3SO5A

Crystal structure of an immunoglobulin i-set domain of lrig3 protein (lrig3) from mus musculus at 1.70 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
98
Chain Sequence
b'FPPQITVQPETQSAIGSDVSFTCSAASSSDSPMTFAWDNEALQDAEMENYAHLRAQGGELMEYTTILRLRNVEFTSEGYQCVISNHFGSSYSVALTIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine-rich repeats and immunoglobulin-like domains protein
publication title Crystal structure of an Immunoglobulin I-set domain of Lrig3 protein (Lrig3) from MUS MUSCULUS at 1.70 A resolution
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 20
structure length 98
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3so5A00
2DI8A 5BO1H 1NJ9A 1QBLL 3ARZA 3UPAA 3IJSB 4M7KH 2DIAA 5I1AA 3BUTA 4JO1H 3FFCE 3ULUL 3KPRE 5TF0A 3ULSA 4MNQB 1ZLWK 5SWZE 3BAEH 5D7KD 3DLQR 3QXUA 5ELIA 3MRLA 2AJ3B 3HE6C 4X4XA 2R9HD 2DMBA 3GFUA 2ARJB 5IK3B 3AS3A 4JVWA 3SOBL 1LO2H 5H37G 1C5BL 2AJUL 1EPFA 2X4RB 4IRZH 1RULH 3HPJB 4PRDB 5TFSL 3TH2T 3C5ZC 5J57B 4OZIE 3HI1A 4X98B 3W9DB 4OSUL 1S7QB 5C0DB 2OJZL 2R1YB 5DFWH 3TLRA 4JN1L 8CGTA 4ZO7A 5B22A 3T65A 2LV4A 3BQUD 3RPIA 1A1NA 1GAFL 5GGQL 2VH5H 1OVZA 4O9HL 2FSEA 1FVCB 2O93L 1XFPA 1ZT7A 4HGWB 4DWHA 2P5EA 5CCKL 1DBAL 1I9IH 2C3XA 4OUUB 1OTUD 4K2UL 4LHUA 2EEDA 2HT3C 3P2TA 4GJTB 3MBEC 3VD9A 1T83A 5IFHL 5L2JB 1RUPH 5FKAB 2MQ3A 4PJEA 1TJIH 4FZ8H 1Z9SA 4WWKB 3GMNB 3FOLB 4MNGE 1ZWIA 4HDIA 5DJ6A 2ZKHL 3OKYA 3LQMA 5IHZB 2VISA 4BSWB 2DTMH 3OMZA 5C6TH 5JXEA 1TLKA 3SKMB 3UTSA 3VGFA 3KLAB 3RUGA 2EIZB 4DFHA 4R8WH 4JY5H 3WHE1 4JGUA 1DBBH 4U7KA 4U6XB 4KY1H 3RWJA 2ZG2A 1TZGL 5ALCL 2GY5A 4L3EE 4I2XE 3ULUC 3U9PH 1X5AA 4CAGA 2DMCA 3OXRA 3HNTL 1C7SA 3NIFE 3ARFC 2Z0BA 1SM3L 4R4BA 3EO0B 5FHAL 4Q9QL 2ICWA 1LK2A 1NUFA 1OY3B 2ERJB 4QHUB 4QWWC 1G7MA 2X89A 4WHCA 2G60H 1A6UL 5I18L 4Y16A 4YX2H 2NXYD 3QIUB 5DJ0B 3R1GL 5EUKA 4QTIH 4HF5L 4DVRH 4L9LA 3IDGB 2RR3A 3M1BB 3L3DB 4AL8L 5F9WC 3SGJA 4GAJL 2ZG3A 4HKJA 1CFSA 5HHOE 1MSPA 3K8LA 2APBA 2C9AA 3TA3C 15C8L 4WI3A 2A6DB 2VIRA 3RZCD 3IETB 1BFVH 5I16B 3E2HB 1BEYH 3RWCA 1HN1A 3PDGA 1MHCA 3QUZC 1JGVH 3K4ZA 5KJRH 4WTWA 3EHBD 1FL6A 2B2XH 4P2YA 3QHZH 1CZ8L 4PJFA 1CCZA 3FKUS 4G8EB 3J8F7 1LEKA 3H42H 4LLUA 3RIFF 5KG9A 1B2WL 1MCDA 4BFEA 3L9RA 2V9RA 2VL4A 2VITA 3OAYH 4ZOBA 1C8PA 3DO3A 3HG1E 5I76A 1H8OA 3VXMD 3MA9L 1EEUA 5JIIA 3CJJA 3C60C 1D5XA 3PNWB 1F97A 4AMKL 4HD9A 3T8XA 3AU1B 1OHQA 5EUOF 4Y5VB 4F9PC 3TBTA 5HSFA 4WW2A 4UNTA 3WIIH 4JFXA 1AKJD 2XPGB 4IMKC 1VFBB 2ADIB 4KV5E 2C3HA 2PYEA 1P7KA 3C8HA 3BXNA 3H7BB 1YJDH 4OZ4B 4Q9RL 4ZDHB 3KR3H 1YEJL 3ARBC 3HNVL 4OQTH 2A9NH 4G5ZH 4H1LB 3QEHB 3U4BL 2AEPL 2D7OA 3UBXA 4CVXA 3HC3L 1I1AB 3LEXB 4Z0XA 4Z5RA 3V52L 3GK8L 2C4FT 2NLJB 3B3IB 1I8KA 1N2RA 4XC1H 4LEXL 2JB6B 1JFQL 5C86A 4KJYB 1CR9H 1E4XL 2G5BA 3UJIL 3K3QA 1WBZA 2PXYA 1LEIA 2F74A 4I0PD 2XA8L 3RTQB 4FHBD 3V4VH 2PCPB 2P5WE 4PRHD 2E3VA 2OL3B 1E4KC 2D7PA 3ARDA 4P2OC 4JZJA 5C08D 1DR9A 5JDJA 4J8RA 2MQCA 3IFOA 3DGGB 4APQD 5MEQB 2HLAB 2Q3ZA 4NQDB 3SCMD 4ZQKA 3TYFA 3WFZA 5E8NA 5EOCL 2VZOA 4OM0L 2X1OA 2VAAB 3UTTB 4LCCB 1KPRA 1QP1A 5DD3L 1G9NL 3CXDL 3SGEI 2VQ1B 1G7QA 3ULUD 5GJTH 3AROA 3EFFA 1RZ7L 2D3VA 1AD9B 2R0LL 4NQCB 4H26B 3CD4A 4K9EH 4P5MB 5F7YC 3ARFD 3SE9H 3NABH 2EO9A 2W1NA 1C08B 3NCEB 5FCUL 2JJTC 4OLEA 3PHOB 5DVNA 4GRWE 1GYAA 5E8PA 1XGTA 3S96A 1AQDB 1ORSA 1OL0A 4K7PL 4U1NB 5GSVA 4YO0A 3MYJA 3QXVA 1NCWL 3ARWA 3AC0A 1KCLA 2E9WA 2X09A 1TQCB 1DANU 2X41A 1DQMH 3ZDYF 3RFZC 2X4SB 4LMQI 2WP3T 5ISZD 4XT1C 2I25N 5TH2A 1A6WH 3BEWB 5CIPA 3UYOD 1F11B 1WFUA 1LHZA 4FQQB 2XN9D 3DSFL 5JW4M 4MSWA 3V95A 3TA3D 4QT5B 3HCVB 5HJ3B 3WS6C 3MRKA 4M03A 2OYPA 5F3BB 2X4NA 5DMKB 1U8IA 5IW6B 3V7AG 3VFGH 2XWJB 3U6RA 1FRGH 3FB8A 1F4YL 2CGRL 2X9WA 5IT2L 4P23C 5E5UB 1Y6MR 2Y4SA 1UADC 4G43A 3QUZD 3TBYA 3Q3GA 3T2NH 1OSZA 3AREC 3QCVL 3GSUA 3CH1A 1KYOJ 1MHHB 4XRCA 2FL5B 3DROA 2WM0A 3WUZA 1D6EA 4FS0A 4C57C 3MLTA 4WU7A 5C0NC 2J8UA 1CIDA 3WE6A 3Q5OA 1OWRM 5HYJB 2YD5A 2IGFH 4ZUSB 1MJ7L 2W9DH 3KJ6L 4ZXBD 3C60D 2DRUA 3U9UA 3MCLH 5JZ7C 4F58L 2C1OB 1CD1B 1G9NC 3SKNA 4XBEH 3SDDD 5IP4A 4GKNB 1H15B 3D25B 1G7HA 1T5XA 1KELH 1BQHA 2DYPA 3ZSTA 1KLFA 2JELL 1JYVA 3CVHB 1FNEB 3VFMA 5L7XH 2BVTA 4XP1H 1BQLH 2MCPH 5EZJB 4GW4A 1I7UB 4PRNB 4HUMB 1QA9B 2PN5A 3GBLA 4G7VL 1Q9KB 4ZUTB 1Q1JL 4ZD3H 2WUCL 1TZIA 2VC2L 5FCSH 4P2QA 2FHCA 4YPGA 2R23B 4PJ9A 5AAWA 4P59L 4NKOA 1M4KA 5E1AB 5IM7A 4XP6L 3SE4C 3QDJA 1B9ZA 1TJGH 1HHJA 2NY3D 4QRSA 4U3CA 4E42A 2XKNB 1TCMA 4P57B 1F02I 1CDGA 3STLA 4NJ9H 3C6LD 5AYQA 2X9XA 3VCLB 1JTTA 4YXHL 4TRPH 2F5AH 5M7QA 4M1DL 2JK5A 2ARJQ 4FTVA 2NQCA 4FMFA 3QBTB 4CL7A 4NHUA 3IVKA 1WEJH 1KB5H 5D7SL 3JXAA 4GW5A 4JFFA 3AAZA 2WBJA 4FQXA 4NN7B 2X4TB 1LO0H 1WBYB 4H1LH 3MLSH 3QDGE 1ITBB 1BJ1J 1G7PA 2Y9RT 5I1JH 1WT5A 5I8KH 4P2RA 4JFDE 3MOBH 4YDIL 3QQ9C 2DL2A 5AZ2H 5JQ6H 5C7XH 2RCSH 5DS8A 2R69H 3RGVD 2JJWA 1P53A 4LMQE 4KZDH 3STBA 2IAMA 4S1DD 3IDXL 1S5HA 1EHLH 3FCTB 3QI9B 2ZUTA 2EXWC 2KKQA 1JHLH 4JG1L 3G6DH 3K0WA 3BPCB 2YMXH 2DLIA 4G8GA 3T0EC 1SYVA 3W82A 4OCYL 5IFJB 5KAQF 3PGCA 4G6KH 2UZYB 1A7PL 2OL3H 3NOIA 3O8XD 3I02B 3IDNA 3CDCA 3QIWA 5F1IB 3PWVA 5I73B 4JM2D 3RIFK 1AGEA 4HC1L 3PQYD 1IKFL 1FZMA 4H25A 5JW4N 2DQUH 1IAIH 3DXAB 4ISVA 4NKMA 1YYLL 1B4RA 2NTSP 4NRZA 1FYTE 3LH2L 3MV8E 3SO3C 4PJGA 2YA0A 5SWQA 5BRZA 4OV6F 1F4XH 5FA3A 2VKWA 4BZ1H 1MVUA 3TZVA 4LRIA 3DMMA 1ZHKA 2YD1A 1PZUB 2ZNXA 3MMEA 2O5ZH 4U6YA 2VLJA 1JPSL 4HT1H 1AXSA 3OAUL 1RIVH 4JVUA 4Y4KC 1T21A 1UKQA 4M7LT 1E4XI 3N50A 2B4CH 3QDAA 4MA8L 1MFNA 1ZK9A 3KYKH 2BFVL 5DD1H 4NM4H 4BUGA 1N6QL 1FPTL 2FJHB 2VWEC 4Z7NF 5D7LE 1XR8B 5GGRB 3I6KA 4AEIH 3BT2L 1CLYH 1X5IA 2DQDL 3SE8L 1JF5A 4Y4FC 1RFDL 1ZKAA 2HG5A 2X10A 5T3ZL 3A6CL 2EYTB 3KPQB 4BFBD 3FL7A 2DS4A 4R0LC 3O6FB 3OAYK 3JV5A 1XGUB 1KXQE 4NCC2 4X7DC 5C0FB 1M7DB 4MXQD 2H9GB 1V7MH 1QHPA 1GXEA 2W0KA 5C3TA 3MLZH 3REVB 3KJ4C 2R2BB 2ZUYA 1AP2B 1DBKL 2V17H 3T4YA 2JIXD 4JZOA 3L6FB 1UACH 3BH8B 5IHUH 3EKCA 1OD7A 3MV01 4KJPC 4Z7VF 4HIXH 4EI5C 4FZEL 5ITBH 2EE2A 4NKIH 4RZCB 1J8HB 1RJCA 4ZSOE 5F97E 2XQBL 3X11B 1YMME 1U8OA 2X7LB 4WY7H 3IRZA 3T0BA 5E8EA 1DE4A 5BO1L 5K59F 1WWAX 1I8LC 4YHPB 25C8H 3QEQA 4CVUA 4JO1L 2IF7A 4LCYA 3CFKB 5D7JD 2P49B 3PV6B 2HJFB 2V6HA 4MVBC 3BAEL 4YXLH 5C0BE 4OT1H 4YE4L 3GMMA 3IDUA 1DN2A 2NY2C 3OAZH 4B53A 3IAGC 2NY4C 3TO4A 1JTOA 3MRMA 3W0WE 4WI9A 1RD6A 4ELMF 3VRJA 5D2LA 5DUBA 1N64L 5JHDA 4LCWB 3RWDB 1RZJH 3OJ2C 4RMTA 1LO2L 4U1KA 3MRPB 2PTUA 1NGWB 1NC4D 2ADFH 4IRZL 4J3UA 2G2RA 1RULL 4FG6C 4LGPB 2R2HB 5MP6H 3WFHB 3L5XH 2XFXB 2A83B 2SEBB 4S0TD 4HWBA 5HYQA 4MX7A 2FHFA 1CXFA 4XGZA 2Q87A 3TC9A 4D0BB 3UJTH 2R0WH 1KJ3H 2FWOB 3TPKA 2VH5L 4F7EA 1J87A 4BKLA 4D2NA 3QWOA 5K9QG 2FNBA 1I3GH 1YPZA 3ARGB 4JO3H 1JUFA 4KK8D 4XTRC 1I9IL 4MB5A 4LPYA 1VADA 4WUUE 3LQAH 5HGHA 1P69B 1RUPL 1NC2D 2HFEA 4LSSH 3CX5J 1GGBH 1TJIL 4FZ8L 4LPUA 5ESVB 2GT9B 5I1IH 4I4WA 4XP5H 1CDUA 2W92A 5J6HA 4NZDA 5C6TL 1KV3A 3MRFA 5HHNA 3CDGB 4OI7A 4J4PC 4CJ1A 2FGWH 5SWSE 2P46B 3KPSA 4R8WL 4HJJH 4QEGA 1FL3B 4LSUH 5DDHA 3TO2A 4JY5L 5E56A 4X8JA 3UMTA 4Y4KD 4OLYH 3TBWA 4L29B 4KY1L 4NBZB 1P7QB 1F58H 1F6LL 3U9PL 1I3RA 3OQ3B 4LLWB 4R90H 5ENWB 5L88H 1JZ5A 2R1XA 2YBRB 1VPOH 2OTUA 3EBAA 4LL9A 2B7DT 3ULSB 2BVUA 2EEBA 3C8KA 1R5WA 5ILTH 5E2VH 4YX2L 3MRLB 2GJJA 1IEBB 2ZUQB 5HGAA 4MB3A 4WHYH 4X4XB 5DC4B 1EAJA 4QTIL 2ZCHH 2E6PA 3H8NA 4DVRL 1CK0H 4S0SD 3V7AE 1PD6A 1E4WH 4P2CG 1XCTB 5KS9A 3RJDA 1OPGH 4NQSA 4RRPA 2J6EH 3HI1B 2VTFA 2VDLH 2X44D 4LIQE 4CW1A 1I8IA 1QFOA 3T65B 3RPIB 1A1NB 1BFVL 3GI9H 3Q5YA 1X5YA 3DX9A 2FSEB 1K3ZA 2Q6WA 3MLXH 1U8LB 2YPVH 5IBUB 1IC4H 1JGVL 1CU4H 2GAZA 1ZT7B 5KJRL 1AJ7L 2BVQA 2P5EB 2DI7A 4E0RA 3QHZL 4LHUB 3H42L 2AI0H 3SJVE 5I1DB 3KHOA 4LSPH 1T7ZA 5DGQA 5I0DA 4GAFB 4HDIB 1UYWH 5DJ6B 4BA8A 5IQ7H 1FDLH 2YD4A 1A7RH 5JA9A 3ULVD 3EIFA 2VISB 1LDPH 1OGAA 4YBLC 1L6ZA 3UTSB 1NMAH 4BZYA 4Y0GA 3RP1A 3TNNA 3T0EE 3WIIL 5H94A 2P8PA 5DMGC 1RK1A 1IJ9A 4FG6D 2DQHH 2QADC 4TVPD 3FB7A 1YJDL 4AQ1B 4XCEA 2H6PA 3JV6B 3KR3L 3OXRB 1Q72H 3IJYA 1VGEH 2NR6C 2A9NL 4G5ZL 4OQTL 5T3ZD 1KT2A 3IRPX 3QDMD 4RX4A 3MV7E 1VEOA 4QRQA 4R4BB 5KSAD 5HVFB 4NRYA 1OARH 2ICWB 4NZUH 2V5MA 1LK2B 4U1GB 4PUBH 1G7MB 2DQFA 1CIUA 1GGIH 1RUQH 3HE7D 4XTRD 5C3LD 4XC1L 3MJGX 1V3LA 1CR9L 4L9LB 4WO4D 3QFJA 3RKDC 5GPRA 5C07E 4XNYH 3V4VL 1T89A 4DK6A 5CD5D 6FABH 4OKVB 1U8MA 1KJMA 2LTQC 1FNHA 4HKJB 2PNDA 2UY6A 2VWEE 2NY0C 3DUSA 3KXFA 5IOPA 5GJTL 3RWCB 4M9OA 1MHCB 4P48A 3TBSA 3ZT7A 1LQSR 3MLVH 1FL6B 1HCVA 4K9EL 4KU1A 1JHKH 2CO7B 2UZXB 2WLZA 3IDYB 3CCHA 4PJFB 3SE9L 3NABL 3ILQD 1LEKB 4AIXA 4LLUB 1NFKA 5KG9B 1ZHNA 4X6DA 5CD3A 1DN0A 4LBEA 1UB5A 5EH1A 5I30H 1T0NB 1QBAA 2VITB 3MFGB 1LEGA 3O4LA 4JEGB 4NRXB 2C1PA 4Z7WA 4ZO9A 1W2KT 3MRJA 4NQVA 4WFED 5C0AA 2YD9A 3T8XB 1YJDC 3OKMA 1OLZA 3EDFA 3I6GA 1CBVH 1FFRA 1FZJA 3TBTB 5KSBA 2EICA 4WW2B 4NN6C 3L5WA 2XXMB 3O4OC 1JJUA 3DECA 3GJFK 3V8OA 2F8XC 1A6WL 4MZ2A 2JJSA 2D9CA 3O6LH 1P7KB 2CKNA 4JLRA 3BXNB 4LCIH 1X4ZA 5DFVD 5SV3A 5CJBA 3KPPB 2DWEA 4V1DE 5F1SA 3UBXB 3VFGL 3G6JA 4Z5RB 1FRGL 1OAYH 4Z0XB 2QLVB 1VA9A 5MENA 4UIMA 1I8KB 1N2RB 1W0VB 3B5TA 3T2NL 5L2KA 4X99A 1K2DA 3QQNA 3MLWH 3FQUA 3TJEH 3ARUA 2G5BB 2P24A 3QCUH 5HHXH 3QXAA 2PXYB 1LEIB 4HBQA 2F74B 1XCQA 3GO1H 1ETZB 4KK6C 2IGFL 2W9DL 3ARDB 3MCLL 4M43H 2BNUA 1AGFA 1ZE3C 4C56D 4J8RB 3FB6A 3IFOB 4XBEL 3NIDF 3TGXA 3TYFB 4YZFF 4ZQKB 3T77A 4JJHA 2E7MA 3N0PB 1A22B 1SJEA 4X83A 3I84A 5E8NB 1KELL 1V7NH 4ODTH 3E6FB 3EUUA 1QRNE 4N0FB 1S7TB 3VMNA 3PGFH 4K9EC 4XP1L 1BQLL 2MCPL 1KPRB 4ZD3L 2GSGA 3EFFB 2PETA 4P46D 1EXUA 5DC0A 4WWKC 2FLBT 3VDCA 4XXDA 1QFWH 3MJ6A 1VFMA 4NNPH 1BFOA 4W6XB 1ND0A 3BJLA 1MI5A 4NZJA 2J5LC 1JYNA 3CAFA 5E8PB 1XGTB 3S96B 5FOBA 2GEEA 5GSVB 5MHSD 1S3KH 5E6ZA 3MYJB 2H2SD 2IQAA 1A2YB 5EB9A 1JGEB 4TRPL 2F5AL 2X2YA 4BM7A 5TH2B 4UOW0 3DYPA 1WAAA 2CLZB 4ONGH 4IHOA 1WEJL 3NPSB 4ORGA 1KB5L 2WBWB 1V5JA 4MSWB 2WANA 1AO7D 4IS6A 5KAQG 3MX0A 2ERJC 1RZIA 2YA1A 3MRKB 2X4NB 1KIQA 1U8IB 3K74B 5CJ8A 5F9DC 5J06A 1LO0L 3QIUC 3U6RB 5E00A 3FB8B 3MLSL 5I1JL 1J8KA 3AXLA 1NGXB 4G43B 5I8KL 2X4QB 4DUXA 3TBYB 3MOBL 3Q3GB 3QXDA 2FR4A 5AZ2L 5JQ6L 4IIQA 3GSUB 5C7XL 2HH0H 2RCSL 1Z3GL 2R69L 4KZDL 3DROB 3MUJA 2A77H 1XZ0A 4PRPE 4JQXC 5TPWH 4WU7B 4G9FD 1JHLL 4HWEL 2J8UB 3RWFA 4ZNEA 4PJEF 4H1LG 2YMXL 4HKBA 4WFHE 5FGRA 3U9UB 2YZ8A 5FDWA 4G6KL 3WUWA 2OL3L 3VRIB 1KN4H 3E2HC 4D9RE 1N6VA 1G7HB 1T5XB 2ICEA 4HKZA 1BQHB 4QNPF 3RUGF 1T7WA 2DYPB 4TUJA 1P6FA 3MGTB 3VFMB 2DQUL 1M6OA 1IAIL 2W0FA 4GW4B 3H7LA 5IQ9A 5EIIA 2P4AB 2GIYA 5F6HI 4N8PA 4LLMA 2F53A 4Z8FH 1TZIB 3QUYA 4RDQF 3D3VD 1F4XL 4QOKA 3MRRA 2AEQH 4BK5A 3VFVA 4BZ1L 5EU4A 3EYQC 3QPXH 4YPGB 5EZIH 2ARWA 1NLBH 1F2QA 2P44B 4J3XA 4PJ9B 4NO0A 2O5ZL 5C0GA 5IM7B 4LK4A 4HT1L 3KYNA 2DQJH 2LU3A 1R3JB 4O2EA 1HHJB 4QRSB 4E42B 2B4CL 3H9SA 4Y5VC 1B6UA 4YFDB 3KYKL 1UJ3A 4XAKD 1JI2A 5DD1L 1QSFD 4NM4L 5MEOA 3STLB 3A0OA 1BQUA 7CGTA 1QSEA 1PY4A 4FTVB 4O02H 4AEIL 3NCMA 1CLYL 4NHUB 1MRFH 2YN5A 4GW5B 4JFFB 2WBJB 4LVEA 1DFBH 2MTPA 2HVKA 4FQXB 4XI5C 3RAJH 4GAYB 5B4MC 2XV6B 3BKYH 1G7PB 4PV8A 1S7SA 2RFXA 1V7ML 4ELKA 2DQGH 1BHGA 4P2RB 1HXMA 1EMTL 3MLZL 2HTLD 5DJ8A 1CVSC 3RTQC 3GIZH 3GKZA 2V17L 2ZCLH 2QSQA 4PJFF 1EAPA 1UACL 3DX7A 3KPLA 3L7EA 3VU2A 5IHUL 5TE4H 4G8GB 2AXHA 4HIXL 1SYVB 2R1WB 1PJ9A 1BM3H 4HS3B 5ITBL 3PGCB 3X13A 4NKIL 3D39D 4U1SB 3NMEA 2HRLA 3IDNB 4LCCC 4WY7L 2YXMA 1ZTXH 4GLRI 3QIWB 4GKZA 3PWVB 3D1MC 3MNWA 2H32A 3CVIH 3OBAA 1FZMB 4H25B 3ZYIA 25C8L 4KDTC 4WW2F 4ISVB 4NKMB 2WP3O 1U9KA 3BKMH 4YXLL 5JR1H 4NRZB 2G75A 4OT1L 4PJGB 4EOWL 5SWQB 3ILPA 5BRZB 4NSKA 5FA3B 2J4WH 1MVUB 4HUWB 4K7PY 4RA0C 5IMLB 1R3IL 1ZHKB 5CMAA 4U6YB 2IPUG 2VLJB 1AXTH 1RZJL 2BY0A 2CRYA 1CFQA 1AXSB 1AGCA 1D5ZA 4PV9B 1T21B 1ONQB 5ADPH 2ADFL 2FH6A 1QSZA 1S78D 4Z7QE 3FN0H 4I3SH 5MP6L 1TQCC 3L5XL 3S5LB 1BFTA 4Y1AE 3D69A 4R4ND 4Q6IA 5K33A 5HDQH 2GJ6E 1HHIA 1JZ4A 5F88A 3MV9D 3TP4A 2R0WL 3UJTL 1KJ3L 1DP0A 1MCNA 3HC4H 3I6KB 2Q86A 3GI8H 3HA0A 4LLDA 1IAOB 1V3KA 5BZDA 5CIPH 4LSTH 1LO4H 1I3GL 2HG5B 3MUGA 4JO3L 4MNQE 4D3CH 3R0MA 3CMOH 3LQAL 1KBGH 2KDGA 5JW5A 3MJ9H 1PKOA 4XCNA 4K71C 3PJSA 3O45B 4LSSL 1GGBL 1FFPA 1KFAH 4HV8A 5I1KH 2Y72A 5I1IL 2Q7YA 1L7IH 3B8YA 4KJWD 2APXA 5IVZB 4UZGA 3AFLA 4XP5L 4N8CH 5I0ZA 3MACH 1HKLL 4V2BA 3T4YB 4JZOB 2FGWL 3HB3C 3ZE2E 1I4FA 4HJJL 3VXPA 1NUNB 4LSUL 1HK6A 4I18A 4OLYL 1UM6H 2OSLA 5DR5H 3AUVA 5GGSA 1OAUH 1EJOH 3SBWA 1F58L 3BEVA 2YPKA 3U2SA 1GSMA 1U8OB 4R90L 3V6OA 5E8EB 5L88L 1DE4B 1AGDA 2C3GA 3WIHA 4JCMA 5E5RB 5IFAH 2ENSA 1VPOL 2VL5A 3B9DA 3QEQB 4LCYB 4C54A 4POUB 1RZJC 3IDJB 5ILTL 3SDXE 4OZFB 5E2VL 3VXMA 1KULA 3GMMB 3DUHA 4X6FB 3VG9B 3TO4B 2HAZA 5D71H 4X7TA 3VRJB 2ZCHL 5DUBB 4XI5D 2GUOA 4YR6A 5JHDB 1CK0L 1JWSA 4PLKC 1KPUA 1E4WL 2AJSH 4MXVF 4U1KB 1EEYB 1AKJA 3GSWA 2PW2A 2G2RB 3AB0C 1P84J 1AXIB 1OPGL 2C3WA 3MR9A 5FKPB 3K81A 2J6EL 3CFEB 3P40A 2VDLL 3V4UH 1JL8A 3LN5A 4WHYG 2BVOB 5B38B 2ED9A 5HYQB 3G5ZB 4MX7B 1HYSD 4XGZB 1BWWA 5D1XC 1DCLA 4J23A 3GI9L 3LQAC 4F7EB 4HEPG 4BKLB 4OZHA 3MLXL 2YPVL 3QWOB 1IC4L 1JPST 2OLDA 1CU4L 4NN7C 1YPZB 1JUFB 1IAII 4LSQH 3RRQA 4KZEH 1VADB 3RWIA 5IBTH 5HGHB 2V5YA 2AI0L 1G6RA 3CGTA 2HFEB 4KI5C 4I0PA 1PW3A 1F6AB 4LSPL 1KCRH 4R9HA 1EJ6A 4PRHA 2JCCA 2APTA 4I4WB 2HFGH 5C08A 1RZGB 1UYWL 1QBMH 3QI9C 5IQ7L 1FDLL 1A7RL 2ZSWB 2LFGA 4APQA 4WTZG 1LDPL 4LFHD 2WQRA 3SCMA 3MRFB 5HHNB 4OZGB 1NMAL 4HAGA 1UKTA 1OLLA 43C9A 4KRMB 3KPSB 1T04B 2YRLA 2X42A 1T1ZA 4RGNB 4X8JB 3TBWB 3VXSE 2DQHL 4PJIA 5I73C 3B83A 4ODBD 5DVOA 1Q72L 2CH8A 3TJHC 4KTYA 4XPBH 1VGEL 3LS4H 2R1XB 3D87B 2VDMH 5KANG 1I7TB 1KNOA 1HI6A 4JFHD 4GSDH 1OARL 3T3ME 2OTUB 3H9YA 2VZ3A 4NZUL 4PUBL 1R5WB 3QUXC 1GGIL 1RUQL 3P73A 3RX8A 3V0WH 4U7SA 1JK8A 3C09C 5HGAB 2ATPA 5IEHA 3FT2A 1AC6A 3QUMH 3WHE0 5F1NA 1J12A 3VFTA 5ISZA 4NUJA 4XNYL 5KS9B 5DEZA 6FABL 2XN9A 4NQSB 4XVUD 1I1YA 4KKBC 4JRYD 4U7MA 3KNBA 3TCLA 4O00A 3RX5A 4CW1B 3HUJA 1U91A 4MA7H 1I8IB 3O9WB 4XHQA 2WAHA 1KCVH 2A73A 2GFBA 1FLRH 3GJEA 3DX9B 1MH5A 3CPLA 2Q6WB 3O6FC 1M7IA 2NNAA 1J88A 3AVEA 1SBSH 3MRGA 2GAZB 4ZTPH 3MLVL 2BVQB 5E2JA 4M5ZH 1M71A 2ZJSH 5I1GH 4E0RB 3L1OH 1JHKL 2P8LA 3JVGC 5I30L 2FBJH 3FHAA 1W8OA 1RV6X 1HNGA 4LF3A 4ZXBA 4U31A 5KVGH 4XB8A 4NT6A 4WGVB 4I9WE 3SDDA 1OGAB 2A0LD 3QULA 3BKJH 1T80A 3WHXB 5IVXF 1CBVL 3FQXA 4Y5XA 2UWEA 4WTXA 4X9HA 3TNNB 1J86A 4NQDE 4M6MH 4XHJD 1KTDA 2P8PB 3ZKNC 4W6YB 2ADGA 3C8DA 3VWKD 3O6LL 3UTTE 3FB7B 2IAND 4LCIL 4XCEB 1WWBX 2H6PB 4NC1C 4UMGA 1RZKH 3IJYB 4HKXA 3PDDA 4D9QD 3I3BA 5D1XD 4BFIB 4QRQB 4NQCE 3RL1A 4NRYB 4C58B 1OAYL 2X4PA 3CU7A 1HH6A 2DQFB 4KMLB 1FZKA 3BD5A 3P4OA 3LSOA 3MLWL 4NWTH 3JV0A 3TJEL 5FB8A 1ZVHA 5HDOA 3C6LA 3QCUL 4PJXB 3CDFA 5HHXL 3QFJB 4JFOB 1S7WB 2EDHA 1QSVA 3GO1L 1EERB 2VXQH 1U8MB 1KJMB 4M43L 4XNZB 4ZS6C 3ESUF 2KPNA 3F7RA 5HD8C 5CEYA 1IRAY 1V7NL 3TF7C 4ODTL 1BD2D 1A1MA 3PGFL 4HWBH 4LLVA 3DUSB 3MA7B 1EEZA 4PP2A 4L4TD 1Q0XH 3QZWA 4L8CA 3KXFB 2P47B 5IOPB 2JB5H 3JWDC 3TBSB 4HUUA 1U42A 3RGVA 4B0MM 4K8RD 3WNMA 3CCHB 1UEMA 1QFWL 5T1MA 4NNPL 1ZHNB 4X6DB 5CD3B 1DN0B 2GSIA 1UB5B 4LBEB 1HWGB 3QG6A 4UDUA 1LEGB 3WKNA 5JXAH 3QUXD 3AY4A 2P8MA 3O4LB 2BNRD 1F3JA 2C1PB 3O8XA 4Z7WB 5HYJE 3MRJB 1S3KL 5ERWA 3DIFA 5C0AB 2ZUUA 4I13B 4JM2A 5D2LF 3OKMB 2AXFA 1UEYA 3PQYA 4K3JH 1FZJB 3GUTA 4MCZA 2NY6B 4HUNB 3L5WB 5BOPA 3BOVA 4LHUG 3UP1A 2XICA 5GRXG 5EC2A 1DJSA 4ONGL 3CSYA 5HDLA 3U46B 2P45B 4MJ5A 4Z7UA 4RIRA 3ARQA 5JW4Q 2DWEB 3MLYH 4OFDA 1TDQA 2R15A 5FYJD 3H3KA 3G6JB 3FRPA 3BZ4B 3U48A 2BOBA 2ZUQC 4GFTB 1P4BH 5DYOB 5MENB 3C5JB 3OJDB 1YY9C 4HUXA 3SGDH 5L2KB 3V5DB 1N7MH 2EH7H 3D2UA 4X99B 4RBPH 1K2DB 2HH0L 2DB8A 4HS8H 3FQUB 4OCMC 1CL7H 3H9HB 4RDQG 2A77L 4EVNA 2P24B 3HPLA 3NFNA 5KBNC 2WBKA 5TPWL 5HVGB 1GL4B 3G9VA 4KKAC 4V2CB 3V0VB 4YFEA 2BVEA 2CSPA 4MXWH 5KANI 1AGFB 3FB6B 4M4PA 1KN4L 4M93B 1J7VR 1SJEB 4IRSD 4P4KC 5BV7B 3OGCB 1KEGH 1TZHA 1UZ8A 4POZD 3DYOA 2BOCA 1MY7A 2I9LB 4HG4K 4Z8FL 3PL6A 1EH9A 1T83C 2AAVA 4WU5A 2XQYK 2H3NA 2AEQL 1EXUB 5DWUH 2XXCB 2JIXA 3QPXL 5EZIL 1A3RL 4KI5E 4XXDB 1NLBL 2A38A 1BFOB 1TNMA 2DQJL 1MI5B 5KOMC 3PP3K 5JXEC 5TF1H 3ABZA 4X5LA 5DJCB 5FOBB 3W9EB 3UTPD 3O3AA 3CNKA 5EOTA 1DQJB 1EBPA 2XKSA 2Z91A 3U0TA 5EBMA 1FL5A 1QACA 2NX5A 5J9PA 2CDGA 4UINH 1QFPA 1XF2A 1AQKH 5D7JA 1JNHA 5J13B 5KS9F 4O02L 1NCCH 4IHOB 5J1AA 4L8SA 2DLTA 4BFGA 5IG7A 3DXAE 4ORGB 2EDXA 5E4EB 2C7UA 4IS6B 1PLGH 4U1GC 4Y16C 1KIQB 3FAXA 3RAJL 4IM8A 5KVMC 5E00B 1AFVH 3BKYL 3AXLB 5D2NB 3TFKC 1NC4A 1F3RB 3R06A 2DQGL 4QXUH 2NY7H 3QR2A 4X80H 5D5MF 2FR4B 4L9LC 3H0TA 4IIQB 1UQSA 3WN5A 4PLNC 5EORH 3S37H 1H3UA 3GIZL 2AQ1A 2ZCLL 3FQTA 3SGJC 1XZ0B 1BVLA 4HJ0C 2QQNH 1AI1H 1U3YA 5EDXA 5HHMD 3RWFB 5TE4L 3RBSA 4HKBB 1TTFA 3MRCA 4OCRH 1CFVH 1I1CA 1KIRA 3OV6A 1BM3L 3DTXA 3UBXG 5FDWB 3WUWB 5JW4R 3OF6A 4Y2OA 3OKNA 4C55A 2EDBA 1ZTXL 5TGBA 2H1PH 2ICEB 2MKWA 4HKZB 4TUJB 3WNKA 3BWAA 3CVIL 1G0YR 3GEWB 4YBQD 1FLTX 1NC2A 4PRIA 5HI3D 4YAQA 3O11A 4LU5H 2W0FB 3R0NA 4FFWD 3OPZH 1T20A 5EIIB 5IQ9B 3BKML 5JR1L 1JRHH 4LLMB 2F53B 3QUYB 1NMCC 4QOKB 3MRRB 3VFVB 2J4WL 1Q9LA 2FX7H 4X9GA 5EU4B 1ZLUH 3HLAA 5F7UA 3I3EA 5C0GB 4AZ8A 1PAMA 1AXTL 1XH3A 3INUH 3KYNB 3MCKA 1IFHH 1LILA 5ADPL 4JO4H 4O2EB 3FN0L 2VN7A 4I3SL 3H9SB 4X7SH 3RWGA 4WW2C 1UJ3B 2R4SL 1EO7A 1MWAA 1K8DA 1FN4A 5KSUA 5MEOB 1J8HE 1IC1A 2NY1D 4YJZL 4U3HA 5HDQL 2F8OA 1QSEB 1AGBA 2GJZA 2WZPD 1B6DA 1ZGLM 3HC4L 1R0AH 3GI8L 4NC1E 3LKSB 5EU3A 1ZANH 4LSTL 1LO4L 4D3CL 1JF1A 4P4KD 1A9EA 2I9TA 3CMOL 3LRGA 3O2VH 4XVJH 1KBGL 1A0QH 3MJ9L 2XIDA 4XB7A 2OM5A 1KFAL 4PV8B 1S7SB 5I1KL 2RFXB 4LCWE 1L7IL 4B7IA 1MCWM 2AVGA 1HYRC 3ZYJA 1HXMB 1NMBH 2PXYC 5DJ8B 5CBAA 2B20A 3MACL 1R6VA 2D2OA 1SBBA 5A3IC 3ARDC 1EAPB 32C2A 1EUTA 1N0LA 3MC0A 3BQUB 3JWOH 4JZJC 3DX7B 4JJ5A 4X6DF 5JOEA 1UM6L 4UTAH 5HYSB 5DR5L 5F9JB 1A6VH 1OAUL 1EJOL 5CEZH 4TQEH 3X13B 3EYOB 2XZQH 3CC5A 5F89A 2V2TB 4GKZB 2H32B 5IFAL 5E2UH 2HMID 5KSBF 1X3DA 5BV7H 2NTFA 5JO5A 2HP4A 3RVUC 1II4E 4I5BA 1OTTD 2G75B 4DAGL 3ILPB 5D71L 1U8NA 4NSKB 1RUKH 1BIHA 2DQCH 4Y16D 5CMAB 2ICWI 1CFQB 1QFHA 1AGCB 2AJSL 5DQJA 2ZWLT 1D5ZB 1BQHG 3TT1H 3BMVA 4IRJD 4OIBA 2CDEA 4XVSH 3OL2A 3V4UL 4RFOH 1BJMA 4P9MH 2EDJA 3D69B 5L6YH 3QDMA 2R0KH 5KSAA 2ADJA 1HHIB 4GS7B 1BJ1H 4HX1A 3NPSC 4F7PA 2NXYB 4LLDB 3HE7A 3MUGB 3S3PA 4KZEL 4P4RB 5IBTL 5JW5B 4MAYD 4WO4A 1MHEA 3BYTA 4RNRA 4O51B 4XCNB 3BD3A 4ALAH 1KCRL 4HV8B 3RX7A 1EVUA 4DKEH 2Q7YB 2HFGL 1QBML 5IV2B 3VGGA 2Z8WC 5GGTH 4MJ4A 4FQ1H 1I4FB 2PTTA 3VXPB 4I18B 3RZCB 2CJUH 4RFEA 1I1FA 2D0FA 5DK3A 5GGSB 4G3YH 1D3CA 4WVRA 2YPKB 3U2SB 2H8PA 3P9LA 1CICA 4FNLH 4XPBL 1AGDB 2VDML 2PYED 4JY4A 3VFRA 1CGXA 3UTQB 2OJEB 4JE4B 2P5EE 2VL5B 4GSDL 1MREH 2DLHA 5T1KD 4RBPK 5CSGA 1JGLH 3VXMB 3QA3B 3TESA 4PJ9C 1INEH 3V0WL 4QLRA 1NCNA 4X7TB 3TYGH 3QWQB 1G9EA 3UBXI 2NYYC 3QUML 4YR6B 1C12A 3S3JA 3DX6A 3WV0A 1ZGLA 4M4RA 5IJKA 3B2VH 2VOTA 3UTSE 2FZ3A 1AKJB 2EE3A 3GSWB 1BOYA 3MR9B 5L9DH 1TQBB 4LDOB 1T0MA 2PF6A 1BWMA 3UPRA 4Z76A 1DQDH 4JO2H 1OAZH 2X5PA 3LN5B 4KPHH 5A3ID 5T33H 1ZHLA 4MA7L 3JBG7 1WCQA 5DF0A 1KCVL 1DUYA 1FLRL 3TVMD 3VI4F 4WFFE 3ALWA 3VGDA 1GC1H 3VXUA 2WBJC 5C0JB 4PGJA 5IIEA 1SBSL 4ZTPL 4FQXC 4JKWA 4M5ZL 3HZYA 2ZJSL 2FECL 3GRWA 2K1MA 3L1OL 5C0CA 5I1GL 1FJ1A 3RWIB 4OD2B 1WT5C 1U8JA 3D0VA 1G6RB 5F8RC 3Q0HA 3HR6A 2CK0H 3KPTA 4I0PB 2FBJL 2AKRA 5EU7C 4PRHB 1REIA 3P0GB 2IAMC 5I19L 1KOAA 5C08B 5KVGL 1B0GA 1DQQA 4KGLA 4C56A 2XI9A 4APQB 3SCMB 2VERN 3BKJL 1KJ2H 3QPQD 3FN3A 3VXRE 4PJ5D 3PHSA 4M6ML 4ZYKA 5K9JH 4JPVH 5EO1A 3QIWC 4WJ5A 2D03H 3UXFA 4P46A 3MRDB 5EG6C 1RZKL 3GIVA 4FQHA 1G1YA 1U8KA 1YDPA 4PJHA 1KNOB 3EAKA 1HI6B 2N1KA 1CD8A 3BP5A 3H3BC 2H32H 5I71C 1TITA 1NQBA 3CK0H 5EUOA 4PJFE 3TZVC 3FFCA 4LRIC 5AUMA 3DMMC 4LGSB 5F7WC 3P73B 4FFZH 2D7NA 2ATPB 5IEHB 4NWTL 3D9AH 1WFTA 4O58H 3X12A 4KUZH 3GSNA 5F1NB 4L3CA 3VFTB 5ISZB 1RUMH 4YIQA 4NUJB 4RWYH 5EWIH 2XN9B 2VXQL 5HVWA 4NCDA 4QXGH 1WTGT 2HJLA 4OI8A 1KLGA 1AO7A 3KNBB 4M7ZB 3TCLB 4RISH 3WDHA 2OTWA 3TA3B 3DETC 3HUJB 3BMWA 2UVFA 3PHQA 2A73B 1EUUA 4HWBL 3VFUA 3GJEB 1Q0XL 1MH5B 1QO3A 2JB5L 3CPLB 3QUZB 1M7IB 2NNAB 1ZLUK 1AIFA 3MRGB 4GBXD 3U1SL 1ZS8A 1M71B 3ZKMD 1YEIH 4G9FA 4HLJA 4X5WA 3O41A 4DK3A 5F7LB 5FECA 4P2QD 4NIKB 5JXAL 4PB0H 1MPAH 4PJ7F 4LF3B 4ZXBB 3C60B 2BHUA 4J7RA 3BYYA 4NT6B 5CGTA 5I8OH 1OQOA 4PGZA 3SDDB 1OP3H 3QDJD 5GZOC 1JZ2A 3QULB 1NAMA 1NCDH 2Q76A 4NZRH 2R2EA 1OAKH 3FQXB 4K3JL 2UWEB 2VDOL 2FO4A 1RZKC 2YPLD 3WNPA 4PGBA 1KYOK 1KTDB 2ADGB 2AQ2A 3WS3B 3QXWA 3D3VA 2VDNH 4I2XA 3LV3B 1QLFA 4HKXB 3MLYL 5HY9A 3S98A 4EI6A 2VUOA 3OZ9H 3LN4A 2VABA 3RY6A 3RL1B 3WIHH 4S1RH 2X4PB 3TO4C 1HH6B 1P4BL 1D5IH 4TSCH 2NY3B 5HPMA 5DK2B 1YC7A 2BHZA 1N7ML 2DKSA 2EH7L 1FZKB 1Z0MA 3P4OB 5DJZA 1BQSA 1GOHA 4JM4H 2KZ1B 1HWHB 4HS8L 1QSFA 1CL7L 3Q2CA 5BJTB 5FB8B 3C6LB 2QL1A 4MA3A 3EOBA 3L3HA 3SKOB 2IAMD 3ET9F 4MXWL 4P5KA 1QEWA 2HVJA 3BPLC 5DHXB 4IOIA 4E41D 4NUGH 4JKMA 4YHLH 3F6LA 4POYA 5GGRY 3MRBA 4YHYC 3RVWC 5HHOA 1KEGL 4JKKA 3MLPA 1KGCD 3K2MC 4LLVB 1EEZB 4L1HA 3BGMA 1UM4H 4L8CB 2G5RA 1YY8A 4L8BA 1PG7W 4J2XA 1MELA 3RGVB 2A2QT 3H2WA 3GBNH 5DWUL 1ZT4A 1OTSD 2BXYA 4RRPG 5T1MB 3S35X 2GSIB 4Y8AA 3DJ9A 3TZVD 3QG6B 1G6RH 3DMMD 5TF1L 1JBJA 3OKEA 5CP7A 1F3JB 2J8UE 2EDFA 3D39A 3O8XB 4RGNC 4NFDA 3DIFB 2YWYA 4JM2B 2AXFB 3DVIA 1B4JH 3PQYB 3OKLA 4UINL 3GUTB 4MCZB 1AQKL 4G7YH 2VLME 1JNNH 3QRFM 4U1LB 1NCCL 3CSYB 3DX8A 4MJ5B 4Z7UB 4DCQB 5GZND 2EXYD 1PLGL 3SDCD 4G8IA 3VWJA 5F21B 1T6VN 4OQ1A 4WEUD 4LKXA 1AFVL 2BOBB 2O61B 4S10A 3GNMH 3Q5TA 2ZP0T 2FECI 4MJ6A 4QXUL 2NY7L 4X80L 4HUXB 4OZHF 3SOBH 3QJHA 3S37L 3V5KA 1GIGH 1N59B 5ALBH 4EVNB 3HPLB 3MREB 3NFNB 2QQNL 1AI1L 3C6SA 1Q9OB 3GHBH 2X70A 4UDTA 2AJXH 3CFBA 5FM8A 3EOAB 4L4JA 4OCRL 3VI3F 1CFVL 2JCCF 1J1OH 1HHHA 5BS0D 1ZVSA 4I77H 1RU9H 5HGBB 2C5DC 4FTVE 1T0PB 4X0KA 4YEFA 3U0WH 2H1PL 1Y18B 4WENB 1TZHB 1UZ8B 5FA4A 5ID1A 1WGOA 4KRPD 4LU5L 4JFFE 4QY8A 2BOCB 3LRHA 3RU8H 3OPZL 2YD8A 5DHYB 4PJIF 1JRHL 4F3FA 5D7IF 4WU5B 2H3NB 5ESAA 4MD0A 1RHHA 1Y0LA 4KAQH 4N0UA 2FX7L 2Z93A 5E8OA 4M1CC 4P2RE 2JIXB 3CUPA 5E03A 5T1LD 3UYPA 5J12C 5EU7E 3INUL 1IFHL 2J2ZA 4N8VA 1ZAGA 2VKXA 3DVGB 4JO4L 3O3AB 4X7SL 5EOTB 4G8GE 2Z91B 3EJZD 2E9BA 2V5TA 3U0TB 5EBMB 1FL5B 1VHPA 4KJQC 5J9PB 4HAFA 1Z5LA 3GMLA 1DVFA 1S9YB 5BVJB 4HFWA 1XF2B 5D7JB 2WIMA 4TOYH 3MQIA 1R0AL 4DGYH 5J1AB 4L8SB 5IG7B 2NZ9C 1ZANL 1R5VA 4CN4A 3RVWD 2KBGA 1WCBA 3O2VL 1JN6A 4XVJL 2YHGA 3HUJF 4PJGE 1A0QL 4ZO8A 5BRZE 4F2MB 1ZV5A 3R4DA 5HDBF 5JOPE 1NC4B 1X4YA 3R06B 2VLJE 4CUCA 2BP3A 3WN5B 1NMBL 1UQSB 2EZ0C 4RAVA 4TVSa 4XCFH 4HWUA 2D4DA 1I8MA 3FQTB 1T89C 1BVLB 3BZDA 4NM8H 3JWOL 4XNZC 1RJLB 2QV2A 3MRIA 5GGUA 4XPFH 4UTAL 1A6VL 3MRCB 1FV1A 4OV5A 3B43A 5CEZL 4TQEL 4I1NB 2OTPA 3E6HA 2XZQL 3OKNB 3ORJA 5TGBB 3KPOA 1T7YA 3KYMA 3T04D 3BWAB 5E2UL 5I17A 2UWEF 1NC2B 4YAQB 3O11B 3AS0A 5BV7L 2Z35A 2Y7QA 4NYLA 1HQRA 1RMFH 3RGHA 2IMNA 4HUKB 4YDVA 4OD1H 1NFDB 3K8KA 1FYHB 1P2CA 2FLRT 3BO8A 1RUKL 1Q9LB 4D0CB 3HLAB 2DQCL 1BVZA 2MOVA 3WFDH 1VCAA 1R3LB 3SGDI 5I8CA 1PBYA 4QHMA 5F7FA 2VUYA 1XH3B 3MCKB 5EZOH 1NCTA 1WFOA 1J1XH 3TT1L 1CL7I 2UZIH 4PJBF 2Z4QA 4XVSL 1P5VA 4K07A 3RWGB 4NKDA 2AJVH 4GKOA 1Z6JT 2NY6C 3CX5K 3GJFA 4RFOL 1T7XA 4I8DA 4JKLA 1MWAB 4P9ML 5LAXA 3AMKA 5KSUB 1FN4B 5L6YL 2B5IB 2JJSC 2O26U 2R0KL 4Q9RH 2VO5A 1AGBB 1I7ZA 2GJZB 4ELMA 3I6LD 3O6MH 4KXZH 3SE3A 1U95A 3QEQE 4XNUH 5EU3B 1G7IA 5B3JF 1JF1B 1A9EB 1HHGA 1T66C 3K2UH 3ZL4H 5C2BH 4PG9A 1W0YT 3O3DA 3ZT5A 1JFQH 4ALAL 2PUQT 5DHVH 3C9NA 4DKEL 5JHDE 1RK0A 3JWOC 3QDGA 2NMSA 3TH3T 1MUJA 1JCKA 1CXEA 5IWLA 4NQED 5GGVY 2I27N 1FIEA 4JQVA 4JRYA 5GGTL 5CBAB 4FQ1L 1T1WA 1I7RB 4LSDA 3T0VA 3MV11 4PJ8D 32C2B 1CD0A 5I1EH 2CJUL 1FO0A 1A4KB 4M93C 4LPVA 5E1HB 4G3YL 4M00A 5JMRA 5BV7C 4B5EA 3BJ91 1MCSA 1BLNB 3HS0A 2CKBA 4XH2B 3AS1A 4FABH 4FNLL 3CC5B 3CFIC 4KKLC 5F89B 3DGCR 4JM2F 4AIOA 4OLWH 1YPZE 3P9MA 5B3NA 1MREL 2NTFB 3ZDZE 5ACLA 4I5BB 1NCAH 1JGLL 3ALXA 4QGTA 3M45A 1GH7A 1BAFH 2JLLA 1INEL 3MV8A 1A47A 2FX8H 3TYGL 3WUWG 1EBAA 3BESR 3RVXD 1BF2A 5DRWA 4ZUUA 3B2VL 4G6AD 4OZGE 5DQJB 5AEAA 3KPSE 1KJVA 4YFLF 1R3KA 3L3GA 1FFNA 5CJ5A 1DLFH 3VWKA 2CDEB 3N1FC 4RGNE 5L9DL 2IANA 3TN0D 3TCXA 3CDYA 1S9VA 3DOSA 1DQDL 4JO2L 4KPHL 3HC0B 2F54D 4N90E 5T33L 5J13C 5D4QA 2XTJD 3SEPA 2D0GA 3QDMB 1FP5A 5D1XA 1XGPA 5KSAB 1T1XA 5AYUH 4HX1B 2GHWB 3GSRA 2XWBA 5E4EC 5D7LA 1J0KA 1YN6A 1GC1L 2MHAB 2LU4A 1NDMB 3HE7B 3RI5K 4OD3H 5IR1A 3BKCH 3LZFH 1ZA3A 3VRLF 4M6NH 4R97C 2VLLA 1IKNA 1I9RH 5TQ0H 1YQ2A 1MHEB 1PVHA 3GMOA 4RNRB 4WO4B 1JRHI 2CK0L 5IB4A 1CDIA 4IIQC 3QJFA 4O2CB 4TPRH 5DT1H 3GZKA 4U6HA 3BUYA 5A2KH 1QHOA 2M2DA 2RAMA 4IOFC 2VSDA 4HWZB 1SQ2N 3BGAA 5KS9E 5C71A 1KJ2L 4MGXA 1BD2A 2PTTB 1JYXA 2JF1A 2N7AA 2AV7A 2CUMA 4R7NA 4L4TA 4RFEB 5FYKD 1ACYH 4JPVL 1R24A 4CADB 3VXOA 1J1PH 2IPTH 2D03L 2H8PB 3P9LB 4UQ2B 4Y5YA 1MIMH 4ZSOA 1T03H 4JFED 2XYCA 4JY4B 2OMBA 4TTGA 3SDAD 1ZT1A 3CK0L 3G5VB 5INCB 1ADQA 2BNRA 3PG2A 1N3NA 3HAEA 4FFZL 4W4OA 2CIIA 5C0BA 4UBDC 3D9AL 2EC8A 4FQIH 4O58L 1C12B 4KUZL 5FF6A 2BDNH 3DX6B 1ZGLB 1OGAE 4TNVF 1RUML 2FZ3B 1WBXA 3JTSB 1UJ3C 3GSOA 4RWYL 5EWIL 3CXHK 4XMKH 4YHNA 4QXGL 4Y4HD 1GC1C 3UPRB 4RISL 4W81A 1OP9A 4S1SH 3RQ3A 1ZHLB 3VG0H 4C4KT 1DUYB 1MWAH 4I3GA 5CLWA 4HH9A 1D7FA 1NUGA 2R9HC 3MRQA 3O6KH 3PWLA 2OZ4A 1JZ3A 5B21A 3ZMRA 3NTCH 5IIEB 2HKFH 3JZ7A 3WSQL 3VDAA 4KKLD 4FQLH 3HZYB 3KDMA 1ODAA 2ITCA 1FJ1B 3TPUA 1XF3A 4WCYH 4GOSA 3D0VB 1YEIL 1GGTA 4WV1A 4PTUA 2AKRB 2UUDK 4PB0L 1MPAL 1I3VA 4PJXE 4M9PA 1QFWM 3O81A 3QFJE 1HZHH 1B0GB 1DQQB 1C5DA 4YBLB 4C56B 5F6HJ 5I8OL 3HI6H 2HWZH 4NOFA 1NCDL 4IRSA 3IFNH 3MFFA 4NZRL 3RVTC 1OAKL 4A2LA 4ZYKB 4OGZA 5FYLD 5EO1B 3PWNA 1QQDA 4IMLA 5BXFA 3PWPD 5BOZG 4ZG1A 4P46B 5J1TC 2VDNL 3KXFE 1T4KA 3GIVB 4FQHB 2YZ1A 1QUNA 1U8KB 4PJHB 3THMH 1MCRA 3OZ9L 3WIHL 4S1RL 5ICXA 3BP5B 1IBGH 5ESQA 1D5IL 4TSCL 5EUOB 4K94H 3L7FA 2DM4A 5AUMB 2ZG1A 2W60A 4X6DE 4LDEB 1NDGA 4W68A 5EPMA 5TQ2H 4AIZA 3WD5H 1H5BA 3M8OH 3LB6D 4JM4L 3O4LE 3ULVH 4JRXD 3X12B 4MA8H 3GSNB 4Z7WE 3F58H 5C0AE 4L3CB 5DJ2B 3ZE0F 4YIQB 4K7PX 5E95B 2VLRD 4Q6IC 4IOFD 2NXZC 4CVZA 4TVPH 2CR3A 4NUGL 1PX3A 2HJLB 1KLGB 1AO7B 5EC1A 4YHLL 2OTWB 3K80A 1J9CT 3LKNA 3NCYS 2VR5A 3PHQB 4Z7OE 2NXYC 2APVA 3VFUB 3DRTA 4MCYA 1UM4L 1VACA 3EZ8A 1A7NH 4NKQB 4BQCA 1QO3B 3G6JE 4YXKH 1AIFB 3FOMA 3MOAH 2CDFA 1ZS8B 3WJLA 1DSFH 5MENE 3V79C 3GBNL 3MNVA 5L2KE 1BPVA 3VH8A 4PJCA 4G9FB 4X5WB 3O41B 5FECB 3SJVA 1G6RL 4WI8A 1A02N 1HXYB 4NO0D 3JUYA 4H5SA 1HILB 2HT4D 5IESH 5CEZE 4MJID 4I18C 3UDWA 5D6DA 3I50H 5J8OA 2Q76B 2OBGA 1B4JL 5F7DA 3SBWC 2FO4B 1UFUA 4DKDC 1IGYB 4G7YL 3EHBC 4U33A 1JNNL 3V6OC 5FEBA 5JNYA 1NGYA 1VEPA 4MB4A 1QR4A 4LNRA 2F9BT 3D3VB 1QSED 2WWKT 5CP3H 5DD0H 1JE6A 4F7TA 5HY9B 1A4JA 4YE4H 4EI6B 3VMOA 3LN4B 2VABB 5E6ID 4GG6E 4KRNA 4P5TA 5T3XH 1X9QA 3GNML 1N64H 4HGMA 1SMAA 4HZLA 4P9HH 4WI2A 1MI5E 4RMQA 1NBYA 2QSVA 1GIGL 4LCUA 5C09D 1QSFB 5ALBL 1HOCA 1L7TH 2YK1H 4MA3B 3EOBB 1INDH 1LP9A 1TQBC 3GHBL 1NCBH 3L3HB 2AJXL 4XNMB 5C07A 1J1OL 1L0XA 2IH3A 1QEWB 2MFNA 2HVJB 3BIBX 4I77L 1RU9L 4HWNA 4TYUA 4P4KA 1WAAE 4R6UA 3U0WL 3RVTD 3MRBB 3QISA 4W4NA 4J3OC 1EO8H 3BGMB 3RU8L 1NKRA 1MCEA 4L8BB 1YY8B 3V0AC 4AEFA 1G7LA 4I0PC 5D2NE 2QR0B 4KAQL 5EU6D 4HUVA 1ZT4B 4HS6A 5IUSA 2BY2A 3ZYOA 2EKSA 1RI8A 3GRWH 2J5LB 5D1ZD 2YS4A 5GRWA 4APQC 2HFFA 3SCMC 4IJ3B 3EYFA 3OKEB 4HW6A 5CP7B 2OI9C 1TENA 3VI4E 3D39B 4YUEH 4ZNEE 3O3BB 3U0PA 3BIKB 1K9TA 2W0LA 1TFHA 4R4FH 1I85A 3W11C 1JHTA 1YEKH 3VDBA 4TTDD 3G6AA 3OKLB 4TSBH 4WFGE 3T09A 4TOYL 5HXMA 1HH9A 2EDTA 3BPNB 4DGYL 5HVHC 2NXZD 3DX8B 2WIIA 4X6CF 1G0XA 2YA2A 2F53E 4G8IB 4Y88A 3FONB 4TNVK 5DJDA 4QOKE 2D0HA 3FHQA 1FVDA 2R39A 1V3JA 4QRRD 4TUOA 2YWZA 4GQ9H 3VFWA 4IRJA 4U0QB 1J0YA 1CLZH 3EDDA 2X1QA 3V5KB 1EEQA 3D48R 1MJUH 4XCFL 4YGVB 1RSFA 3H9SE 5C0IA 3ES6A 4NM8L 3C6SB 3O3EB 3CH8A 3MV9B 4XPFL 5EZLA 4M7ZC 3GSNH 1HHHB 1ZVSB 2OX5A 5IW3A 1JZ6A 2AV1A 2Z9TA 4OJFH 1WZLA 3DBXA 4ONFH 3U83A 4X0KB 1U8PB 5D7KE 1WISA 4MAYA 1CDJA 2QJDA 4U1MA 1AJ7H 4PRBA 3S9DB 1QRNA 1MOEA 3VXRD 3ZHLA 1TVBA 1RMFL 5I74B 4EUPA 1FCGA 5F7NC 4YNYA 3BE1H 4OD1L 3UZVB 4F3FB 2J3SA 3T4AA 3L95B 3WL9A 5I1CH 2RB8A 2UYLB 5ESAB 4MD0B 1Y0LB 4L5FH 4N0UB 1ITCA 2Z93B 5E8OB 4OGXH 3RDTA 4ZXBC 4PTTA 4PJHF 3WFDL 3U36A 3FQNA 1CTOA 5DD6B 5EZOL 1J1XL 3SDDC 3IFLH 1M7XA 4FRWA 3VGAB 3S36H 2UZIL 3MJ7A 5DZOA 3X3FH 1QPXA 4Y5XC 3K1KC 2M1KA 3QZWG 2AJVL 1KB5B 4PRAA 3CIQA 1YEEH 2KQMA 3BPOC 1CTNA 1NAMH 3GMLB 1DVFB 2R8SH 4HFWB 3TH4T 2ZNWA 1OF2A 3ZKSD 4ZFFB 5T1KA 3O6ML 1ZGLP 2JJUA 9CGTA 4XNUL 4KMQA 3IXAA 4OZIF 4LPWA 2GITA 2D7TH 5I9QB 1JN6B 3K2UL 3ZL4L 2NY3C 5C2BL 4M8QA 4N0CD 3VFPB 1OT1A 1A6TB 1TVHA 5IVOA 1S9XA 3C6LC 5FM5O 4RAVB 3F8UB 3CU1A 2OR9H 1I8MB 3BP6A 4MD4A 4KDVA 1X5GA 3TVMA 2EO1A 5I1EL 3MRIB 4HQQH 3QIBA 4JDZB 1FV1B 4JFQA 4OV5B 3FRPG 2N7BA 3D85D 5CLTA 1OGTA 3E6HB 5ETUA 2QEJA 2M8XA 3W11D 4FABL 4OGYH 1L4IA 1N5AA 3KPOB 3KYMB 1P84K 4OLWL 4MS8C 2CUIA 2JJVA 2Z35B 2Y7QB 4NYLB 3RGVC 3MROA 1NCAL 4S1DC 1CFNA 4YDVB 4X5XA 1BAFL 3IB4A 1P2CB 4Z7VB 4DZ8A 3BO8B 1X7QA 3DO7B 2FX8L 2XG5A 3AY4C 3NIFF 4PJ5A 4QHMB 3S34H 5I8CB 4BH8A 3O8XC 4OFIA 2Y5TA 2VSCA 1BZ9A 1HIMH 4E5XB 1DLFL 4JM2C 2V7NA 2Z4QB 3CSGA 4HK3J 1H3XA 3GJFB 2DMKA 4C59B 5LAXB 2BHYA 4MYWB 5HYFA 4NO3A 5AYUL 4HJGB 3V6OE 1EFXD 4MDIA 4ELMB 1I7ZB 3MJ9A 3S8WA 5J4MA 4F8TA 5FO9A 4TUKH 1U95B 2QKIA 3BRDA 1G7IB 4OD3L 3RY5A 1YEHH 3BKCL 3LZFL 1YEGH 3RWEA 3X3GH 3G04A 4M6NL 4L8DA 5E9DD 3KYAA 3VXME 1HHGB 2LQRA 4K71B 1I9RL 5TQ0L 4MNHA 2CPCA 4PG9B 1UXSA 3UZEA 1QD0A 3O3DB 2PW1B 2OXGA 4TPRL 1B90A 5DT1L 3C9NB 4BUHA 4TN9A 1G9MH 1RK0B 3V5HA 4CJ0A 1MUJB 4HXBH 4DKFH 2EDRA 1X5KA 3GMRB 4JRYB 1Z9MA 2IFGA 5CGYD 3E0GA 3LRSA 1AY1L 1FO0B 1ACYL 5KVFH 5K9KB 1J1PL 4OCSH 2IPTL 3QHTC 3HS0B 4GBXA 2CKBB 2VXUH 1MIML 4KHTH 1T03L 4MXQC 3MUY1 1K5NA 5I75C 1AHWA 3PL6C 3P9MB 3QWRA 3BN3B 5E0QA 1DLHA 3FB5A 4UV4H 4JHZA 1MCLA 1Q0YH 4HEME 4CBPA 3KG5A 2EIDA 4KK5D 4XWOD 4PRHE 4KV5F 3VI3E 4XBPA 5IEKA 1MAMH 5C08E 4YDKH 4FQIL 5J3HD 5DRWB 4ZUUB 2BDNL 1IE5A 2ICES 2YPLA 2X6MA 3AB0B 1LD9A 2AERT 4BSVA 1YQVH 1KJVB 5BW7A 1R3KB 1FFNB 3L3GB 5HTSA 4ZAKC 3VWKB 1QNZH 4XMKL 2IANB 1NAKH 1IGTA 1ZSDA 4G6FD 2B39A 3B6SA 1S9VB 5D7JC 3S36X 1H3GA 4R2GD 3ULUE 4S1SL 4GO6B 5K9OA 3VG0L 5D1XB 1E6OH 1T1XB 4HH8A 4L8SC 1MWAL 4PB9H 4F33A 5DUMH 5C9KA 3GSRB 2GJ6A 2XWBB 3O6KL 3LD8B 3NTCL 5D93B 2HKFL 1IGJB 3WJJA 1FBIH 5IR1B 4KROD 5DMIH 4FQLL 2E7HA 1T2JA 1VFAA 2VLLB 2DJUA 5T1DH 1CXHA 4MS8D 4WCYL 2XTLA 1MFDH 4DUWA 2PR4H 2BNQD 5IB4B 1Z3GH 5DVLA 3QJFB 4UU9A 3WN5C 4G8FB 3IU3A 1AD0B 4JREB 4U6HB 2ARJA 3BUYB 1HZHL 5IK3A 4HWEH 5K93A 3SPVB 5ISZE 4E41A 3HI6L 4PJDA 1FAKT 2HWZL 2XN9E 3IFNL 1BD2B 2X4RA 5GS2H 4PRDA 2B0SH 4L4VD 4L4TB 2ID5A 4KK8C 3NCCB 2PO6C 3GDBA 3HUJE 4PJAA 1R24B 5J89A 5DMJB 3VXOB 2R1YA 2BRQA 5IGXH 2D7MA 4Y5YB 1HEZA 1X5XA 4ZSOB 2V2WA 1K4CA 3I75A 4KXZI 3THML 3QUMA 5IVXA 3OB8A 1IBGL 1M1SA 5A16A 3QUXB 4K94L 2BNRB 3C09B 1N3NB 3HAEB 4IDLA 3SDXA 4PGEA 4RMRA 2CIIB 5TQ2L 3WD5L 1WZKA 3WFCH 3M8OL 1IL1A 4WRLA 2CLVA 2YUZA 3TIEB 3ULVL 5BZWA 1A64A 4OCWH 3D2UD 5FF6B 1C5CH 3F58L 4YFLI 1IAKA 1L9MA 1MLCA 3GSOB 3KLAA 4QRPD 2UWEE 2EIZA 2B5IC 4XPHH 1QLRA 4LARH 5LWYH 2B8OT 3RNQA 4YHNB 4TVPL 1SYSA 3ZO0A 3ALPA 3U82B 4WDIA 1Q38A 3SDCA 4BK4A 1BFSA 1TXKA 3GJFH 4LLYA 4XZUB 1CDHA 4UUJB 5HGGS 3PWLB 4QRUA 3SGEH 1A7NL 4R3SA 4GRLD 5H2BA 5GXBB 3HKFA 4YXKL 3MOAL 3PIQA 3EO0A 3TV3H 1DSFL 3IXTB 1O7VA 3KDMB 4QHUA 2ITCB 1U3HD 3HZVA 3TM6A 1XF3B 3PL6D 2F15A 1EMTH 2EE9A 4WV1B 5DJ0A 4PTUB 1MCJA 3KLHD 1KUMA 3J7HA 4O2FA 1QYGH 5BS0A 3WDJA 1L6XA 1WTLA 4DGIH 5IESL 3V6FA 1IAMA 3LS5H 3ECBB 2G9HB 3I50L 4IRSB 3MFFB 4PY7A 2L7JA 4JN2A 1DBJH 5GHWH 4CVWA 4ZAKD 2NX5D 3PWNB 5CINH 1QQDB 3UYRH 3WDIA 1FO0H 3VXSA 4IMLB 5BXFB 4FN0A 3G08A 1Y6NR 4K94C 1UGNA 3D6GA 5DD0L 3AS2A 1T4KB 2W38A 3VFSA 2CKBH 5T1LA 2LU7A 5IMMA 2Q3AA 4EOWH 5JPNA 2DWDA 3PGDA 1IGMH 5ICXB 4AM0A 3ULVC 5T3XL 1R3IH 4FP8H 2BC4A 3L7FB 2W60B 4LVOB 4P9HL 1BMGA 4LRNH 5EPMB 4AIZB 1H5BB 3RKPA 2Q8AH 2EDDA 4YHMH 1YMHA 1FG9C 6CGTA 1SJVA 4GXUM 4PBWD 5GIRA 3F7YA 2HRPH 1L7TL 2YK1L 4DTGH 1INDL 5I1LA 3TBVA 2CXGA 1NCBL 3N9GH 2R2CA 4QXTA 4L9DA 4PY8J 2AK1H 3DARA 4UT7H 3AU1A 4PR5A 5KSAC 4CVZB 2Y25A 4N9OB 5EC1B 2F19L 4NPYA 3G5XA 3LKNB 3N1GC 3LKQA 4F37F 5CJXA 3G5YA 3G9AB 4Z7UE 3OF6D 4JFPA 3HE7C 1EO8L 2PO6D 3DRTB 5HHQA 2YRPA 4MCYB 5AD0A 1MF2H 1VACB 4JPWL 2H45A 2V5SA 5JMOC 3KVQA 1MFAH 4PRID 3FOMB 4NQTA 4WO4C 4X9IA 1I1AA 3LEXA 3VH8B 5CD5C 4PJCB 12E8H 5HHMB 3NFPA 1D6VH 3FT4A 3GRWL 4KC3B 1HKLH 1NEZA 2Y1VA 3UC0H 1L0YA 3QO0A 3ARYA 5IJVB 3B2UD 2JB6A 1F4HA 5KOVC 4HULB 2XT1B 5GRJH 3FQWA 4H5SB 4YUEL 4R4FL 2XACC 1YEKL 3V4PH 4N1CA 1JNLH 5F7DB 2J8OA 4X7EC 4TSBL 1CXIA 1K4DA 4Y7MA 4Z6AT 2XZCH 1RUAH 1CICC 3DGGA 2P48B 2HLAA 1NJ9B 5JNYB 4H88H 4PIRF 3F12A 5CEXA 3ILQC 5CILH 4QTHA 5I1AB 3VA2C 3KLDA 1J05A 1CDYA 4P9HC 5IKCA 4F7TB 2ZUWA 1A4JB 4UIKH 2WV3A 2ESVD 4C4KO 1E6JH 5AG9A 5DRNA 5C8JA 4K8RH 4UT9H 5D72H 2J8HA 4H26A 5IB5A 3DV6A 3VXNA 4GQ9L 4AEEA 4X7FC 1BJ8A 3T0DA 2MJWA 2IBZX 1CLZL 5IJKC 1NBYB 1MIEH 1C08A 1ADQH 1TMCB 1MJUL 5JIHA 2LE9A 4WI7A 4LCUB 3HAEH 1HOCB 2NY1B 1AQDA 1LP9B 3T08A 2GY7B 5DFVC 3GSNL 1XAUA 3MPCA 2KL6A 2IH3B 3BFOA 1NBZA 2I07A 3BVNA 4OJFL 4XNQA 4P4KB 4ONFL 4ZFGH 2CLRA 2DOCA 4Y19D 5D5MA 1F11A 3LIZH 5I15H 2Y07H 4FQQA 4Y2DD 3FMGH 3NA9H 2A74A 2MWCA 3ARXA 1JWMA 3P4NA 5FYJH 3WFBH 4QT5A 5HJ3A 3BE1L 4NQEA 4LAJH 4F57H 2OZ4H 4PJEB 3WMSA 5I1CL 3JUZA 1G7LB 4L5FL 3CFCH 4MLSA 4BZ2H 4HS6B 1ZWIB 2W0PA 4OGXL 4PJ8A 5C6WH 2EKSB 1QFUH 1CE6A 1CWVA 1ZLVK 4N68A 1MHHA 2HFFB 3IFLL 4GXUN 3RUGB 4DEPB 3RPKA 3S36L 5MEPA 2OCFD 3X3FL 4UTBH 2OS7A 2VXSH 2F8VA 1FNLA 5DUPH 3RWJB 4N5ED 5GGSY 2W59A 4QHKI 5HYJA 5IB2A 1JHTB 1IMHC 1YEEL 2FJGA 3G6AB 1NAML 5JW3H 2C1OA 2R8SL 3WXVH 1IGFH 4P46C 3QAZB 1VSCA 3IKKA 1UA6H 4YDJA 1UWXH 4KVCH 3MLUH 3CVHA 1FNEA 4YHIA 1I7UA 3C2SA 4LOUD 2D7TL 4RGMC 4Y16B 4UOW1 1NFDE 4ZUTA 5DJDB 3VJ6A 5EUKB 5ACMA 4TUOB 3NIGE 3VFWB 4IRJB 5A1AA 4MWFA 2H2SC 3WYRA 1NGZA 3TN0A 2C4XA 1D9KD 5E1AA 2QQKH 2F54A 5IROA 2OR9L 7FABH 1NANI 3ZE1E 1H8SA 5C0IB 3ES6B 4MDJA 1CFSB 1DQTA 2A9MH 2HLFD 1EZVX 5EZLB 4HQQL 4OF0A 5J7CC 2IPKA 3DNKA 1DDHA 3O2WH 2VIRB 1KIUA 2AV1B 5HPOA 3OR7A 3WLBA 3DBXB 4OGYL 5E7BA 4M5YH 4MAYB 4U1MB 3GSQA 1CICD 4PRBB 3PWUA 1TVBB 2Y06H 4LIQH 4EUPB 3CXHJ 4ZFOA 4M3JA 4AENA 5T3XD 4YNYB 2DD8H 2V5RA 1NMCB 3T4AB 3L9RB 3ZE0E 2H2PD 2X40A 1LDSA 2WWKO 4BYHA 1WBYA 3MLRH 5I76B 3A6OA 4MQXD 4PTTB 4NNYA 1D5XB 3U36B 2VXTH 1UJTA 3S34L 3FQNB 4LVHB 2NCMA 1HIML 4EDXA 5K9QI 5DZLA 3FCTA 5GRYA 2HTKD 3GKWH 3QEGH 4JFXB 2DM3A 4JFEA 5HI5D 2E6JA 2XG4A 3V7MA 4NHCH 2DTSA 2PYEB 5IFJA 2BVPA 4EBQH 3SDAA 2XZAH 1OF2B 5DSCA 5T1KB 1CD9B 3BW9A 4TUKL 4CVXB 3CSPA 3IXAB 3RY6C 1YEHL 4OKDA 1YEGL 3X3GL 3DXAA 3VXUD 1U3ZA 1VB9A 5SX4H 2YD3A 4RA3A 4JG0H 4KKNA 3ULVE 4M8QB 5FO8A 5C0CD 1TVHB 1G9ML 5A2LH 4HXBL 1LGVA 1WBZB 2ED8A 4DKFL 43CAA 4Y4HA 1PKQA 2VLKD 4AK1A 4TVPE 3B9AA 1FE8H 3BP6B 5FK9A 4JZJB 4F37K 4MD4B 3FO0H 4PJCF 3TVMB 3BZFA 4MD5A 5T3ZE 1YEFH 4HMEA 3QDME 4JHAH 5KVFL 4JFQB 4OCSL 1TETH 1A1OA 3DWTA 1OGTB 2AK4D 2VXUL 5ETUB 4ZTOH 4Z78A 4KHTL 1CQYA 1G7QB 2GYSA 1T1YA 4X4ZA 4TULH 4JHBA 5E2TL 1AE6H 2HTLC 1H9VA 1UXWA 2FEDD 3BDYH 3MROB 1MLBA 4WUKH 3KPQA 1FFQA 4UV4L 4WI5A 3W39A 4AQOA 4X5XB 5F7EH 1Q0YL 2CK2A 4LASH 4DZ8B 1OT2A 1X7QB 5C0FA 1TTUA 3FFCD 1MAML 3KPRD 2H9GA 1ORSB 4IJ3C 4YDKL 3S6CA 5SWZD 4PJ5B 3PWJA 4BH8B 4OIAA 4YO0B 2Y5TB 1BZ9B 1YQVL 1FZOA 3NVQA 4ODUA 4LVNC 1QNZL 4FQJH 2V7NB 3PWPA 1NAKL 1MCOH 2VDRH 1QZ1A 1UVQA 5CIPB 3BPNC 1E6OL 1CLOL 3VFNA 1LP9F 4PB9L 5DUML 1UCBL 4MDIB 4CGTA 4K7FA 4P0DA 1U8QA 5FO9B 5F96H 3L5HA 2QKIB 3VWJC 1BVKA 4N8VG 5GISH 1FBIL 4XAWL 4YHPA 1G9MC 3RWEB 5DMIL 5KSVA 3G04B 4L8DB 3A67H 5GGTA 4KUCF 5T1DL 1OSZB 1S78C 4JRXA 4JPKH 5E7FA 1MFDL 3CH1B 2PR4L 4WFEE 4LNVA 4XRCB 4P49A 4XPAH 3D18A 4JHWH 2XKUA 3V5HB 2BSTA 1D6EB 4R4NC 3MLTB 2VLRA 3MBXH 5A2JH 4LCWA 1HHKA 3WE6B 3RWDA 3P0YH 1SVCP 3IFPA 5CZXD 3QDHA 2R2HA 3LRSB 3FFDA 2B0SL 3SKNB 4HXAH 2YD2A 4WGWB 4OAWA 1CGWA 2UV3A 5IGXL 4GBXB 4EZMA 5FM4A 1P4LA 3WLWC 1SJHA 5I74C 4KJWC 4L3ED 5I8EA 3KPMA 1AHWB 5DA4A 2Z31D 3VGBA 5F1OB 4P2QB 3ARGA 1DLHB 1A3RH 3FB5B 5F7MC 1VESA 4NKOB 5I66A 4EUPH 4YHKH 5CSBA 5B8CA 4MJIA 3QDJB 3IS0X 4R7DA 3WFCL 4XBPB 2VE6A 4UQ3A 5ESVA 3GSXA 3U79A 5IEKB 1WIPA 4X7CC 3VGAC 4C56E 4OCWL 1C5CL 1CI5A 2YPLB 4BQ8A 4XPHL 2A6JA 4LARL 5LWYL 1IGTB 1DVFC 1R3HA 3B6SB 4KQ4H 2JK5B 4J6RH 4KK9C 4FXLA 1YZZA 3IVKB 4X9FA 5K9OB 1A14H 5E6IA 4M1GH 4LFHG 2HT2D 3O0RH 4F33B 2GK0A 3FO1A 2BXZA 3AAZB 5F9OH 4PJHE 3GM8A 4ODWA 5HHOD 5I9QC 4RGOH 4U1HA 3N1PC 2C26A 1X5FA 1X6NA 3TV3L 2YBRA 5EUOE 3M17A 5C09A 1VFAB 2BVYA 1KJ2A 1WIOA 5MHSE 4ETQA 5KW9H 5DS8B 4UU9B 1IEBA 1XEDA 2ICCA 4QF1A 2IAMB 3IU3B 1S5HB 4XC3H 4NO2A 3DI3B 1W8NA 1QYGL 1HYSC 2APFA 3U4EA 4BH7A 4DGIL 4E41B 4PJDB 1SEQH 3REWA 5CJQH 3LS5L 2EDKA 5I6XB 5FUZH 2BX5A 4QXWA 1XCTA 4ENEC 1JMZA 5GS0D 5J6GA 3HG1D 3BD4A 3UX9B 2FIKA 1UT9A 1N4XH 1AO7E 1DBJL 3IYLW 5GHWL 3QT2A 4HMDA 1UWXK 5F70A 1A7QH 5DJYA 4PJAB 5CINL 1AGEB 4UAOB 3UYRL 1FO0L 4UILH 1TIUA 2Z8SA 3LDBC 4W6WB 2CUHA 4FFVC 3ETBF 1EHAA 1HEZB 2CRIA 5EU6A 3LY6A 4PJ7A 4MAUH 2V2WB 1K4CB 5FO7A 5CWSA 3I75B 2CKBL 2NPLX 3BP7A 4JCLA 1FG2A 1U8LA 5I71B 1IGML 5D1ZA 3QUMB 5JIKA 5A40E 5IVXB 3TZVB 5A16B 3V6ZA 2B4CC 1VFUA 5ITFA 3DMMB 4FP8L 5IB3A 3MMEB 3VWJD 3GGWA 2W07A 4G9FE 4HPOH 4LRNL 4O4YH 4PGEB 3SDXB 4BELD 5I1DA 2Q8AL 1IL1B 2CLVB 4YHML 5BZWB 2HRPL 3SKJH 4DTGL 4U6VH 3B9KD 3N9GL 5F7KC 2R4SH 1IAKB 1MLCB 2AK1L 4UT7L 2WLYA 5DEFA 2KZWA 1QLRB 4B50A 3RNQB 1SYSB 2EC9T 4OFYD 5EBWA 5A2IH 4WDIB 5C6PB 2E8YA 4QO1A 3SDCB 2P5WD 4LLYB 3D3VE 5SV4A 1OCWH 3SE3C 3N1MC 5CJOH 3HMXA 1O5DT 5KZCD 4QRRA 2CD0A 2N4IA 3JV6A 1MF2L 4QRUB 5H2BB 4R3SB 1MFAL 5D1QD 3QYCA 1JNJA 3GM0A 3PIQB 2GTWA 3V6BR 3WLWD 4JQIH 2DKMA 4OFVA 1MCIA 3BRGC 1K85A 3HZVB 3LOWA 3ZDYE 12E8L 1CFBA 1GZQA 1D6VL 4XVUC 3ZKXB 3P77A 5IWLC 4XAKE 1C16A 4JQVC 1QSFE 3UC0L 4JKPH 1CT8A 4O2FB 5JUEH 1PSKH 5GRJL 5BS0B 1T3FA 2GQHA 3V6FB 4YHOH 4JPIA 3V4PL 3U7WH 5HYIA 2DJ4A 1JNLL 4BJLA 4PY7B 4OKVA 4JN2B 4KRPB 2XZCL 1RUAL 3VXRA 2XWTA 3HR5A 4H88L 5MI0B 3VXSB 5CILL 1DVFD 2GI7A 3G08B 2YXFA 4KK9D 2VZ1A 1H3TA 2AJZA 3VFSB 5T1LB 4OTXH 4UIKL 5IMMB 4DAGH 1E6JL 5ACZA 5JPNB 4K8RL 2DWDB 3MRMB 1MFCH 3PGDB 4UT9L 3S7GA 4AM0B 2YC1A 1FSKB 5D72L 2FHBA 1H3PH 3BISA 2A0LC 3AM8A 5D2LB 1RVFH 2BC4B 4DN4H 3BI9X 4AG4H 3NN8A 4Q7DA 1MIEL 1ADQL 1T0NA 1P1ZA 4XHJC 4OBSA 1YMHB 1BBJA 1E27A 3VD7A 1U41A 2AJYH 5GIRB 3D39E 3F7YB 4GMTH 3PP3H 3VWKC 3SGKA 5I1LB 3TBVB 4NRXA 3DURA 4LQ1A 5GS2D 3HE6D 1PZ5A 4QXTB 1FH5H 2K9UA 3QRGH 3OX8A 3BPLB 3EW3B 3EO1A 2DIBA 4BQBA 4PR5B 4ENED 4YHYB 4ZFGL 4NPYB 4JB9H 3C5ZD 3HAEG 3G5XB 4P3DA 3LKQB 3LIZL 3LD8C 3G5YB 5I15L 2Y07L 3NA9L 3FMGL 5D93C 4JFPB 3T0AA 1IEHA 5HHQB 5AD0B 5FYJL 3WFBL 3OKKA 3KPPA 1CDCA 1IKNC 4FFVD 2YUWA 4F57L 2OZ4L 1UWEH 2IEPA 5FYJU 2MNUA 3CFCL 4BZ2L 4JREC 3NZHH 1AH1A 3EJJX 1W0VA 2FH8A 1QFUL 3NFPB 3FT4B 4OCXH 5ICYA 5J6HB 3B8SA 1R5IA 5E08L 1NEZB 3QNXA 2DL9A 1PQZA 4M02A 3QO0B 4ETYA 3D0LA 4Z0BH 2HT3D 4GXVH 3MBED 5DDHB 3TO2B 4UTBL 1HNFA 3D85A 3FQWB 3L3JA 2VXSL 3MV9E 4EIZC 2R4RH 5DUPL 1ETZA 5D7IA 1I3RB 5JW3L 4ODHH 1K4DB 3WXVL 4Y5YC 2WMPA 1IGFL 4JFYA 1NKOA 4K8RC 5C9JA 4HIJA 1UA6L 4F80A 3F12B 4HSQA 4EN3C 5CEXB 3E6FA 4KVCL 4QTHB 3MLUL 4N0FA 4Z7QF 1S7TA 3LMJH 4MMXC 1J05B 1IC7H 3C8KB 5IKCB 1MJ8H 2YKLL 3LEYH 5DRNB 5C8JB 3ZTJH 1Q8MA 4N0UE 4OCNC 4W4OC 1KCKA 5C92A 5IB5B 2LVCA 3DV6B 3VXNB 3MO1A 3VFOA 4KKCC 2QQKL 1EHXA 4QWWD 3IGAA 3QDGD 2CXKA 7FABL 1QVOA 5D8JH 4AT6A 3E8UH 5HGDA 4JFDD 5EOQH 1EFXA 2A9ML 1INQA 1FIGH 3CFJA 4RFNB 3O2WL 3BRFA 3ZKQD 1A2YA 2Q1EA 4WI4A 1JGEA 1NBZB 5FGBA 1P9MA 2D31A 3ESVF 2I07B 3BVNB 4XNQB 4PJDF 1GGYA 4XXCA 5DJXA 5D70H 3C2AH 4GLRH 5E9DA 2CLRB 1UZ6F 3CFDA 4P3WA 5D5MB 2CLZA 4M5YL 2ITDA 2NW3A 3MNZA 2A74B 3ZE2F 4KVNH 1Z2KA 2Y06L 1JWMB 3P4NB 4LIQL 4PJAF 4NO5A 2DD8L 4NQEB 1DTUA 4WV1C 1MCCA 3MLRL 5I19H 1NGXA 4PJ8B 4Z7NE 5KTEH 5F6IB 5J12B 4KI1A 2X4QA 1FC1A 3CSBA 1TNNA 2VXTL 1FYTD 3MV8D 1CE6B 5LGJA 4U2ZA 4IRSC 3UZQA 5MEPB 2FGZA 1NLDH 1JGDA 3SDXF 3GKWL 3QEGL 4POZC 2FATH 2VNCA 3HMWH 4OLXH 5H94B 1RK1B 1GHFH 5IB2B 4K3DH 4NHCL 3IS1X 2FJGB 3BWUC 2NW2A 4EBQL 3ARVA 2VXVH 2XZAL 4WHDA 3VRIA 3VH8G 1KT2B 3P9WB 4YDJB 1P6AB 3MGTA 3V8CA 4YHIB 5D7LD 4PJBA 1KENH 4Z7VE 4LVOC 4JG0L 3VJ6B 3KGRA 1H5BC 2ILLA 3ARBD 4EIGB 5DEGA 5M95B 4MWFB 2UY7A 1HQ4A 1NGZB 3TN0B 1IM9D 3HRZA 4JGMA 4N1EA 2YSSA 4GQPH 4PGDA 2F54B 4R26H 5K59E 1FE8L 1R3JA 4NNXA 2XTJB 4X4YA 1PEZA 3FO0L 3UTOA 4MDJB 2P43B 2RGSA 4NOBA 4OUOA 1YEFL 2IPKB 3BDXA 4JHAL 2X05A 1DDHB 2D9QB 4JFHE 1TETL 1QBBA 4ELME 4OF5A 4ZTOL 3OR7B 3WLBB 1S5IH 3HN3A 4P2OD 4EXPX 1RURH 2BNQA 3GSQB 4TULL 3U1SH 1MCPH 4UOJA 1AE6L 3WJLC 3PWUB 1YMMD 2DF3A 3BDYL 4ZFOB 4WUKL 4AENB 4EN3D 35C8H 3HHRB 5F7EL 5LXGH 3W5NA 2OP4H 4LASL 3SN6N 4GAYA 5E5MA 1I9EA 4NNYB 4JRYE 2QQLL 5C0BD 1PEWA 4L4VA 4NQVB 3QUKA 1RZ8A 4UI2A 3UDWC 3W0WD 5D6DC 3I6GB 3T3MF 4HIHA 4EDXB 4KKCD 1CXKA 2DQTH 4FQJL 2VDOH 5KSBB 4YBQC 1XGRA 2E9JA 5HI3C 1MCOL 2VDRL 3QFDA 4JFEB 4FFWC 1K3IA 1G7JA 2R1WA 5JTWA 2DLFH 4JLRB 4XMLH 4HS3A 4WW1A 2BVPB 2HKHH 1N5YH 3SDAB 1NGQH 4U1SA 3TNMA 3MTRA 5DSCB 1CQKA 2IH1A 4OF6A 1SMOA 5SX5H 3BW9B 5F96L 5DHVA 1G0DA 2PYFA 5GISL 4P5TC 1RHFA 3A67L 4UIMB 4JPKL 5FO8B 4K23H 4XPAL 4JHWL 1J11A 3OTTA 1EK3A 4HUWA 4QRPA 5IMLA 4WUUD 3QXAB 3MBXL 2NY1C 43CAB 1XCQB 1B0RA 4Y4HB 1PKQB 3P0YL 5IHBA 4P23D 3UJJH 4PV9A 1ONQA 5FK9B 3ARED 2BNUB 2IANE 2EE6A 4JAMA 4HXAL 1MRCL 4D9LH 3BZFB 3T77B 5L8KB 4MD5B 4GKSA 3S5LA 1N26A<