWA 3SGJA 2R2BB 2CJUH 2AAVA 4ZFOL 5E4EC 3PABB 2LU4A 2C5DC 4J3XA 4Z7VF 5GIRB 2NYYD 1A6WL 5LXGL 4XP4L 3Q6GH 5D2NC 4ZNEA 3VD5A 1FGNH 2FL5A 3QI9B 5IFHH 1P7HL 2ORBL 3CVIH 5I9QB 1NLDH 1V7MH 4L8BB 1AE6L 1IAIH 1OWWA 2BMKB 4JFFD 4MXQD 4IMLB 4K8RD 1GGBL 5IP4A 5C0AE 2H2PC 4HH9A 2VE6A 1V7ML 3DWTA 3CDFA 4FMFA 1MFCH 5DC9B 1DLHA 4XVJL 4ZFOA 4XCYB 4LKXB 2F53D 3OJVC 1I1YA 2CD0A 5FYLD 4E5XA 4JFEB 1AGFA 2OL3A 3IAQA 1QBBA 4PP1D 5MHSE 4O58L 5L7XH 3U0WL 1NC4A 3FKUS 3QG6A 1D5IH 5A40E 1MCWW 4P2OC 1KJ2B 2HRPL 3Q6FA 2DD8L 4PV8B 1KN2H 3H8NA 2Z93A 2DRUA 4N0CC 1X44A 3BOVA 5EU7E 5LGHH 3NFPB 5DHVA 4JDZB 3U9PH 1FNHA 3LEVL 3QQNA 5KSVA 1JPGA 2W9DL 4XBEH 4JKLA 1D3CA 2CO7B 3QDHA 3ULUH 1W72B 3BP4A 2ZOKB 5DSCA 2ENSA 4M8VA 1FAIL 2CGRL 4LVHB 1K5NA 5CSBA 4G7VL 2Q6WA 3DXAE 5FKPA 3KLSA 6CGTA 5HGAB 2DKSA 3F5WA 5MERA 2I26N 4R7DB 3PV6A 3VXOA 3M8OL 1SBSH 3ORJA 3M17A 1ACZA 3TESA 3VFMA 4H0HB 3IKKA 1NBVH 2NW3B 3OKEA 5ELIA 3MUHL 4X7TB 1OAQH 1T4KB 5IEHB 2X6MA 2XI9A 1X6NA 1ND0A 1TQBC 5MEOA 3ZE0F 5I1EH 2FSEB 2YMXH 1OSZB 3U6RA 4NRYA 4OGAD 1CVSC 4IMLA 4CU7A 4LRIA 4MA3B 4LHJB 5C6WH 1NC2A 3DO3A 1HZHH 2AGJL 4IHOA 2Q1EA 5FA4B 5C09D 3T3PF 5GJSL 5HHXH 3WLBB 4I3GA 5IMOA 4CN1A 4LNVA 4HUXA 1A6ZA 2F8XC 1CXHA 1T1WA 4WDIB 5C0AB 3SN6N 2A9NH 3MNZB 4OLWL 1K3ZA 3MREA 1PEZA 2AJZA 3U48A 2X40A 4KJYA 2ADJB 3SCMC 1TXKA 4LKCA 5EO0A 4UQ2A 4BFGA 1GC1L 2W0LA 1F2XK 4X7DC 5C0AD 5I1AB 1S7UA 3HHRB 2CUHA 4Z7WB 4N8VB 2V17H 1S7WA 1JZ4A 1RZIA 1MCLA 5DRWB 2CK0L 4X4MA 1Z2KA 5I74B 3LN4B 5D7KD 3QRGH 1MNUH 3JUYA 5FECB 4HWZB 4HWEL 1RIHH 5BRZD 4OFDA 4QOKE 1KTDA 4LCIH 1B90A 1T0PB 2ERJB 3N85L 2AP2A 2Z9TA 2IBBA 3ECBA 2ICWJ 1B0RA 4OZFH 4M61A 1T3FA 1W0WA 1MPAH 1X3DA 4KQ4L 3O6FA 3GSXB 5C07B 2VL5B 3UMTA 4ZXBA 4ZS7H 2F5BL 5ADOL 2CIIB 4Q9QH 2BSRA 2C4FU 2KL6A 3BSZL 3O2WH 4AH2A 4U05A 2IQAB 3U2SB 35C8L 1FNEA 4OI7A 4WW2F 4MJ6A 5IMOB 1FNAA 2Y4SA 3RU8L 3TBVA 4TQEL 3PWNA 4XHJD 1T0NA 4RDQF 1I3RA 2NZ9C 1AFVH 4X4XA 2BHYA 4WFGE 3S37H 4GKNA 2DQUH 1U92A 1JHKL 3S5LA 4CVZB 4LCUA 2ZUSA 4FTVB 3MLVH 3IJHB 1A7QH 2E9BA 2XFXB 4DVBB 3I2CL 5I1AA 1ES0A 3LS5L 2NPLX 3LQAL 2VKXA 3UTSE 1WBXA 1KPUB 4KK9C 5DUPH 1T5XB 4CGTA 4MAUL 1GVIA 3HG1B 3ZTNH 1NL0L 4M3KB 1CFTB 4BYHA 3OKKA 1FL6A 5JHLH 2HFFA 1HHKB 2FATH 3K2UL 3FFCE 1KCVH 1RK1A 5E6IC 4NO5A 5T1KA 1AY1H 1HNGA 3GIZL 2EZ0D 3VFRA 1KC5H 4XNXH 3DTXB 4UI2A 5IUSA 3BPOC 3IFPA 4G7VH 2R23B 1RSFA 5M94B 1QR4A 1ORSA 1T03H 5C9JA 4DK3A 4G8IA 3AAZA 3AMKA 4NQVA 4QHMB 5GXBB 1CK0H 3VCLB 4FXGB 2FJHB 2P42B 1RQ5A 1X6LA 1RJZB 1NMBL 4ACPA 1OAUL 1IBGH 3TO4B 4YC2B 1OM3H 4EI6B 1D6EB 4OLEA 4DGYH 2LQRA 3V5HB 2DM2A 4Z7VE 2QJDA 4NQEA 1UB6A 1A6VH 4LNRA 5I1EL 3TYFA 1U8PA 5EZLB 1J7VR 5JW4Q 5ESVB 1O5DT 2BOCB 3OR6A 2B39A 1J87A 2OXGA 4RGMC 4X99A 3EBAA 1SBBA 3DMMA 1HK6A 2ZOKA 3UEZA 4MDIA 5IW6B 5D7KE 5IKCB 4R0LB 3CFKB 1H0DA 1Q9KA 2V6HA 1V3MA 3BAEH 2F53A 2HMID 1QA9B 3KPLB 5KZCB 5I1DA 2Z8RA 4DGYL 1WWAX 4KAQL 4AG4L 2O5ZH 5DO2C 4W6XB 1TVDA 1PG7W 1D5MB 1UJ3C 3BP6B 1FVDA 3IXTB 3WFDH 3MOBH 1YY8A 4BSVB 5DD0L 5FUCE 3HZVB 4G9DA 3NTCL 3FFCB 1MLBB 2F74B 1XCQA 3GSOB 4NHUB 1A6UH 4U3XA 4Y2DA 1L7IH 3OWEA 4HS8L 4KKAC 2BK8A 5ITFA 3DV4B 32C2B 1VEPA 5LGJA 4LSQL 1UKQA 2JJVA 3CSGA 2WAHA 1KUMA 1QACA 4JZOA 3A6BL 2QADC 5L2KE 3QIBC 3SQBA 4GQPH 3DTXA 2KH2B 4MSWA 2EC8A 3GGWB 4M03A 3WFDL 3C5SA 4WWKC 1W8OA 5SWQB 1OP3K 4ALAL 2L4OA 1AR1D 3NABL 5E1AB 3ARQA 1YMHA 4HUVA 4P5TA 1WWBX 1U8NB 4OLVL 4X6DF 5HI5C 3T0EB 3SY0A 1D5XB 4E41E 2IG2H 3OXRA 2GAZA 4M1CD 4QF1B 5HXMA 4MJ4A 1G7LA 3WS3A 4D0DB 3IRZA 4G8GD 1AC0A 4I9WD 2G75A 5CEXB 2MOVA 4YNYB 2ZSVB 4WFFD 4LSVL 5FGSA 5B4MC 3BUYB 1I1AA 4MZ3A 1IILE 4QCIB 1ZV5A 1QFUH 4OJFL 2IF7A 4NNPH 1JZ7A 2APBA 1CFSA 4OIIL 2R39A 2GCYB 1JNNL 3MO1B 4WWKD 1FBIL 3LQMA 1WV7T 1DBAH 3RZCB 2EDXA 1QRNB 2NY1C 5DD1L 1OTUD 4NO3B 1RHHB 3FMGH 1ZHKA 3UTZB 1OW0A 3OGOE 5JMRA 1VFOA 1HYSD 2ICES 4I0PB 4I3RL 4TN9A 1FDLH 2C3XA 3OAUL 3V5DA 3UZEA 4LPVA 4RMSA 1UCTA 3TNNA 2Y7QB 4XCEA 1J05B 5CZXD 4F3FB 1U93A 1JGEA 4WHTB 2O93L 2HFEA 3TPUB 4OCYH 5IMKB 3L3KB 3SJVE 1OAUH 3RWGB 4K8RH 3HUJB 1FYTE 1KELL 1T1YA 2X4QA 4JFDD 1RURL 3FQUB 5GZOD 3QXDA 1KNOA 2E6JA 2VXUH 3EOAA 1QPXA 3QUXA 2DQIL 4U7MA 4Z0BH 1AI1L 4DKDC 4Q9BA 3SDCB 5IIEA 4OD2A 4HUKB 3VGDA 1KJMB 5BOZG 5JLZB 4KJWD 4KU1A 3D18B 3R1GL 4M6NL 1BF8A 3IF1A 3QUXB 5DJ8B 5E8DL 2WBJB 3GRWL 2D4FA 4H8WH 3LIZL 3CMOL 5I74C 3U7WH 2R0LL 3CUPB 5JUEL 2HFGL 5FDWA 1E28A 5HHPA 4HUMB 5BV7L 1BOYA 1GGTA 4UTAH 2DICA 5CZVL 1RULL 1GGCL 3G08A 5FEBA 1MCBA 4EQ2A 3VH8B 3ALPA 4X98B 5E08H 3ARGD 2WUCH 1VEMA 5LCVL 4HF5H 4F7PB 2R4SH 3TV3H 2E7MA 4PGCA 3ZKXB 3UJTL 1A14H 2WUBL 5MEQB 3KYKL 2G60L 5E99L 2DQGH 3AXLB 5CJXA 4NQXA 5ESQB 4HCRH 3SDDB 5LCVH 1INQB 4MQXD 4UQ3A 3QPQC 4E0RA 1ZGLM 4ELMA 4P9ML 4G6KL 4EJ1C 3T0EA 3ARVA 4OLZL 5E6IB 5HHMB 4MD0B 3RZCA 1NCCH 1WSST 5T1LA 1YEHL 1LK2B 3IRPX 4U2YA 3BFOA 3WIHH 5HVFB 4WI3A 4KXZH 4G5ZL 5DFVD 5CP7B 1KJ2H 3IDGB 5EZJB 2IEPA 2BNRA 3UTPD 5HYJE 1OAQL 1QFUL 4OJFH 3DUSA 4ZFOB 4U1IB 3QZWB 4PJCF 3GGWA 5DJDA 1WISA 4M6AA 4F15B 5J6HA 3QCUH 3ROOA 1LO3L 5TDPA 2Z91A 5D7JC 3Q5TA 1EGJL 3LN9A 3MNVB 5DJAB 3IETB 4TRPH 3IJSB 2FLRT 3EO1B 1OGTB 4G42B 4K2UH 4OQTL 2P43B 5HGDB 1G9NL 4NKOA 3T65B 2BNQA 4DOHB 2IJ0C 3N0PB 3P9WB 1FAIH 2VZ3A 1J1XL 4PLJC 1KPRB 4WJ5A 1EPFA 5JDSB 4A6YL 4O02L 3TO2B 3BIBX 4XRCB 1NPUA 4LFHG 4NUGL 3VRJA 1IEAA 1JGVH 4LCWB 3C5ZD 4PB0H 4QXUL 2KZWA 4QWWC 3PIQB 5L6YL 5GS1C 4HFUL 3H0TB 4MB3A 4K8RL 1QFHA 1UFUA 2A6KB 2WNGA 3NGBC 1UG9A 1CTOA 1UM5H 2KQMA 5D1QB 4RNRB 3IB4A 1BD2B 4PJ7F 4LSDA 2JJSA 3RY5A 4JFDE 4HMDA 1KJVA 2GTWB 2J4WH 4KY1H 1CGXA 1NMAL 3QZWA 1X5HA 4HLZH 1OD7A 3HPLA 4U1HB 5T3XL 4HWEH 25C8H 5LWYL 3EJZC 1UEYA 4XPBL 1HSBB 3QAZB 3FN9A 1I9EA 4MCZA 1E6OL 3D25A 4PGEB 1M05A 4TNWF 1QSED 3HZKA 1RMFL 4RMTA 4XPBH 3VXUE 2DWEA 1IGCL 3LSOB 4JFFE 2NX5D 5F1IB 4PLJD 3TN0C 1G7MA 1A6WH 5LXGH 1IAII 2DIAA 3TBSA 2P1YA 1MCEA 1KPRA 1KIPB 1YPZE 5ENWB 5HD8C 5JUEH 2IBGA 1E0OB 3R06B 4EI6A 4FQXD 1LEIA 3S35L 5E4IA 4HJ0D 3MRFB 3CVIL 1S78C 1N7ML 5D1XA 5C71A 1C7TA 3VW3L 3KWWA 4IRZL 5SWZD 5JXEA 1VFAB 2MHAA 1KCSH 1OOAA 1HQRB 4UUJB 1BBJB 1PLGL 1PKQA 1II4E 3DVNB 4U1IA 2V7HB 2XN9B 2Y07L 4LCCA 2AXGB 5MHSD 5FYJL 3S96B 4X5LA 3UJJL 3K4DA 3GMNA 5FB8A 3QXTA 1XGTA 2BSTA 1BZ7A 3PHOA 3L6FB 5DI8B 3V8OA 1GOHA 4KRLB 3BN9D 3IJYB 1RJLB 5BVJB 3NIDF 5J9PB 1U8QA 3ZKXC 4LSSL 4RAVA 3JWOH 4PY8J 3RNQA 3MRRB 3HUJF 4KJQC 1RK0A 1NCDH 5T1DL 5E0QA 1G7PB 3GIVB 4P57B 1KCSL 5HHQA 1S9WA 4ODUA 3C6LB 5I16A 1T0MA 5KAQF 2YPKB 4PJDE 3EYOB 4YXHL 5L2KA 1RJYB 2YXFA 2ZUQC 3IDNB 3FQUA 4MMXC 2CDGA 4K7PH 2NZIA 1F4AA 4NO2A 4HK3J 2DMCA 4LDLB 5C08D 2DQTH 2Z4QB 4R2GD 2WBJD 4LPUA 3QWOB 1JV5B 3ULUF 2UWEE 5KG9B 2FX9H 2QQKL 3AS0A 1DEEA 2EIZA 1FE8L 3QHFH 2J8UA 4R4FH 5CS7A 5A2IH 5D1ZC 3V6FB 5J56B 1IAIM 1F45A 1A7BA 5HGBB 4I0PC 2ED7A 3L5IA 2RBLA 1G0XA 3PWVA 4EIGB 3PWPE 5E95B 3NBNA 1NDGA 1QFOA 3WUWB 4F7EA 2KPNA 3IJYA 2EDTA 1H3XA 2AV1B 4PJXA 2XACC 1VB9A 1W0WB 3KPQA 3MO1A 3QI9C 2VC2H 1ES0B 1AP2B 5BMFL 2AVGA 5E9DD 4JJ5B 3VXNA 2FR4B 4PJCE 4WV1B 3FT4B 4Y16A 4LLDB 1LD9B 3CFDA 1HQRA 1F02I 5I9QC 4YHKL 3HR5B 3KWWB 3MYJA 4OLWH 3PG2A 5IVZA 5EU5B 1RUAH 3GI9L 3MXWL 1B2WL 2H8PA 4UDTB 3UYPA 3WD5H 2ADIA 1I7ZA 2X9YA 2I24N 1QSEE 5HGHB 5F93C 1TCRB 2JJTC 4PTUA 2ZUWA 1IBGL 2H26A 2P8MB 1FLTX 1SYVA 1UACL 2FWOA 4IIQC 2DWEB 2NXYC 5F1IA 2CKBB 2AQ1A 4WHYG 5FM4A 1NCAL 3BP5B 3QCTL 3W9DB 5CUSH 2VH5H 5C0NC 2V2XB 3GMQA 4Y4HD 1M1SA 1NCBL 2OP4H 3D85B 1CZ8H 2DAVA 2EZ0C 4QOKB 3WL9B 3O3UN 4AL8L 4BZYA 4U7SA 2MHAB 3ARDC 2FDBP 3VXMD 2BERA 4M6MH 2XZAL 1R3HB 1CLYH 4M1DH 4BUHA 1ZAGA 5BZDB 5DJ2B 2Z8SA 3KPOA 1YJDC 1HNFA 4C56E 3RY4A 3SO3C 1NFDA 2GK0A 3SDCC 3VRJB 1CD1A 1CICC 5AUMB 4BSWB 1JYVA 4KKAD 2FJFB 2VH5L 1KLGB 1ZHLB 3EO9H 3SY0B 2RFXB 4Y2DB 4U7KA 1VCAA 1ETZB 4ISVA 1MVUA 3QCVH 3OKOA 3QT2A 1NBYB 5F9OH 5C0JB 1MJUL 3VXSA 3U0TA 1S7SB 4NBXB 1PYWB 3F7VB 5ALBH 1BECA 5DJYB 1JZ8A 4ZUTA 2AXHA 3KHOA 1Z9LA 5H35A 5B3JE 3SCMB 1Y6KR 5A2LH 5CCKL 4R6UA 5DK2B 4OLXL 1SBSL 3KPNA 1KTKE 7FABL 3WXVL 3ARBA 2B0SL 1BAFL 1HCFX 2CH8A 4LSUL 3DUSB 2YOCA 5EU6B 4X7CC 1TJGL 5DK3A 5JDJA 4GG8B 4PV8A 2RQ8A 4ZFZA 5J3HC 2B1HL 4F9PC 3V6OA 3KYOA 4R4BA 1YUHB 2YRZA 2H26B 5CBEB 2PO6C 1CICD 5L8LB 3MJ9L 5F7WC 3ARBC 4PGCB 5MEQA 4UOW0 3HCVA 4UDUB 2ITCB 5IBUB 5IB1A 3TH4T 3TO4A 4IOFC 3D3VB 4UBDC 3D39D 3X12A 5JA9A 4GRLA 4BK4A 3KLHD 1KIRA 5C92A 3QRFM 3O6ML 4B50A 1DBKL 1NUNB 3VXNB 3OJ2C 2ARJQ 1YNKH 3D3VD 3WFHA 3VGAC 2BNRB 5EC2B 1JGUL 3X3GL 3TA3B 5B39B 3IDXH 1JVKA 1IEHA 4LVNC 1NDMB 2WW8A 5IB3B 3F12A 1AIFA 2I25N 1UH2A 5I8OL 3H3BC 4OIIH 5GS1B 2P5EA 4TSBH 3C5JA 2OM5A 3X11A 5C08B 1RIUH 1V05A 1RZJL 4KVCL 3SDCA 4Q0XL 5GGTH 1FRGL 3MA9H 4WI4A 5JLZA 3D48R 1YECL 2DQCL 4NCC1 2LTQC 4ODBD 5KVDL 1D6EA 1ZSDB 2H32A 4WO4B 3G04B 4F7CB 5D6CA 3EFDL 2Z4QA 5DVLA 3B5GA 3RWJA 4ZUVB 4JANA 5SX4I 4NNXA 4QRRE 1H3VA 1E28B 5HHPB 2NYYC 1LGVA 4YHOL 1IAMA 3QO1B 2HFGH 2KKQA 5DHYB 3ESVF 4BFEA 5BS0D 4Q0XH 3L5XH 4ODUB 5KVEH 2ZCKH 3P77B 3NIGE 5E9DB 1MJJA 3GIVA 4P57A 4CVWA 1KJMA 3RGVB 2JJTA 1MY7A 1UM4L 3TNNB 1L0XA 1EJOL 1I7RB 1RZFL 1WBZA 5TFSL 2I07B 2R56L 5CZKA 3RPKA 3RIAF 1Q0YL 4DQOL 3E0GA 5GSRB 1ZT1A 3L3GA 3MV7E 1F4WL 3C5JB 3OKDA 1P7QD 1XGTB 3GFUA 5KW9L 1AIFB 4G6KH 3O11B 3SOBL 3VWKD 3L6FA 5DI8A 2OCFD 4YFLI 4LLVA 3ARGC 5IR1B 4NHCL 3L3OA 3MRCB 2VZOA 2D0GA 4XHQA 3IDMB 4DEPC 1KF9B 4L3AA 2PETA 4P2QA 4PGBA 3ULUD 3NTCH 15C8H 3MSPA 2D2OA 5I16B 4HQQH 4ERSL 4E41D 2OK0L 4GXUM 2O5YL 1UZ8B 5E2UL 15C8L 1EAPA 5J06A 4MD4A 2P5WB 1FLRH 4HUUB 5I1JL 1VPOH 2AEQL 3KYKH 2DOCA 1F3DH 5HDBF 2F9BT 4I9WE 1R3LA 1BZ7B 2DKUA 4LMQI 4YXLH 4HHAA 1PG7X 4XCNB 4BELD 1EEYB 4FG6C 1I7RA 1YDPA 3ULSB 3MLTA 1QG3A 3VFWB 4Q9RH 2P5WD 3B4NA 1BREA 3PF2A 1BVKA 3ECBB 3WLBA 1XF4A 3WNPA 1I85C 3NABH 2R0ZH 5EFIA 2I5YH 5FOBB 4M7KH 5HYFA 3D3VE 1IQWH 3OJDA 4QYOA 3KPNB 2RB8A 3F62A 3HNTL 1UCBH 2A83B 4MA1C 3V8CA 5LGJB 4XP6L 2RJMA 4OFPA 3W2DL 3L7FB 1XMWA 2ZG1A 2FSEA 4JHAH 5HYQB 3T2OA 4FQ1H 1QSVA 1MCOL 1V3JA 5I75C 1P4LB 2D7OA 3IDUA 1AD9A 4LMQE 4Y5XA 2AKRA 2F74A 1U8NA 1R3IH 2OTWB 1WFTA 1YEDB 4JFQB 4FQIL 3NZ8A 2I27N 3SJVD 2VQTA 3QEQD 4Z8FH 2PTUA 1Z9SA 4HIHA 4QRRD 4F33B 1F13A 3P40A 3QXUA 3QHZL 1OPGL 3JTSA 4W4OC 2GTWA 3PP4L 2VDPH 3BXNB 5JXEC 1DQLH 1WF5A 3T65A 3U79A 2QEJA 2MQCA 3QEQB 1YYLH 2HT4C 5J12C 4NZDA 3J8F7 1FPTL 1AR2A 1W2KT 1JK8B 5I8EA 4TSBL 2VO5A 3C8KB 3FHAA 3ZKSD 5DYOB 4PRID 1LP9A 3DJ9A 4P5KA 5C0BD 5EO9B 1FDLL 2A0LC 5EZJA 1XFPA 3FTGA 1INEL 2Y25A 4NN6B 2NXYB 5JIPA 4GO6B 1DBBL 4EUPG 2FO1A 3LDBB 2VLLA 3IDGA 1CGVA 4L4JA 2BOCA 4G8FA 5GRJL 5C0BB 3K2MC 4I48B 4JRXD 3M17B 2PYED 4XXCC 5ACZB 3SDAB 1U8OB 5HDLA 4PTUB 2H6PA 4LLYB 2LABA 1R5VB 3CJJA 5CEZD 1ZA6B 3V2AR 2J6EA 3QSKB 2FJGB 2Q86A 4FRWA 2VXUL 4I18B 3ARBB 4Y89A 4IRJB 2DQIH 4Z0BL 4HT1L 3MRPB 2XKUA 5H94A 4LBEA 1HHIB 4OBRA 5AZEH 5BV7H 5A2KH 2IH1B 2GSIA 5D7IF 1ZGLB 1Q9OB 4H26A 1ZLSH 1FLRL 1L7IL 1CDYA 1DE4A 2Y06L 3VXTB 2EDWA 2YPVH 1YQVH 3L3DA 4PJIE 4QNPF 4J12A 4MNGB 5ALCL 3WKNA 2YS4A 2PO6B 3QDMB 1XH3B 2ICWB 3UTPE 1BZ9B 3QH3B 4U1JB 5F6HJ 4S1RH 5E2VH 4FQCL 3WNKA 4NRZB 3JWOL 1CD1B 3HRPA 3H9SE 3GRWA 4QRPE 5EUOA 5D7JA 3VFVB 4HBQA 5JW4N 2HTKD 3QDMD 1RVFL 3C09C 4QRSA 2R2BA 1QSZA 1ACYH 4UIKH 2NY4D 3WIIH 3HE7C 5A2FA 1SEBB 4PRBA 3PGFL 4LCUB 3GMMA 3HUJA 1KEGL 2DL9A 4Y5VA 3V0VB 2DQDH 5EUOF 1R3JB 1FVEB 4GBXB 4WO4A 2ICEA 4MNQB 4IS6A 3KR3L 5HHQB 5CJQH 3THMH 4XVTL 1K8IB 4U31A 4JPKH 4LASH 2Q8AH 5IIEB 1J0HA 1EEYA 4OZIA 5T33L 3QULA 3T0DA 4APQC 2WWMD 3EJZD 5D8JL 1AC6A 3QIWC 3EOYG 4KJQD 2W0FB 4YDJB 5IVXF 5F7HA 1OT2A 5KSAD 5CGTA 5TJWK 1T1YB 1QFWH 3FT3A 2K1MA 3ALXA 4HULB 4YX2H 5AD0A 4K94C 2VYRE 1JPSH 4JGUA 5IOPB 5HYSA 3IS1X 2VDNH 5CWSB 1AGBB 4YXKH 5DRNA 1Q1JH 4A2MA 5KSAB 5K9KB 1DVFD 4LASL 2Q8AL 1UC6A 3DHMA 4L8SA 4WENB 2NX5E 4FQIH 3WS3B 3DRQA 4HH8A 2PR4L 2YBRA 4JRXE 2AV1A 2XT1B 4FTVD 1OWRM 1NEUA 3RHWK 5IB4B 5EO0B 4PG9B 1AKJA 5CEZE 1OAYH 3ET9F 4NSKB 4WNQB 1F3DJ 3LDBC 1C5DB 3QH3A 5BV7C 3ULVD 2BXYA 4MCZB 5D7LD 1EERB 2WINB 2JIXD 3EYVB 3E6HA 5IHLB 1CFBA 2X1XR 4ODWA 5IESH 2JELH 1IAKA 3WJJC 3RWHA 4ZO7A 4EDXB 1MCDA 2VXSL 4HC1L 3K1DA 3UJTH 1NCBH 2DTMH 4UNUA 4MCYB 4S1SL 4YGAB 5KSUB 4H26B 3MGTA 1ZS8B 4ZAKC 3CLFH 1OAKH 3VXUB 3NPSB 4N90D 1QSFD 2YPKA 2WK2A 2EDOA 5A16A 2XV6B 3RWCA 1EZVY 3MA7A 4RFEA 4LVHC 1U0QA 3GUTA 1DBML 2QSCH 4YEEA 4X83A 1YEIL 2RFXA 1D5IL 3RWDA 1JNJA 1SHMA 4QRPD 2NLJB 1NGWA 1BZ9A 4M9OA 3AVEA 4WI2A 4NHUA 2ZKHL 3VFPA 3PWPB 1N6QL 3PHOB 4J4PD 4XP5H 5FUZH 5FA4A 1NCDL 2YPLB 4PJ8A 2ARJA 5I1GL 4YZFE 1YEJL 4G9FE 3SDXA 3QFDA 3PDOB 1KEGH 3L3HB 1HHIA 5KSBE 1F42A 1N2RA 1T21B 2WP3O 3FO2A 4XBEL 4Z7UA 3TZVA 2X44D 4Z7WE 3BW9B 5MP6H 3JV4A 1C5BH 1TJIL 4GW5B 4JKPH 1NCNA 1RZ8B 2XOTA 1NJ9A 2YSSB 2Z35B 5J7CC 5F89B 4J7RA 5J57B 2BSED 2YWYA 2UWEF 4ZUUA 3SDXF 1WEJH 2FEDD 4K7PY 3BP5A 4RFNB 3ZL4H 3DX6B 3LB6D 1N6QH 3QHFL 3U7YL 1IRAY 4X6CE 2QL1A 5EZOL 4K23H 4Q6IA 5ESVA 4XTRD 2FATL 3K2UH 2VNCA 2V5SA 2Z31A 1MHHA 2IC2A 1WJ3A 4JRWA 2VTFA 3C2AL 2VLRB 1IGFL 3CSPA 2VLME 4PJEF 1YQ2A 4QRRA 5HGHA 1KGCE 5E8OB 3SE3A 2E27H 1ITCA 1P4BL 4L9DA 1BVZA 4G8IB 4LHUB 2V2TA 1QUNA 1S7XA 3GKZA 4ZSOE 4KRMB 1W0VB 3QFDB 1HZHL 2AGJH 1UACH 3H3KA 5E8EA 1CCZA 1MELA 2HT4D 5MI0B 4NKMA 4HIHB 1I9RH 2BY3A 4G6JL 2F19H 4HIXH 4XNUH 3V6BR 1N3NB 3DPBA 4PJIF 3QG6B 1FC1A 1UB6B 3OJMB 3L3IA 2BJML 3BKCL 1MF2L 4I0KA 1MCJA 3MV9E 4QLRA 1UM5L 3BDYL 3WDJA 3ULVE 3T0AA 1T04B 3E8UL 5I1LB 4FQJL 2J8OA 1OQOA 1LO4L 1BF2A 3B9KD 1M71B 2O61A 4OB5L 3VCLA 4OZHE 5FO8B 4R3SA 1DLHB 1GL4B 4AYFA 4CVUA 2OS7A 1XZ0A 5KOVC 3EFDH 4OF3A 1WZ1H 4DOHE 5I76B 3S4SB 2Y6SC 2WIIB 2XY2A 3T09A 3TPUA 3FO9B 3TT3H 4Q58C 2A1WH 4XBGA 1F4YH 5L2JB 4F7TA 4QO1A 4PJAB 3P0VH 1H3WM 4OAWB 3I02A 4OCRH 1UWXK 2J88H 43CAB 5I18H 3HE6D 1WIPA 4PJEE 3DSFL 5BO1H 5HDQH 5HHNA 1J9CT 1R3LB 4HWBH 1A1NB 3WNOA 2OJEA 4PJFF 1AGCA 1DVFA 1ZTXL 2OR7A 4P4KD 3SQOH 1PQZA 4PUBL 1E6JL 2FYYA 1DQJA 4M7ZC 4AEHH 1LP9E 5MP6L 1TETL 5TQ0H 3SOBH 1GJIA 5DEGB 3PXHA 4ZOAA 1F4XL 2HJLB 2R0ZL 4P4KB 4UB0L 4L3ED 1IQWL 3HE7D 4Z76A 4TUOA 1JGDB 2BSSA 4M8QA 3SKJL 3VFUB 5MEPA 4KKCD 3MJ9H 3BP7A 5E7BA 1DQQA 4GKZB 3QIUD 2FO4A 3OR7B 4QT5B 1UXWB 3RIAK 5JOFA 2EDEA 5JNYB 3VDAA 2NW2B 3O11A 8FABA 5A43C 2B7DT 1CGWA 4Z0XA 4AZ8A 1VGEH 3UDWA 3S37X 1E4KA 1H5BC 4OD2B 4LKCB 1VPOL 1R5IB 1NBZB 1UGNA 5CCKH 3MV9B 4KMQA 4CN4A 4Y4KA 2P8PA 2GI7A 2HT3D 4ZD3H 1MJJB 3K7UA 4ETYA 3PQYD 4I13B 4OV5A 3V7MA 3SGDH 3QWOA 2EDYA 4X6FA 1T89C 3QR2A 1UWXH 2OR9H 2ZJSH 4LGRB 3IFNL 1B4JL 4RZCB 2OL3H 2IPKA 2P5ED 2YC1B 3W9EB 1CK0L 2E6PA 1RZJH 2GY7B 1FAKT 1X5YA 3BWAB 3RVTC 1T1XB 5I30H 4O51B 3QJHA 4N0YH 3FQXB 4ZFGH 3Q5OA 3PGDA 4ZODA 3C6LA 1ORQB 3EHBC 1IGFH 3G6AB 1AO7A 1T80A 4OT1L 4RIRB 1RFDL 1MHHB 4V1DD 2ZNXA 4XMPH 4LLMA 2HJKB 4JQIH 1IT9L 1G7QA 4KVCH 1FIGH 1FVCA 1XH3A 1IKNA 4G3YL 1ZLUH 1EA9C 3IGAB 4IDJL 2VDRL 1CLYL 3X11B 3QP3A 3L5WB 1RUML 3UYRH 3O6KH 4Y5YB 2F8OA 1IC5L 5FB8B 3W5NA 4TTGA 5J89A 4JB9H 4GJTB 4PRDB 1H3PL 4KRNA 1VACA 3QFJE 4ELMF 5I6XB 4UT9H 3NFPA 2IADA 1LWRA 5C0IB 5MENB 1VFAA 4D3CL 1GGIH 3I75A 3WJLC 5I66B 4J3TA 5GSVA 2PW2A 3QQ3A 5C8JB 1MUJB 5JHDB 5JQ6H 4LHUD 2GYSA 5FYKL 3SDXB 4LEOB 5TDNB 1B9ZA 1X5KA 5JPNB 1UM4H 4NQEB 3MTRA 3HFML 3CCHA 3I3EA 3RKDD 3W0WB 4RFNC 3VXRD 3UP1A 2FB4L 4YDLC 4PGEA 4OFKA 1WT5C 1KENH 4YHMH 4B53A 2UZIH 4JY6A 2MKLC 4TSAH 5GS0L 2B2XL 3ULUE 5ISZE 1WAAA 3LIZH 4H8WL 4JREB 1P4LA 4LSUH 1BPVA 4PGZA 4PRPA 1KENL 1E4JA 4YHZL 5DJ2A 1MAKA 1YC7A 1I8LA 4JGMA 4JDZA 5EOQH 3ZKMC 1YEFL 1NC4D 4X6FB 4ONGL 5I1CL 1U3HD 4NUJB 1RIVH 4BQ6A 4JVWA 1XF2A 2PTVA 4OGZA 2YPLA 4OGYL 3TC9A 3BKML 1VA9A 1WAAF 2R4SL 4XCFL 1I8KB 1ADQH 4GQ9L 1A14L 2WUBH 2BVOA 1CR9L 4MB5A 3IF1B 3T8XA 3QWQB 4ONGH 5C0JA 1NC4B 1FZKB 2P5WE 1ZT4B 4FXKA 3ESUF 3UTTB 2R8SL 1XIWD 1U3HB 3EDJA 1GZPB 1HH6B 3F58L 5FXCH 4DGVL 4KPHL 1F90L 1C1EH 4RFOH 4Y8DC 1J86A 3PQYE 1IC4L 1FG2B 3WXVH 1H5BB 5DMYA 1RUPH 3MV8D 1BAFH 4JFZH 1XT5A 2E7HA 4XNYH 3VXPA 4YLQT 5K9JH 5DRXA 2OSLB 5FKAB 4OLVH 2C1OA 5EOCH 4Y4KD 5F3BA 4I0PD 1BWMA 3DGCR 4GQ9H 5HYEA 2XNAB 5AWNH 3U46A 1X5XA