3SO5A

Crystal structure of an immunoglobulin i-set domain of lrig3 protein (lrig3) from mus musculus at 1.70 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
98
Chain Sequence
FPPQITVQPETQSAIGSDVSFTCSAASSSDSPMTFAWDNEALQDAEMENYAHLRAQGGELMEYTTILRLRNVEFTSEGYQCVISNHFGSSYSVALTIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Leucine-rich repeats and immunoglobulin-like domains protein
publication title Crystal structure of an Immunoglobulin I-set domain of Lrig3 protein (Lrig3) from MUS MUSCULUS at 1.70 A resolution
rcsb
source organism Mus musculus
total genus 20
structure length 98
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3so5A00
1DQDL 1HH6B 3IDYC 5EOQH 5C08B 1FPTH 1IC5L 2AXFA 4NPYA 5TE7L 1JUFA 3GMMA 4NO2B 3IF1A 3C5ZA 2Z8VC 1AKJB 1FAIL 3BEVA 3RFZC 3KYAA 3GEWB 4Q6IA 3QULB 4ZFOB 2XWTA 3TO4D 5T3ZD 3VFTB 4QNPF 3V6FA 5LCVL 1D6EA 1X5AA 4LSQL 4TQEL 4DGIL 3HE6D 4Y5XC 2V5MA 4KI5D 2BP3A 4PJFB 4HPYH 3RRQA 1Z9MA 5DJZA 1QA9A 2MMXA 2X4TA 1KXVC 4PUBH 3I3DA 1NAMH 1KTDB 1D5BB 2WBJD 3LD8C 4ZTPL 5BV7L 1UM6H 1WBYA 5FOJA 4EUPB 3CSBA 1DN2A 5TF0A 1R3IH 1F6AA 4X9GA 2OZ4L 1QKZL 2Z9TA 4FQCL 3QUMB 5A1AA 5GRUL 5D70H 1G7HA 3DSFL 3DXAA 4L4TE 4OF6A 3RWDB 1HQRA 4RWYH 1MLCB 3VCLB 3IKKA 1CL7H 1H5BC 1JRHL 4Q7DA 5EC2B 5IEHB 1HXYB 4UV4H 3QXUA 5ICYB 1T2XA 2Y1VA 4Q58C 4JDTL 5JQ6H 5D71H 1BBDH 3ILQC 4XPHL 5DD6A 5E9DE 3RY6C 4XMPL 3MLVL 1MVUA 3PQYD 4YR6B 3B5HA 1R3JB 3D39B 3EDJA 1HZHL 5FHAL 1P5VA 2VLLA 5T3XL 2ZPKH 4MAYC 1RZGB 2YSSB 3PGDB 1H3UA 3RWCA 3VFRB 2QQNH 2L4OA 5F6HI 5C6WH 4ENED 5KSAD 3GMOA 1EFQA 1MWAA 1Q9OA 5E2TH 4KDVA 5GS3A 2OXHA 1R0AL 2ESVA 1NGWA 3QUZC 2A1WH 3FRPG 4JG1H 3EO1B 4JN1L 5BJTA 5L8JB 1BBJB 2X41A 2ADJA 2AEQL 5E24E 1Z2KA 5K9QG 3HMXA 1IAKA 1P4IH 4Z7WE 1QRKA 2ATKB 4LLMA 1BIIB 4ZYKA 2NW3B 5TQ2H 4EI6A 1D9KD 5LGKA 3V0WH 3MODL 5I30L 3HZKA 1B4JL 3QJFA 1T66D 4XHJC 1SM3L 4NFBA 1FYTE 1WIPA 3ZTJH 5JXEC 2RBLA 5T5FL 4IRSB 5GXBB 4M00A 9CGTA 3S35X 3H3BC 5JPMB 3C2AH 4RISH 2ZUQB 5IKCA 4HIJA 3D3VE 4U7SA 4CNIA 2V17H 1P4LB 4NQUA 4G3YL 1RJYA 3NFPA 5GS1A 1NDGB 5HYEA 2GAZB 2CLZA 2VQTA 3B9DA 5ESVB 4FTVD 3DUSA 4Q9RH 1EO7A 3VA6A 4PJGB 4XPTL 5ERWB 2P8PB 4WW1B 4N9GB 4LHJB 3V7AE 3V8CA 4DKAA 3UJIL 2CLRB 5J4MA 3WFHA 1UQSB 3DETC 4WO4A 3RI5F 5H94B 5L9DL 4QHKJ 4HJGB 3MGOA 2XKNA 5LGHL 1Q1JL 3P40A 4NWTH 3RKDC 1Q72H 5FB8B 3IXAA 2PR4L 2YXFA 4Y2DC 5ALCH 3NCJH 3IVKB 5IBLC 3L9RB 3O9WC 4QHLA 3GIZL 5MEND 1JGEB 2NY4C 3QT2A 1ONQA 4LCIL 1NBYA 4OSUH 1DBBH 4QOKA 4IMKA 3I75B 2Z31D 3HZMA 5BRZB 4JFEE 4KJQD 1B0RA 2F53B 2D0GA 4G6ML 2EYRA 5I18L 1FJ1A 1RULH 4HKJB 1LO0H 4FFZH 2BVOA 1MWAH 4MA1C 1TJGH 2OXGA 1YJDC 1ZWIA 4MCYB 3NA9L 2AJSH 3IDJA 2DI9A 1NLDH 1MI5D 1YEGL 4Y16B 2E7LA 5C0CD 4ODSH 1XF2B 4JGUA 4H88H 2D0FA 5IHBA 1UFUA 4YEFA 3SO3C 5C07B 3TIDB 3O6LH 1ZHBB 3U36B 2A74A 2ZG3A 4PJXF 2PYED 4POZC 1FNGA 1RUKH 2BK8A 2ADGA 3I6KB 4KRLB 2JF1A 3S37X 2XG5A 2CGRL 4DZ8B 5B22A 4ODVL 3WJLA 3SDAC 3ARGA 4HIXL 2HMID 1QLRA 2EIZA 1YC8A 2FL5A 4LL9A 3S36H 4OLZL 5HJ3B 3QR2A 1H3PL 1NGYA 3FKUS 3W9EB 2GJ6D 1S7SB 2APTA 3ZKQD 1A7RL 1WAAE 3I85A 2IALB 5EU3A 5CD3B 5FDWA 3LHPH 1BD2A 3IAPA 4PRHE 4ZFGL 4TVPL 5MEQB 2AI0L 3LRSB 2VQ1A 1X5ZA 3QG6A 1I7RA 3KXFA 2W0PA 2ZUWA 4M3KB 3PWPE 4A2MA 4FFYH 3G6JE 3M1BA 1QBAA 4JKMA 3UPRB 4LAQL 4OLWL 1NCWL 3PHQB 3RU8L 3STZA 2C1PB 4QXTB 4LK4A 2P5WE 5DJCA 5I1LA 1GH7A 1PYWA 1I75A 1MCQA 5D7JD 5F7DB 5CCKL 1LO5B 2XKUA 3QI9B 1MCKA 4RRPG 2BJMH 4ORZC 3SPVB 3VI4E 4CUCA 1UJ3C 3PWVA 4JFFD 3KS0J 3SBWC 2EECA 5GRZA 3O45A 1A14H 5HY9B 2PXYC 3U7YL 1T7XA 1FDLH 2G2RB 4M43H 3B2VH 2O61A 3OXSA 4R90H 1WVZA 3O6KH 3VWKD 2VDML 1CD0A 4G8EA 4J1UB 3J8F7 1KCLA 1JPFA 5A43C 3FRUB 2VXUH 2E5EA 1VKXB 4GG8B 5IVXA 3ZL4H 5K9OB 4M61B 3T4YA 3EYSH 1S3KL 1OAKH 3B9KB 3UPCA 5C7XH 4OLUH 1JHTA 2G9HB 4P48A 1TZHA 2GITA 4KXZI 4DK3A 5E1AB 2UWEA 3GSWA 5B38G 4G8FB 4HKXA 2AGJH 1I85C 2X7LB 2DJUA 3THMH 4R8WL 5FHBH 2AXFB 4GMSH 4P9HL 3QDAA 4PRIA 2YC1B 3SDYL 2R1YA 4HPOH 1T83C 4I8DA 2VKXA 3E2HB 1KN2H 1RQ5A 3IF1B 1YY9C 2YS4A 4GG6F 2IPKA 4HIEA 3BEVB 2AW2A 4X8JB 2XA3A 2A83B 1C7TA 1BFSA 1GPOH 1S9XB 4Q6YA 3HG1A 5ILTH 4NKDB 5K59F 1YPZE 3SKJH 5EUOB 1IC1A 5GGVL 4M7LH 3HB3D 4KHTH 3QDHA 4XWOC 1RUQH 1HYRC 4EKXA 5DJZB 1QA9B 3IRZA 5FEBA 4A6YL 1CLYH 2B5IC 1PQZB 1A3RH 3R8QA 2D03H 3V52H 1FORH 4L3ED 4DW2L 3CFCL 3C08L 4XNMA 2APVA 3FQTA 1BZQK 4OLYH 2F15A 5D7IE 3WFCH 3RY6A 1HE7A 1NANI 5KN5A 1JPST 2ERJC 5KVMC 4N0UE 2X10A 4WTWA 2W9EL 1JP5A 2NY0D 4MAYA 1FFPB 3DXAB 4JPWL 4JZJC 5KVFH 4O4YL 2IPTL 3GSVA 4AEHH 3P11H 2UUDK 4WFHD 1UC6A 2Z91B 3C8HA 4U1MB 4WHYH 3UAJC 3QUZA 1IC4H 4ELME 2YD5A 3STBA 1SYSA 2Y9RT 3FJTA 4JM2B 2CLVB 3T04D 3OQ3B 1MVUB 1K4CA 2NY7H 2A9ML 3SDCC 3CC5B 3MBEC 3BP6B 3OBAA 2VL5A 3CFKB 2DKMA 3FFCD 3PL6D 3TT3L 2UUDH 1T1YB 3QFJD 2NXZC 3RWFA 1QFUH 1KCSL 1NAKL 3BAEH 4ODBD 4X6CA 3LKSB 1PKOA 5JXEA 3ARFB 1I7UB 5GGSY 1FIEA 4L9LC 5BJTB 4OM1L 3KYMA 4GKOA 1A7QH 2JB5L 1T2QH 4D9QD 2F54A 1QNZL 4U1GB 5T1DL 3W9DA 4LLMB 1X6LA 4PLKD 4S1QL 1F8TH 1AO7B 4NJ9H 4EBQH 4NC0B 5KTEL 4EI6B 2IPUG 4KKNA 5E2UL 4GH7B 3HZKB 3TC9A 3EHBD 2CK2A 3QJFB 1E28A 4N90D 4G6AD 3DUUA 2H9GB 2ZUXA 4CMHC 3OGCB 3RUGF 4Q2ZA 1U92B 5IHUL 4DVRH 3TYGL 5CEYB 3V6ZA 1BLNA 3UJTH 3EYUH 3VGFA 5IKCB 25C8L 4KAQH 1U3YA 4CNIB 4KJYB 3FO1A 3P0YH 4OFKA 3NFPB 4UIMA 5GS1B 2RGSA 2X70A 3N1PC 4E42B 1CFNA 3BDXA 5FM5M 3DUSB 3VFUA 3FT4A 5ICXB 2FZ3A 1CFQB 5EO9A 3O9WA 1A3LL 1WZKA 1MRDL 3FB7B 3OMZA 4EOWL 3BKCL 1HIML 3UTSD 2XA8L 4J12A 1AY1L 3MRRA 4WO4B 4NCC1 5C3LD 1TVBA 1ACYL 3C9NA 3L3JA 2AJZA 4O00A 1YEKH 4WI9A 3TJEH 1VFUA 1YDPA 1A1OA 3T3PF 2MWCA 2XTJE 2BFVH 3IXAB 1VEOA 4L1DA 1B6DA 3RDTA 2X05A 3VXMB 3F58L 1T21A 4RWHA 5FUCC 4S0SD 4JPKH 4ZQKA 2GI7A 4OCYH 5DMIL 4U0RB 2VXSL 4C59B 3LPWA 4HXBH 1WZ1H 4D8PA 1DEDA 1YQ2A 4YDIH 3IDJB 5B39G 1NCAH 4XMLL 2PUQT 2VIRB 1CQYA 3CFJA 3PNWA 3KJ6L 5HDBF 1DBAL 4EQ3A 5IT2L 5DJAB 2A74B 3LDBC 1MLBA 3QEQD 1HHJA 1FNGB 5GSVA 2NY5H 3PGFH 2BY0A 4DEPC 3V5DA 4U1SA 1MH5B 1JCKA 2GIYA 4J4PD 4PJEF 2EIZB 2FL5B 1NGYB 2OTUA 1WFTA 4MB5A 5DJ2B 4KUCF 1LDPH 4RFOH 2IANB 2IBBA 5F1IB 3MRDA 4R3SB 4AH2B 3QG6B 5I16A 4HUVA 1QPXA 2X4NA 3M1BB 1T89C 1H15A 2PXYA 5L2KB 3TA3B 3D2UD 4OQ1A 4ZMAT 3O4LB 5L2JA 2EXWD 2JJTC 1DVFD 1GHFH 2E9BA 3STZB 1MUJA 5IWLC 5CBAB 4DJMA 5I1LB 1YJDH 1LO3L 1WBZB 5E9DD 3TBWB 1KCRH 3MRLA 3IXTB 3CD4A 3MRQA 5HYQA 1OP3K 5EBWB 1ZT7A 1MCWW 3P0VL 3QIUA 1NGZB 1IE5A 1WGOA 3RHWF 3PWVB 1HSAA 1RFDL 1NMBH 4JFDB 3JTSA 3RI5K 2FJGA 2WW8A 3VWJA 5CZVH 2VR9A 4YK4C 3OXSB 5I8EA 2A73A 3UBXA 1FFQA 3K3QA 4JZOA 2YXMA 4ZUTA 4F37F 1F02I 1AGCA 4H0GA 1HOCA 1JPFB 1OP3H 3LS5L 3H9HB 4GSDL 1I85A 5IVXB 3IDYB 4PJ9B 3BPOB 5AWNH 1T83A 1U8KA 3PDOA 5BVPL 5CSZB 1CK0H 3T4AB 4UQ3B 1FYTD 4Q9BA 1X5LA 1KTLA 4FQQA 4C56B 3V9FA 3B4NA 3GSOA 2WUBH 3QDGE 2UWEB 1E6OL 4WI5A 1S9WA 1J9CT 2ICEA 1I7ZA 1R5IA 4DWHA 4O58H 4X6BA 5GJSH 2I25N 2KBGA 4Y5XB 2DI7A 5JOEA 4YGVA 4PRIB 4JEGB 3ARXA 1FGNH 3U0WH 2MQCA 3NPZB 4G43B 4S2SA 4WI6A 2DQEL 4Z78A 2Y25A 1EHXA 3LD8B 2AJXH 4NQEE 1E4WL 4FFWC 4XH2A 3RA7L 5IFHH 3OR7B 3T2OA 4JDZB 2HWZL 1I8LA 3BRDA 2FEEI 4LU5L 1QP1A 2Q6WA 3ZSTA 1GAFH 5A16A 4MCZB 5C0DA 5K9JL 2AKRA 4JZJA 2ZUYA 4PGEB 2FGZA 4K9EH 5E5RB 2ESVE 4JFED 1BQLH 2R23A 4NQVA 5B4MC 1JHLH 1H5BB 4QCIA 5JUEL 2ZJSH 1K4DA 2R0LH 4XVTH 5FA4A 2XZCH 5D7SL 4L9DA 5DJXB 5IW1B 4PJHB 1KIPA 4LKXA 4L29B 2PTVA 2W0FB 4NO3A 2YKLH 2P5ED 3VFNA 1L9MA 5F3BB 1R24B 4Z77A 4BK5A 4LHQB 3LVEA 2X1XR 2IG2L 4LSDA 4AIOA 3PP4H 4M02A 3WFDH 2C3VA 4V2CB 4I3RH 3BISA 3CX2A 4F57L 4MVBD 2B4CH 1MAMH 1EEUA 1J7VR 1LO4H 3WD5H 2J5LC 4I13B 4N0YH 1MCSA 1S7RB 4U1LA 5KVDH 1E27B 1F13A 2DQGH 3QJHB 1AR2A 3HC4L 1KYOK 2V9RA 5IOPB 1OAZH 5IHZA 5BQ7B 1CLCA 1TQCC 4F8TA 3INUH 3TO2A 5KVGH 3TNMA 3WN5A 2OK0L 1BX2B 1ZLWK 4PRHD 5MHSE 4XNXH 4L4JA 3UYRH 4K7FB 1E6JH 4ZUUB 3OKLA 1VDGA 1E4KA 3PWPD 2HFGH 1MIML 2DMBA 4K2UH 5KW9L 4Z7OE 5GGTL 1C12B 3W9DB 5CS7A 4BZYA 1LHZA 3DX9A 1A7PH 4MMXC 1JI2A 2XQYG 2R1WA 3BP7B 5IQ7L 5C0GA 2P5WD 1LEIA 2O5ZH 3P9LA 3SN6N 4KU1A 3QUKB 3S8WA 4QOKE 1E28B 3MREA 5C08D 3D87B 3N9GL 1ZLWH 3DV6A 3DUUB 4LSRL 1J05A 1T7WA 3U9PH 3LZFH 1T04A 2WP3O 2QTEA 4MA3B 3K8LA 3H3PH 3FCTA 4GAYA 4NM4L 1OB1A 1AKJD 4JREC 4K3EL 1XGQB 1IJ9A 3ZT5A 1OSPH 1J8HA 3V6ZB 2QSVA 4OZFG 3FO1B 2FX9H 1BWWA 4KROD 4UIMB 1GZPA 3S3SA 3P4OA 5DMKB 1CDYA 4QHUA 3SCMD 1KPUA 4Y2DB 3V5HA 1UB6B 3KPSB 3O9WB 1T3FB 3QPXH 2NY4B 5CINH 2BMKA 3AUVA 1CGXA 2WWMC 4OFVA 3MRRB 1AFVH 2R1XA 1LE9A 5GGQH 4U6YB 1JF6A 3C9NB 5CP7A 3P9WB 1NGQL 3MLXL 4HQQL 1NEZA 4QRRE 4MA1B 4MA7L 2CH8A 1AC0A 2K7QA 3DVNA 4CL7A 3MRIB 5AZEH 5HVGB 2JCCA 5SWZB 4AT6A 4LSSH 2J6EL 1YEIL 5EU5A 2VMFA 1BD2E 1T21B 1MFCH 1DBKH 1S7XA 3RUGA 2W65A 4L4TB 4LIQE 3KXFE 1FYHB 1P84K 4YO0A 4ZSOA 4OCXH 4RA3A 4XVSH 4AMKL 5CJXA 3MNVA 4MQ7A 1M1SA 3B5TA 3SDAB 3L3IB 6FABH 1VFOA 2XV6B 4L3CB 2NY3C 4HWEL 1F11A 4JHBA 5F9WC 2P48B 1W0YT 3MA7A 1EJ6A 3EJZD 3LEXA 4HS3A 5J7CC 3QDME 1UCBL 1YEFH 1P7QA 3D39D 3O2VH 2VLKB 1CXKA 5IBUG 4GKZA 4O02L 1DUZA 1ZE3C 4KK6D 2EKJA 5ID0B 2F5AL 3LS4L 5T5NG 2VUYA 4CMMA 5DUML 2A77H 1MLBB 3EFDL 1HHJB 2AXGB 4HUWA 3QO1A 1JV5A 1MHHB 3P0GB 3V5DB 3VD3A 1EERB 4TPRL 1MCPH 1QTYT 3KYOA 3BDYH 3MYJA 1S5HB 1T89A 4FABH 3QEGH 2OQJB 3K81A 3NCFB 1UXSA 3QCUL 1V7NL 2JJTA 3Q5TA 1KJVA 3LKRB 4JFOB 5IWLA 4C54A 4JLRA 4PRDA 2UZXB 1YEHH 3ZZ1A 1QFHA 1VGEL 5D9SA 2FNBA 3W82A 5HGGS 4D0BA 1D5IL 3C09C 4ZTOL 2ICWI 2MHAA 5I16B 4UV7L 2P44B 2FLRT 2QLVB 3BN9D 1UJ3B 1YUHB 3QUXC 4GRLC 4BH8A 4IRSD 1GGUA 4RMWA 2I60L 3MV7B 1R3KA 2PXYB 4K7PL 4X6EB 3O8XD 3C6LC 1O7SA 4GKNB 4XVUC 3PABA 3KPNB 1Z3GH 3D3VB 2F8VA 5CMAA 1JWUA 3CFDA 1H3VA 3O6FC 2ZCKL 5DD1L 1AGEA 3UC0L 5IB1A 3QNYA 2LV4A 4PJXB 4GQ9H 3MRQB 2SEBA 3MV8B 4JG0L 2DQUL 4X5XB 1RZ7H 4MD0A 5AYUH 3ZDYE 2AJUL 2R2CA 3CMOL 2W59A 1DBJH 1PGRB 2ADIA 4XT1C 2WWKO 4URTB 2OL3L 3LN4B 3BKJL 4MXQD 3U1SH 1NBZA 3HG1E 3IDIA 3WE6A 1X9QA 2XQBH 5I8EB 1KT2A 3MRFA 3UBXB 4U6VL 4BH7A 1A7BA 2QKIA 4XXCA 4ZUTB 4JZNA 2Y5EA 5E8PA 43CAA 2IBZY 4Q9QH 4QYOB 4PY7A 3V4PL 3GNML 4O9HL 2M2DA 3TGXA 4JQIL 5C6PB 5JZ7D 3ARDB 2V5YA 4YHKL 1KN4H 1CCZA 3PDOB 2AQ2A 3NIGF 3V8OA 2X89A 4GS7C 4M62L 2F53D 2YD4A 4M8QB 5EWIL 4EJ1C 4OV5B 1KTLB 3MRBB 4NQDB 1KFAL 1X7QB 3GSOB 2K9UA 1QEWA 1YEEL 3EOAB 5JMRA 4Y16D 1S9WB 3MRGA 2N7AA 2H26A 5DRWA 4PP2A 5ADPL 1CGUA 4YGVB 2XN9B 3JWNC 5CSBA 4ZODA 3CDFA 4PBXA 3NABL 5E95B 5E1HB 2ZOKB 4S2SB 2B5IB 5HPOA 4MNQB 1OTUD 1W2KT 1NC2D 1Q9WA 2ORBH 3FTGB 2PW2A 3TN0C 2B2XL 2E27L 1EVTC 5E8EA 1OTSD 1BZ9A 3MLZL 5E6ZA 3WFEH 3CVIL 4Y19A 3IT8D 2ERJB 1UEMA 1G1CA 4OGAD 1JPSL 1OVZA 3GSNB 4I0PD 5A16B 5EO1A 3MGTA 1YQVL 1XF5B 3Q3GA 4JZJB 3RGVC 5C0DB 2Q86A 1J1XH 4X6CE 3H42H 1IAMA 1TQBC 1YMHA 4QCIB 3WUWB 3UZVB 3VI3F 4R26H 1UENA 3HUJF 1Q0XH 2F54E 1IM3B 4J3OC 4UT9H 4IRJD 1OD7A 4WU7A 4Y4FA 1AI1H 3ZE2E 5TDPA 5CIPA 1U3ZA 1FVDA 5IMMA 3PIQA 2XOTA 4W81A 1QRNB 4NO3B 3SDCB 3MBEB 4CU6A 3WO4C 4LSUH 5FGSA 5AG9A 4H1LG 4GG6B 1RIUL 5E4IA 4ODTH 2K7PA 4JRXE 4PGBB 5B3NA 2X4PA 3OAYK 4W6XB 4WWID 3ZE1F 2NXZB 2RIKA 3GM0A 4A2LA 1CGSH 5D6DC 1AP2A 4GT7A 1SMAA 4L9LB 3RWEA 3TLRA 3QNZA 2F19H 1FVEA 2D7TL 4EQ2A 5HHOA 3RVUC 5K33A 5KSVB 1A6AA 4HXAL 2D7MA 4F37K 3QXAA 4MSWB 5DK2A 1YN7A 3W0WD 5BV7C 5FYLH 3TO2B 3OAYH 1OTTC 2CUHA 3TPKA 1DL7L 3CCHB 4ZO8A 3B9EA 3NZ8A 5HDLA 3RAJL 4CMHB 4PJ7F 5FCUH 1ORQA 3OKLB 3H6JA 4B7IA 1I9JL 1CXLA 4JHWH 4IMLB 1U8MB 4DAGL 5IG7A 5EZLA 4G7VH 5DI8B 1H8NA 1IQDA 2E9WA 1T4KA 2CK0L 1Z9LA 4QWWD 4LDEB 3RTQC 2CXKA 5C0GB 4XI5C 3WXWH 1JBJA 2EXYD 5FUOH 1ZTXH 1IC7L 2VDKH 1KB9J 4XP6H 2E6JA 1J05B 3UYOD 4MNGA 2QL1A 4ZAKB 3C5ZD 4L5FH 3PJSA 3QXTA 4V2BA 4OFYA 4H20H 4N9OB 2B7DT 3OSKA 3LSOB 4NHUA 5CJ5A 3M8OH 3QDJE 2R39A 1WBXA 4XC3H 1KTKE 1HK6A 3S34L 3P4OB 1U8HA 1VFBA 3A67L 2YD6A 1JPTH 3F7QA 1YEDA 3TT1L 3CLEL 5CIPH 2FIKA 2KKQA 3VXSA 1INEL 5I73B 5TE4H 1PBYA 4YHLL 2AV1A 4NO0A 4G5ZH 1WV7T 1P69B 2V2TB 2XZAL 2R1XB 1RZIA 1WEJL 3EKCA 5CP7B 4JY5L 5E00B 4JY4A 2C4FU 3DMMC 3WSQH 1I3UA 5HHNA 4L4VA 1NFDA 3HTLX 3ULVE 3IU3A 4IOFD 3T3MF 3IFOB 4WWKB 3C5SA 4BZ2L 4GW4B 2AEWA 1JHKH 5CZKA 4NNYB 2FEDD 3AGVA 1N8ZB 4K3JH 3HE7C 4OZIF 1I1FA 3B43A 5DEZA 3RUGB 2GHWB 3DXAD 3DX6A 3LN5A 2IH1A 1EEYA 3FRPA 4JPVL 3LDBB 3EYFA 2FECL 4KUZL 1EAJA 4YO0B 4XTRD 2MPAL 4DEPB 2Z8SA 3K4AA 3EO0A 3MV9E 5E2JA 3DIFB 1ORSB 3MUZ1 1VACA 5IVZB 5DDHA 3HR5B 3S6CA 4HEPG 3U9UB 5HHPA 3MA7B 3KNBA 4GMTH 2ADFH 1P7QB 4KKCD 4GUPA 4PRAB 4GKZB 1L7TL 2HT4C 2YUXA 3I3BA 3U0TA 5GIRA 4Q9CA 3WDIA 1TJIL 1ZLUK 3QO1B 4F2MB 3IDNB 2MTPA 4BQ9A 4LGSB 4CU7A 3QUXA 1TFHA 1F3JA 3MYJB 4GRLA 2ESVD 2NLJA 3K7UA 1N7ML 5DMGD 4Y5YC 3MLUH 3MRNA 4N5ED 5JQHC 2AK1L 5HHQB 5DTFA 3OX8A 3OKKB 3L3DB 3O6FA 1K2DB 4PREA 4ZOBA 3MCKB 3TCLA 1KELL 4R4FH 4AEFA 4YHZH 5D9SB 2ZSWA 4D0BB 5C09B 3JWDL 3TBTA 1ZLUH 1IFHH 2GW5A 1JIBA 1XGYL 4P2QB 2DICA 4OIIL 2R2EA 5F97E 1ES0A 3SKOB 1UZ8A 4OLVL 3SKNB 1PW3A 2ITDB 3WLBB 2R0WL 2X4SA 4X98A 4HWBL 5E94A 4DKFL 4TSBL 1IGTB 4YK4B 2HT2C 2C5DC 2MNUA 5CMAB 1EO8H 3LH2L 3BGFC 4QLRA 5KSBF 4LHUB 4YZFE 3IB4A 1CGWA 1OL0A 3GMQB 1LE5B 3IFLL 4EVNB 1PG7X 4HKBA 5GRJH 5J57B 4E5XB 1N6QH 1B0WA 5FKAA 4LFHG 3S5LB 4LNVA 1DQJA 5EO0A 4PJEB 2C9AA 1MHCA 4WCYL 3D85A 4KXZH 3RY5A 4CVUA 3DWTA 2R69L 5MEPA 4WO4D 4Y8AA 1K8IB 3TVMC 1S7UA 1NBZB 3WE6B 3G6AB 1KT2B 5F1KC 1QG3A 2BNRB 5CJQH 4C83A 1Y18A 1IGML 2NY6D 4JZNB 3IJYA 4NT6B 4I48A 4PY7B 2GFBA 3T8XA 3OKNA 4QY8B 2HN7A 2C26A 1OCWH 1FV1A 3N06B 3IDXL 3MROA 4JFZL 3VXPA 2YEZB 3FQNB 4QOKD 1EO5A 2JELL 4IHOA 4P46A 2AJYL 4GQPH 4HUUA 4NC1E 4WUUA 2YZ8A 3MRJB 4RNRA 1ZS8A 1F4WH 3NFNA 3VH8A 2ZUSA 2XNAA 1N64H 3TWCL 1OHQA 5I1JH 2ARJB 2UZIH 4F7TA 1I9RL 4S1SH 1HCVA 2F58H 4MZ2A 5IESL 5IQ9A 5MERB 3UO1H 4FQ2L 5DRWB 2PN5A 4MXWL 1FH5H 1A2YA 1I1YA 1BVZA 3CPLA 4PB0L 4AEIL 5J3HD 5L0QB 1XGRB 2Q7NA 4PR5A 1E4XL 3RGVA 3X11A 1RMFH 1DSFL 4R7NA 4EDXB 3K80A 2DQJH 4HK3N 1Q38A 2NY1D 3K46A 1NANH 4ZFFA 5HI3C 5CZXD 1OWRM 4KQ4L 4NIKB 4XNYH 2FATH 3H8NA 5EUKA 5I1KL 1BM3L 5IGXL 4Y19B 1MCNA 1G6VK 4RRPA 3ZKMD 2NW2A 1M71A 4NM8L 3FB8B 2OR8A 3IFPB 4LQ1A 4ZFZB 1BD2D 3KR3L 3KXFD 5KVEH 5I19H 1Z9OA 1GIGL 4ZO6A 3TF7C 1YMHB 5CKAA 5D6DA 3QH3A 2DD8L 2FDBP 1L9NA 2WBWB 3BZEB 5LWYH 3UTTB 2J5LB 4MA8L 3CX5J 1JE6A 1II4E 4YPGB 5TDPB 1SEBA 5CIPB 4LP5A 3ARVA 4JY6A 2NCMA 3G5YA 5IB4A 5IMMB 5GISL 3MUGB 4J3SA 4LLUB 1UA6L 4L8DB 3WBDA 3VFOB 3X3GL 2FHBA 2R0KH 1JGDA 1A6WH 4NZTL 1K3IA 3Q2CA 1U8JB 1J8HE 4RMVA 5DFVC 3KLDA 5KOMC 1TLKA 3O81A 2P47B 5FM8A 1IEAA 3QNZB 1OAQL 1FVEB 5DLMH 3KYNA 2HRLA 4POUB 4YHMH 5HDQL 2X4RA 2BVTA 2JB6B 5F88A 4C58B 4QRPA 5I15H 1A6AB 4PJDE 1KCUL 2NTSP 4P5TC 3KPQA 3EYQD 2V2WA 3QEHB 5D7KD 4D9RD 1QBMH 1XF3A 1F3DH 1OAYH 3VD9A 1HINH 5JO5A 1TJHL 3GB7A 4XC1H 3NZ8B 4LPCA 4LDLB 5DUPH 3LQAL 4HKZA 5IM7A 3ARQA 1KJ3L 4TYUA 1AGFA 3HZVB 4JREB 3HNTL 3BYTA 2BY3A 4I2XA 3EDEA 5I71C 3GBNL 5CHNA 3QDGB 4JFPB 5EZLB 5IG7B 2JCCE 1IQDB 4GJTB 1T4KB 4JO1H 4FQLL 1OAXL 2VLRB 3CFIC 3QUYA 2J8UF 5DS8B 4BQ6A 1DQDH 1G0YR 1IC5H 5I1EH 2QQQA 3FO9B 5ID1A 2G5RA 3L1OL 4PRID 4ZSOE 4H25B 1U42A 3NCEB 1BVLA 2D7OA 1MSPA 5FYJH 4HH9A 3DMMA 4NC2B 5LCVH 3HG1D 3SE9L 1ITCA 2NPLX 4P2RA 1BFVL 4TSCL 4TQEH 1NPUA 4BZ1L 4DGIH 4NQCB 5LKNA 1YEDB 3MLYL 2RAMA 3HE7A 1EHLL 1YMMB 3B5GA 3VXSB 4PJ8A 4M9PA 4NDMA 1S5IL 2HVJA 1P9MC 4XX1G 5J13C 1J0IA 1QFWI 1CU4L 1FAKT 2P1YA 3F65A 5BV7H 4XCNA 2XWJB 3MZTA 1MQKL 5EPMA 1IARB 4X7SL 3TZVB 2X9YA 3D0VB 5D72H 4L4VB 4RGNC 1T5WA 4OAWB 3ILQD 5F9WB 4JJ5B 4FQCH 1EK3A 4LPWA 1OGAA 2BVYA 4BELD 5FECB 5I0ZA 2XIDA 4KRPC 1I1FB 4MAYD 3DX6B 3L3OA 3LN5B 3AB0C 4TUJA 3EYFB 5DD5L 4KY1H 5JW5A 3VXNB 3IDMB 4KK5D 4PJCE 4WJ5A 1JRHH 1F45A 2HRPL 3BW9B 2VWEE 3QUZD 1T0PB 1VACB 1N4XL 3KJ4C 1U8PA 4GXUM 4XPHH 4XNUH 3DRQB 1X5GA 3RNKB 1CE6A 4WGVB 1FZOA 1AIFA 1VPOL 2P8MA 5DHYA 4YX2L 1C1EL 3BWUC 1NLBL 3G5VB 3NGBC 5IB3A 4U2ZA 1LGVA 4X8XA 4XZUA 3C09B 4QRUB 4OZHF 4XHJD 2GJJA 3RGHA 3QO0A 3TV3L 5H8DA 5JXED 1FRGL 3QUXB 3MOAL 4GRLB 4DUXA 1R0AH 3OG6B 1UKSA 1JWMA 3MRNB 2RJMA 1NFKA 3EO9H 2AEQH 2NY2D 3C6LB 2GCYA 1C5CL 2F54D 5GRXG 5E5MA 1T1ZB 1W72L 1MRCH 4OZIA 3BVNB 4PREB 4OF5A 4OCRL 1S7VA 3MODH 4HSQA 4XPAH 1T5XB 1I1AA 1H0DB 3KWWA 5T5NF 4X6DF 3MRHA 2EDLA 3VGHA 1M6OB 2R2EB 2YPVL 4UBDC 5T5FH 3UTPE 3DETD 1JF5A 5HHVL 1UZ8B 1N3NA 3HC3L 3HRZA 2AQ1A 1ZGLB 5E94B 1HI6A 2HA1A 1NCUA 1AXSA 3DURB 2CJUL 4G3YH 3RKDD 4UDUB 1DBML 3F7VA 1EVUA 4JPIB 1HDMB 3FMGL 4HKBB 5ANME 5IBLD 4K71C 4M48H 3O9WD 4JKLA 1N59A 2E8ZA 5EO0B 3UJIH 5ITBL 3D85B 1R3LB 3DOSA 1LP9E 3KPTA 4LCUA 5FKPB 2ICCA 2R56H 3QZWG 4GS7B 5L9DH 4NNPL 1MJUL 2Y6SC 2FHFA 5I8KL 2BVQA 1QSVA 5DHVA 1LEKA 4OD2B 5LGHH 1IRAY 3MLPA 2V6HA 5IB2A 4I48B 5DC4B 4RAUA 4PD4J 2HN7B 3GIZH 1KJ2L 3CZJA 3VXPB 1TIUA 4MB4A 4NRYA 1P7HL 1VEMA 4HHAB 5I18H 4JCLA 1D5XB 3TNNA 1F42A 3PQYA 2H2PD 4YDVA 4PTUA 5KSBA 4RQQA 4F7TB 3TN0B 4PV9A 3NA9H 2DN7A 1YEGH 1SYVB 2Z92A 4LARH 3U79A 3T77A 1A2YB 4EIGB 5KSAA 5E7BA 2VLKD 3CPLB 1RIHL 3VXUB 2OLDA 3QIBC 3CK0L 4NKIL 5I1AB 1V3MA 5EU6A 1UH2A 5D7LE 4YXLL 2HTLC 3LQZA 5JPNA 5EZIL 3SJVB 2JK5A 1TQBB 1XGTA 3IGAA 2PYFA 1NH6A 1LP9F 4HIXH 5HHOE 5GGUA 1DQTA 1QVOB 3K1KC 1H3PH 3U4AA 2IGFH 2GK0B 3MXWH 1A7RH 3K0WA 1L0YA 2NW2B 3TIEA 5C0JA 2BX5A 1UKTA 4HS8L 3WO4B 4YHOL 2AJ3A 4TVPH 2AI0H 3VXRA 2HLFC 4M1CC 4WV1C 4U05A 5HHMB 4Z8FL 1MQ8A 2IC2A 4OBSA 4GOSA 3MV7D 1CD1A 1XF4B 2PXYD 4LAQH 2EIDA 3MLSL 4UAOC 3REWA 1DANU 4TUOB 3GHBL 4JY6B 3G5YB 3D6GA 4X4XB 5DHVH 4ZXBC 2H3NA 2ZOLB 4P5TA 3QAZC 1X6NA 1WLHA 4NQXA 1I8MA 5BV7B 3EOBA 3V95A 4E0RA 1IILE 1UB5B 1UZ6E 1Q9LA 4MNGE 4OZGA 4K94L 3FB5A 2FH6A 1DUYA 5B38B 3U7YH 3DVIA 1QSFE 3TFKC 3AS3A 4KKLC 1NGPL 2HH0L 4XCYA 5KJRH 4WI2A 3GSUB 3FT3A 1SJVA 2Z4QB 4PGCA 5ACZB 4NRXB 3TH3T 3RTQB 1U91A 1C8PA 5I75C 4YUEH 1U8LA 2V2WB 3DX8A 5IB5A 4FNLL 4LCYB 3MUHL 1C7SA 3P4MB 1D6VH 2NNAB 3ALPA 3HUJB 1V8HA 4RAVB 1XIWC 3ZHKA 5E0QA 3LMJL 1U93A 3NIFE 1YY9D 4GW5A 1CGVA 1J11A 4HUMB 2FBJH 2RCSL 2MCPL 4DQOH 1MPAL 1JK8B 1NFDE 4PLJC 2ICWA 3ZKNC 4CADA 4DN3L 4CW1A 1G6RL 3MJ8B 3P2TA 4KKBC 3DROB 3OKOB 4IS6B 4TNWF 1R5WB 4M5YL 2YPKA 2EDJA 3SDDC 2M8XA 4J8RA 2DQHL 3I9GL 3EW3B 5DJ6B 4K3DH 5CD5D 3V0VA 5DJYB 1P9MA 1ADQL 1CL7I 4FQHA 5D1QC 1BVLB 1OSZB 5DC0A 4JFQB 4OD3L 3R06A 4KMTL 4UU9A 2IWGA 2YD3A 3IKCB 1I8KB 3STLB 1FZJA 4RMSA 3ILPB 1FP5A 4YDJB 1NSNL 4FQXB 4MNHB 5E8NA 4QT5B 4NFCA 3EJJX 3RIAF 4IIQB 4PJ7B 3MFFB 3JV5A 3BP5B 1RU9H 1FFRA 2Q7YB 2FR4A 2X42A 4G8GB 4NZRL 2NXYB 1KACB 5M95B 2A9NL 5D2LE 5F93C 4YXHH 4JO4L 3UAJD 4R2GC 2EO9A 5A40E 1GGIH 4DW2H 4BSVA 5BXFB 1GC1H 1GGCH 1IGFL 4JVWA 4JO3H 5DA0B 3W11D 3MBXL 3T0EA 1HH9A 1QRND 4DCQA 1AGDA 4XP4L 4JPWH 3RL1A 2IPTH 4H0IA 1FNEB 4JRXB 1FC2D 1KEGH 5JW5B 1B0GA 1LK2B 3B3IA 4RGOL 4JAMA 5D1ZB 4GAJH 3OGOE 3OKDA 3VXQB 1F4YH 4OFIA 4Y5YB 1BAFL 5GGSA 1U8PB 3UTOA 1MJJA 3SGEH 1JZ8A 3V4VH 3U4EA 2DKUA 1TXKA 1RZJC 3L7EA 2A9MH 3GBMH 2XT1B 3ZDZF 3C60C 1GGBH 3P30L 3WLWD 2P4AB 5HYJA 3OPZL 1IGJB 2VXQL 4LRIC 4P3CL 4P5MB 3FQWA 4WNQA 5HI4C 3TT3H 3QO0B 4PP1C 1MNUH 1KCSH 1NAKH 4GBXC 4OZFA 4MX7B 3JVGC 3VRLE 4OM1H 3D0LB 4RMUA 3EDDA 2I9TB 5DFWH 5E5MB 3VDBA 5T1DH 3PGCA 4OZIB 3E6HA 5T1MA 3BGFB 5B21A 2HJFA 5FGBC 3JSSA 4PG9A 5DR5L 1QYGL 2GSGA 1VGKA 4MHHI 1S9VB 2WLZA 4WUUE 4U1NB 4ODWB 1BGXL 3AS1A 2FB4H 3HRZB 1J8HD 1UWEL 1NC4A 3GMPB 3TVMB 1HI6B 5EC1B 4MDJA 1D7FA 3UJJL 4M6ML 3GMLA 3CFBA 3D25B 1OP5K 2CDEA 3Q6GL 4UOW0 5DK0B 4ESKA 5DRXA 4NO5B 2GJZA 4IJ3B 4BA8A 2OJZL 4MQXC 1A3LH 1MRDH 1E0OB 4NNXA 1OQXA 3H9SA 4EOWH 1PZUB 1HIMH 2VDLL 1BEYL 2KDGA 4LVHC 1KEMH 5E8DH 4LCUB 2ITCA 4ONFL 2LFGA 4NJAL 5B39B 4HGMA 2NX5A 5FGCB 4P99A 4W68A 1A02N 3RWHB 2ED8A 1OP5H 4HF5L 1U2CA 4PBVC 4MJ6A 3MRMA 1FHGA 3IDUA 5IB2B 1T03L 5D5MF 2QHRL 4YNYB 3VFMB 3F58H 2BVUA 1A6ZB 1S9YB 3S36X 3MGAA 3ZKXC 3QIBA 5DMIH 4MQTB 5FYJE 4KDTC 4NRYB 5BO1L 2VXSH 3LKQA 4Y8DC 3NPSC 1MFBL 1NBQA 4OZ4B 5KSBB 4RQQB 4OZFH 4W4OA 4PV9B 5GRYA 2DLIA 4C4KT 4X7DC 5C0BA 4XMLH 1QO3A 2O5YL 5HGHB 2VZUA 2CXGA 2YZ1A 4Z7NF 1P7QD 1WTLA 3RNQA 4QHNB 1DBAH 4XP1H 4HX1B 5I1IL 5E7FA 5IT2H 1ZHKB 4P3DB 4PRPB 1MRFL 1QSEB 2DQCL 4M7LT 1FG2A 1WT5C 5C1MB 2JK5B 5CKGA 4WW2F 1MJ7H 4JR9H 3BFOA 2LABA 2Q8AL 1IAIL 1WCBB 4QRPE 3VGGA 32C2B 3MRPA 4ZPTA 3K8MA 5I9QC 1P2CA 3TIEB 2AJVL 3CXHJ 3MLRH 3WNOA 5F7YC 4MDIA 2EDDA 3BHBB 4YPJA 3X14A 2QEJA 3VXRB 5DD0L 3MACH 2UY7A 1GVIA 4I2XE 4UT6L 3GIVA 2DJSA 3PWJA 3VA2C 4LPUA 4XWGL 2FYYA 4A6YB 3F7RA 4H5SA 4UB0L 3EOBB 4FXGB 4E0RB 1CICC 2VTFA 2R9HC 3P0VH 3RZCC 4LPYA 1XIWA 5EZJB 3I3EA 5DJ0A 2D0HA 4ZS7L 3KG5A 3WCYA 5I71B 1WWWX 2J88H 3WEXA 5ESAA 4KUCD 2EH8L 3JTTA 1KPVA 4P2RE 1AQKL 1ZSDA 4XP5L 3PV7A 4PGCB 4XPFL 1WQVT 2JJUA 5ETUA 3GSRB 1FN4B 4HC1L 2ENYA 3QG7L 1G9NC 3SDDA 5CJOL 3S88L 4WW2C 2DRUA 4E9LA 3FFDB 1Z0NA 2R4RL 2X1OA 2VLJB 4GAGL 4HLZG 2X89D 4MJIB 4JM4L 3R1GH 4GW5B 2OCFD 1ERNA 5D1QA 1FNFA 4X9BA 3MQIA 3UTPD 5I1GL 1RUPL 2VZVA 3D9AL 3M17B 4N0FA 1RK0B 1YN6B 4Z0BL 4CADB 5HBBA 1RVFH 1ND0A 5I74C 2BNUA 1E6OH 5DGRA 1OGAE 1FG9C 4NSKA 5F44A 2DWDA 5FYLD 5F1OB 1ZA6A 3DBXB 3Q5YA 4QF1A 1FBIL 1PEWA 3O11A 4OT1L 1JNHB 2VC2H 5FO7A 1ZHNB 4LNRA 2RQ8A 4J4PA 4FQIH 3VFSB 1VFAA 4HS6B 1GOHA 5DMYA 3V0VB 2DQEH 1DN0A 2WUCL 1CFVL 5J13B 3ARWA 4Y0GA 2DLFL 4FQ1H 3QEUA 5B4MD 3R06B 4LLDA 5EBMA 1E4WH 3IFNL 4PJIA 3VMPA 3KAAA 1A6VH 2WM0A 3CDYA 3RA7H 2QADC 2CIIB 4U31A 1MCBA 2H32B 1L0QA 4NGHH 2K3TA 4Y19D 1SHMA 3ZT6A 4YFLI 3WIHL 2XRAH 4X7TA 5EOCL 4KRPB 1F6LL 5K9JH 1N5YL 4X7FC 3AB0B 1SJHB 2OP4L 1JNLL 4JQXA 4XNQA 2AK4E 4FHBD 3SDXE 2DBLL 4MZ3A 5JUEH 1F4XL 4U49A 1A0QH 1N0LA 2V9QA 2VDOL 2VDPL 5GZNC 4L8SC 3DNKA 2AABL 2J8UB 2CO6B 4Y4FD 3U0PA 2I9LA 2CIKA 1QBBA 4XCCL 1BQHG 4QRQA 5DVKA 4KJPD 5IW6A 1EAPB 1ED3B 1KB5A 4DUWA 3WHE1 1OM3H 3NGBB 2WMPA 3GJEA 2IG2H 3B3IB 3EYVB 5FAAA 2Y06L 4Z7QE 3VFWB 4ZUSA 3T1WA 1IL1B 1Q0YH 5M7QA 2UYLB 1WFOA 1MJJB 3BEWA 2J6EA 1DDHA 2AV7B 5HHOD 4CBPA 1HNFA 5J06A 1MFDH 1ZA3B 2OJEB 5JW4R 2BOBA 3KDMA 3SGDI 3V7AG 2YN3A 5BS0B 4RBPK 3G5XA 1FZMA 2XKSA 4OZFB 2H8PB 1AC6A 4RSVA 3CUPB 5JHDA 4JRWA 1HEZB 1T1XB 3G08B 5KW9H 3BKML 5GSRB 5GGTH 4APQC 3E6HB 5IV2A 4HFWA 5IQ7H 3BGMB 1DEEA 4YC2C 1AD0B 2DOCA 4TNWK 2P43B 4HWZA 4N0CC 2GSGB 4PYHA 4RBPH 3CDGA 5ISZB 3EGSA 4KV5F 1RZFL 4YHNA 1F4HA 4OGYH 3QA3A 3BJLA 3BRGC 1C16A 2WWMD 3PQYE 7FABH 3HPLA 4K3EH 2BHUA 4OFYD 1T1WB 3SE8L 1AQDA 3G6DH 2RFXA 5E99H 4MDJB 1HHIA 2YPLA 5JIKA 1LD9B 4EEEA 1FL3A 1M7IA 3BKYL 2CDEB 3EUUA 4KI5F 4NP4L 4OZHB 5GQBA 3MOBH 4U1KA 1Z9SA 3IS1X 4TNVF 4TVSa 1V3LA 5HGDA 3EJYC 5EU6E 5SWSB 1VADB 4Z7UF 2V7NA 1RZJH 3VXSD 3H9SB 3MRKA 4TTDD 4EN3C 1XEDA 3KYKL 4NO0D 1KB5H 3NZHL 2J4WH 3GMRB 4KDTA 1S7QB 4JFXB 1M05B 2LQRA 3P4LA 3S4SG 3ETBF 3D18A 4KK8C 2ZUUA 5IBUB 2NY3D 4L4VD 3U7WH 2VABA 4CDGC 4LGPB 1PZ5B 4X6DB 4ZS6C 3JWDC 1RZKH 1WF5A 4PJAF 2J6EH 1TZGH 2VE6A 3KPRA 5D93B 4PJBF 1JPGB 4XP9L 3MNZB 2B20A 3QIBB 2VZ3A 2X09A 1TZIA 3HAEG 3BYYA 2OL3A 1FCGA 2DYPB 1IQWL 5F8QC 3WUWG 3FN0L 3D69A 4P23A 2JIXA 4LLYA 4FTVE 4DKDC 3RQ3A 1NCCH 3LV3A 4G6KH 4ZO7A 5JOFB 1UXWA 4HPYL 5HPMA 4HWEH 4JANA 5C0BB 5HXMA 2B1HL 1JYWA 4PTTA 4PUBL 1NAML 3VFPA 1UCBH 2CPCA 1UM6L 4XRCB 1XR8B 1RZ8A 3BZ4B 1BVKA 1U3JA 4PB9L 4UTBH 3LS4H 2VISA 4OZGE 3HI5H 5DUMH 1IEBB 4QKXB 1A1MA 1T0NB 3HS0A 5SX4I 4WV1B 3NA4A 3QUXD 4GRLD 1MOEA 2FCBA 3BPLC 3MO1A 4JQVC 3K2UL 4MJ5B 1HNGA 4KI5C 1GL4B 5D70L 2IMNA 3C6LD 4XVUD 5C9JB 4MWFB 1V7NH 5B3JF 1JTPA 3MRPB 3O6FD 4F58L 1VGEH 1P2CB 4ZXBB 3T0AA 3RWGB 4NO2A 4L8CB 3W5MA 3QAZB 4UV4L 1AKJA 5CGYC 3WL9A 1D5IH 4GRWF 1CICA 3QULA 4UV7H 2D4DA 3VFTA 4KVCL 7CGTA 2I60H 3GIVB 5TFSL 4K7PH 4DOHB 2ZPKL 3PWJB 1B6UA 3SOBH 5F9OL 3VXTA 2ZCKH 4PJFA 1NKRA 3UC0H 4PV8B 2OR9H 5E2TL 1D5BA 4BM7A 3EFFA 5I1HL 3QPQC 1FNSL 2B1AL 1MCHA 4EUPA 2AJUH 5HYSB 2I07B 3D85D 1LP9B 3CMOH 4JRYB 3WFBL 2NYYD 4FN0A 4RFEB 2VO5A 5DVLA 1ACZA 2ATPB 5TQ2L 1QBLH 3V0WL 2OL3H 3BKJH 4WUKL 3BMWA 1CXIA 3WEXB 4X4YA 4RGNE 3JTTB 5EN2B 1ZSDB 4U6VH 4JKPL 3U4BH 2C3XA 3RWDA 3T0VA 1MLCA 4WTZA 3S98A 1UACH 2BCKB 3V4PH 4O9HH 2WANA 2HFFB 3T1FB 3SY0B 3OB8A 4LEXH 5EC2A 4OCMC 1HXYA 3C2AL 3UYPA 5ICYA 5BMFH 4P46D 5FF6B 3N1GC 4M62H 4RMQA 4WUUD 5EWIH 5D1QB 1EBAA 3BMVA 4YR6A 3A6BH 2EYSB 1R3JA 1YEEH 3OHXA 3PDGA 43C9B 1YA5A 1ND0B 1RZGA 2YSSA 3PGDA 3HRPA 3VFRA 4NSKB 4I77L 3V4UL 3T0EE 1OF2B 3WKML 1HKLH 1HHGB 1KCVL 3UBXI 5ADPH 3EZ8A 2DWEA 1QFWH 4I0KA 3RVXC 3NIDF 2V5TA 5J1AA 3S7GA 3EO1A 4WHDA 3RGVD 4LCWB 1BBJA 4NWTL 3WNLA 2FBOJ 4ODXB 2ATKA 1BIIA 3NCJL 4AK1A 3KVQA 1Y6MR 4G9FB 4O2CB 5KANI 4L8SA 1DBBL 2E27H 1U3HC 4H1LB 2IADA 1T20B 5HYJE 3CVIH 1KCKA 1JPSH 1RULL 2VXVH 4X7TB 2E9JA 3FOLB 3WUZA 1MWAL 2QQLH 1TJGL 4LOUD 5HHXL 5JPMA 4GW1B 5EULV 1KC5H 4OTXH 3K4ZA 3LEVL 5FYJD 5IJKC 1G9NH 4EUPH 4X99B 3HMXL 4M8VA 1A64A 2XY2A 4NBYB 1NBVL 1NDGA 3W2DL 4FZEH 2GAZA 3GJFA 4KRMB 4XHQA 5J1SC 3U0PB 5ERWA 2P8PA 4WW1A 4N9GA 4TRPL 3RVUD 5I2IA 5JLZA 3OR6B 1B2WL 3O3UN 2CLRA 3C60B 1UQSA 5EORL 5H94A 4P3WA 1BZ7A 1RIUH 3WHXB 1SBBA 3OKMB 4TUKH 4HJGA 1A9EB 2AQ3A 3GK8L 3S36L 4GBXB 3OAUL 4E41B 4AENB 4BQ8A 3QIWC 3IVKA 2P49B 3QRFM 3L9RA 1DDHB 2YOCA 2JLLA 1JGEA 5A3IC 3SKUD 4HXAH 5FM4A 1G1YA 3I75A 1L4IA 1MELA 5BRZA 5BW7C 4NYLB 3C8KB 4UI2A 4L3EE 1DL7H 1TNMA 4J23A 2Y07H 1FZMB 4MCYA 3RAJH 2NX5E 3LKNA 2R2HB 1P1ZB 4Y4KC 1I9JH 1RHFA 1NQBA 1QQDB 1FLRH 3PE9A 4DAGH 4MXVE 5C07A 2ZSVB 3ALWA 3MTRA 3TIDA 1ZHBA 3U36A 1HSBA 2B39A 1JGLL 1GZQA 1DEEB 3GJFK 3I6KA 4H8WL 3QUYD 5C92A 1IC7H 1FDLL 4DZ8A 4M43L 5CBEA 4OB5L 4YHNB 5I6XC 1F90L 4R90L 2CR3A 4LVHB 3ROOA 3O6KL 4OGZA 3QHTC 4WEMB 5HJ3A 1CS6A 3OZ9L 5IFAH 5ACMA 3L3KB 3W9EA 1I8IA 3MLWL 1S7SA 5D7JC 1HHIB 3GZKA 3DMMD 1FL3B 3FFCE 1M7IB 2IALA 2DTML 4PBWD 5CD3A 3S34H 3QFJE 1PD6A 4P2RD 3GJFH 5MEQA 1CGYA 3FZUC 1FO0B 1WFNA 4LRNH 3TT1H 5C7XL 4FFVD 3CLEH 3GI8L 3HE7D 2V7NB 4NOFA 1INEH 4PJ8D 3ZKXB 1IBGL 3RVTD 2DLEA 2XZAH 3I2CH 4HWBA 3PHQA 4M1DH 3NPSB 2DL9A 1KLUB 4QXTA 3ARPA 3THML 5FHBL 4CVXB 4GMSL 3CFEA 4ZOEA 4BJLA 5F7DA 1LO5A 4WFEE 2AERT 4BZ2H 3QI9A 5C3TA 1KN2L 1OGAD 3SPVA 2BDNL 1TMCB 4LIQL 4G7YH 1B4RA 3AROA 5HY9A 2HT4D 5HI5D 1TZIB 1AHWC 1GPOL 5DZNA 2G2RA 1JI1A 3CXDL 4Q97A 1HXMB 1SY6L 2OL3B 4KUZH 1UH3A 4PGDB 5ILTL 3SKJL 4M93C 2MPAH 4M7LL 4KHTL 1J5OH 1F97A 2JIXB 2DKSA 4IRZH 5KS9E 5JNYA 4OQTL 4J1UA 3X3FH 3RX8A 4UQ2A 4PJ5B 5HPMB 5INDB 1CXEA 3FRUA 5F7WC 3UP1A 1VKXA 3I50H 4GG8A 2QV2A 4HIHA 3BH9B 3BN3B 4PTTB 2XWBB 3VFPB 3RJQB 3SO5A 2D03L 5K9OA 5IK3B 4M61A 5I9QB 1DQLH 1L7TH 3B9KA 3SGKC 1INQB 4QXUH 3HN3A 5ENWB 3V52L 2VISB 2G9HA 4CDHA 4ZNEA 4JE4B 1HHHB 1TJIH 4HK0B 4OLYL 5E1AA 4O2EA 3HB3C 2XY1A 4JO2H 3O2WH 2R29H 1EUTA 4G8FA 3ZTNL 1N7MH 4V1DB 5J6HB 4R96A 5FK9A 5D5MB 5KVFL 1J88A 2HT2D 4S10A 1UT9A 4D9LL 3VU2A 3HZYB 4PJ9C 3BPOC 2YC1A 4XBGB 3ZTJG 1I1AD 2UVFA 1CXFA 3WL9B 4X8JA 1XF1A 2A83A 1CICB 4YWGH 3U30C 1H9VA 2A6IB 3RZCB 1S9XA 4DGYH 4KVNH 3HC0B 2HKHL 1EEZB 3MJ9A 2NY7L 4NKDA 5EUOA 2I5YH 4OLVH 5F6HJ 1GSMA 2R0WH 5M94B 3ULUH 35C8H 4HWBH 4PG2A 3BQUB 4GLRI 4TSBH 3TVMD 1Q94B 4DKFH 3VXTB 1EH9A 3CSGA 5DT1L 3LH2H 3QEQE 1MFEL 1X5XA 1QFUL 3BAEL 3T0BA 4YGAB 4XAKE 4Y1AB 4Z7VF 4P4RB 4TVPD 1PQZA 1A7NL 3EFFB 4LLVB 3AXLB 1NL0H 3BWAB 1A7QL 2ZCHH 1T2QL 4WW2B 5C0AA 4BSWB 2A6DB 4HAFA 2BSED 2PW1A 1F8TL 3E3QC 3RL2B 3CVHB 4NJ9L 4KQ3L 4EBQL 2Z35B 3K1DA 4PJIE 5T33H 4X4YB 2VZTA 3PL6C 5I74B 1FFPA 1IGMH 3HCVA 1IGYB 4X5WB 4AG4H 1G7QB 5DO2D 4AQOA 3UDWC 2Z91A 4U1MA 3IDXH 4JFZH 4X83A 3L5IA 3EYUL 3UJTL 2JELH 4KAQL 4PLKC 1JTOA 3JBG7 1EHNA 5J89A 3TJHD 4OFPA 4JM2A 2CLVA 3V5KA 3TWCH 1GGYA 1I9RH 3OHXB 3CC5A 4XB7A 3LQMA 3BP6A 4UZGA 4XXDB 3WXVL 3CFKA 2QADB 4MXWH 1T2JA 1V05A 5EIVA 1T1YA 5DRZB 2CKBL 2PO6C 4QHMB 5JHLH 3KGRA 3LKSA 2DWEB 3QHZH 4PS4L 4AEIH 4K94C 1YEKL 3ARFA 1I7UA 1F6FB 5J1AB 3KPMB 5FO8B 5EU6D 1CLOH 2WP3T 4EI5C 1CIUA 3U82B 3B8YA 3O3AA 4LDOB 5L8LB 4BKLB 5IJKA 1Y6NR 2BVEA 4J6RH 1AO7A 2FIRT 3QRGL 4NUJB 5ELIA 4LVOC 3MJ9H 4NQSB 4KQ4H 5EIIB 4OFDA 1WZMA 4L8SB 4OCYL 3WS6A 5I1KH 1BM3H 2IADB 4WI3A 5IGXH 5F9DC 2H9GA 4ZD3H 3IAQA 4HXBL 1U8NB 3OGCA 3ZT7A 4NKOA 4NM8H 4GXVL 1YNLH 2VH5H 1WZ1L 1U92A 3T2PA 3S3JA 5CEYA 3KR3H 3VXRD 4EDWH 5I8OL 4ERSL 1IZJA 4YHPB 5JHDE 4LPVA 1RD6A 4KJYA 3PWLB 5E03A 3M45A 2DD8H 4N8PA 4E42A 2F74B 1NJ9B 5D4QA 3G5ZA 3GJFB 2EYTB 4OF7A 5ICXA 2ZG2A 4K23L 1CFQA 1XGPA 4X0KB 3FB7A 5I2IB 2DBJA 2WK2A 5JLZB 2NY5L 3L5HA 4P5TD 1UA6H 4M6NH 1TTFA 5BW7A 2PTTA 1BZ7B 4GRWH 2AAVA 3DECA 2DLTA 1OW0C 3X3GH 1CDIA 3N50A 4LPTA 4LEOA 5D1XB 4WDIB 3KPLA 4B50A 2FWOB 2X9WA 3SKMB 4Y4KA 4I4WB 2YPLE 1LDPL 4LLWB 1K3ZA 1OAQH 3VMOA 3EOYG 4Z7WF 3VXMA 3T0DA 1LO2H 3NCCB 4APQB 3MR9A 4HFUL 1OT2A 5DJ8A 1AJ7H 5I76A 1TTUA 2BNQB 3VMNA 3PV6A 4YC2B 3NBNA 5F96L 2OMBA 4WGWB 5F7LB 1GJIA 1CT8B 3LKNB 1X5FA 3EAKA 1KJ3H 1QPPA 1YJDL 1J0ZA 2VIRA 3HNTH 2XZQL 4R0LC 1KCRL 2P5EE 5C2UB 1AGBA 3GBNH 3HI6L 2YK1H 1PDKA 4XBPA 1G7IB 2QSTA 1FFNB 1HCFX 1OAXH 4OD1H 5DJAA 1HSBB 3KPRE 5F71A 5GGRB 1GZQB 1NMBL 1KNOB 2DIJA 2BOCB 4G6FB 1MH5A 5CBEB 2KL6A 1CWVA 2EXWC 3BXNA 3ROOB 4EN3B 3UTZB 4JGMA 3E6FB 4WHCA 1KJMB 4HUXB 1V3KA 4C55A 1I8IB 1W72A 2EE2A 4M7ZC 5DJ2A 3N0PB 4NRZB 4XMKH 3SE9H 2IANA 5F1IA 5TPWL 3QXWA 4RGND 1RAMA 4TSCH 2EDXA 2IFFH 4R3SA 1CK0L 1EHAA 1F58L 4AH2A 3MLYH 4BZ1H 1V5JA 1DFBH 2DM3A 3FL7A 1EHLH 2H2SD 2V5SA 4KRPD 3GUTB 2WUBL 5L2KA 3TA3A 1S5IH 2HT3C 2VKWA 3O4LA 5DRNB 3X12B 2WWKT 4LASH 1RURL 1HYSC 1CU4H 2CKNA 4O58L 3QNXB 5ESQB 5CBAA 3MNWB 1XH3A 1WBZA 3TBWA 3WKNA 3ULVL 3IXTA 5C08E 3CFEB 4LVNC 5EBWA 3O2DL 1ZV5A 3V6BR 4D0DB 3U0WL 1FE8L 3FQUB 3GSQB 4P2OC 3T0ED 1NGZA 5CWSB 1QHOA 5GGVY 5HVHC 2AJXL 4WHYG 4JFDA 3SGKA 5IMLB 4KMQA 3TO4B 1K8DB 4U1HA 1A1NB 1U8IB 3L3HB 5DQ9B 1TVHB 5JNYB 3SQOL 1BIHA 3BPLB 2VN4A 4UT7L 3JV6B 1N4XH 4UQ2B 1WZLA 3GSXB 3H9HA 4PJFE 5ECJE 4RDQG 1YY8A 1FL5B 4HIHB 4Z7UB 1KJ2A 4K9EL 1VPOH 2IAMC 2WBJB 3BPCB 1WAAF 1WTGT 4PJ9A 4WY7H 5HYJD 1BQLL 3RIFK 2GTWB 5BVJB 4AL8L 5CSZA 1JHLL 3T4AA 4UQ3A 1C1EH 1AH1A 1U0QA 4XVTL 2LAGB 2K1MA 4C56A 5C0FA 3TV3H 4HIIB 1G7JB 4YBHA 2BVPA 4O2EB 4OF0A 3GDBA 3G6JF 1FRGH 3U6RA 2GUOB 3MOAH 4NKMA 1A6TB 3ECBB 2YKLL 5K9QI 4R96B 5FK9B 1D3CA 4W6YB 4QTIL 4PJAB 4Y7MA 1H3TA 5GS2H 4Y5XA 1YEJL 1W72H 4PJBB 2QSQA 1XGUB 1F5WA 4UTAL 3QCVL 3ARDC 5DSCA 2WV3A 4G43A 4Y5VC 2B4CL 1LWRA 3QZWB 4JDVB 3EBAA 4M4RA 3GHEH 4J3VA 3VI4F 1U8QA 4JVPA 5EFIA 2VR4A 3OR7A 5GRVL 5HHVH 4JDZA 1I3GL 1X5JA 2L7UA 3D39E 3HC3H 1NC4D 3MPCA 1OAZL 1QLEH 2Y6SD 3INUL 5KVGL 1YNKH 4CGTA 2FSEB 4MCZA 2EH7L 4GKSA 4PGEA 4XNXL 3NCYS 1E6JL 3FMGH 2DM2A 3MUJA 1H5BA 5HVFB 3H9SD 3UDWA 2ZCLL 2NTFB 4K2UL 5C0AB 5I8CB 2JJSC 3ZE0E 4ZPVB 5FUZL 2PW1B 1KENL 1V7MH 2D3VA 2R0ZH 5DJXA 4WFFD 5IW1A 3QCTH 4PJHA 1A9BA 2ZKHH 2YBRA 2NX5D 3T09A 4DZBB 4NNPH 4OGXL 3JXAA 4L29A 2O5ZL 1UM4L 4R4BB 1X44A 2W0FA 5I8KH 5D96C 5DUBB 3P3YA 4FG6D 2A6KB 5F3BA 1FCCA 1EGJL 1R24A 4WU5A 1IGIL 4F9LC 3HCVB 2J3SA 4GRWB 1ZT1B 4IEFB 4YHIB 3H3PL 4NHCH 3R8BB 2PO6A 5IF0B 1KJ2H 4HGKC 5TE6H 3QIBD 2Z93B 1UGNA 5JOPE 4EI5A 2HYMA 1S7RA 4O2FB 4D0CA 2HTLD 1DZBA 1E27A 3V5KB 3WNMA 1VERA 3QJHA 2WAHA 4PJGE 3QPXL 5CINL 1DJSA 1YPZF 4J3XA 3UZQA 5IOPA 3A6OA 3BI9X 5C0BD 5BQ7A 5EDXA 1U3HB 1VFMA 1A6UL 5LBSL 1BX2A 1AFVL 1MHEA 2H41A 5GGQL 1RIHH 4B5EA 3C5JB 4K7FA 3CK0H 4NKIH 4ZUUA 1PKQA 3HMWL 1ZMYA 1ZT4B 1VSCA 4YXLH 3TP4A 3O3AB 2R2BB 3K2MC 1I9EA 5TH2B 2HLFD 1VB9A 1C12A 4M1CD 4DGVL 3MCLL 5EZIH 3C6SA 3BP7A 1G6RA 5EU4B 5MENB 4WTXA 4JFHE 3UMTA 1ETZB 1T80A 3QUKA 5D7IF 2Z31B 5BRZE 5SV4A 4WFED 2F53E 4NUGL 4MA3A 4NKOB 1ADQA 1XGQA 4YHOH 5DWUH 1HQ4B 1MI5B 1ZEAH 1OW0A 4BUGA 5C0CB 3HLAA 4MD4B 1C08A 1A5FL 5DMKA 4ELMF 3LKPA 3G5ZB 5FYKH 4Y2DA 3QIWB 5C07E 2Z8RA 3ALXA 4KKLD 3SGDH 1UB6A 3GHBH 3M07A 3CH1B 3KPSA 1XGPB 1KF9B 1T3FA 3CU7A 2PYEB 4P4KC 3RVVC 1X5YA 1L0XA 3Q6FB 4PGZA 4AIXA 1SMOA 5GHWH 1MCPL 4ZAKC 3BDYL 3AREC 2PTTB 4U6YA 4MMZC 3QEGL 3DYMA 1FIGH 1KB9K 4OJFH 5A2IH 1L7IH 4LEOB 1XIWD 1KULA 1Z0MA 4YAQB 2P7TB 4EIZC 2GJ6B 3KPLB 4DN4L 3MRIA 1MVFA 1YEHL 1OLLA 5SWZA 3OTTA 4Y4KB 5DQDH 4R0LA 2FGWL 4ODHH 2GTZA 1NGPH 2HH0H 4ZUVB 4PLJD 5I73C 3BJ91 3MR9B 5I1CH 4L4TA 5DJ8B 3VD5A 5I76B 3PV6B 3DYPA 4FNLH 5IUSA 5KSUB 3SDDD 5C0EB 3LN9A 1PSKL 1MJ8L 4N1HB 5I6XB 3ULUE 1Z3GL 3SDAA 3L3IA 1EFXA 4L3CA 2G60H 1J8KA 3K8KA 1ZLSL 4WWKC 5D1QD 5LQBL 1NCNA 2N7BA 1AGBB 2MCPH 1BREA 5D7JB 1MPAH 2LTQB 2VLKA 2R8SL 4XBPB 4DN3H 3UROR 1W0VB 5AYUL 1G6RH 5ID0A 4Z5RB 5IMOB 1DBJL 4JFFB 4HH8A 1O5DT 4M5YH 2AXGA 4XAKD 1MHHA 2GYSA 3HHRB 2DQHH 3U1SL 2DQDH 3CJJA 1S5HA 3I9GH 1MF2L 3BXNB 1EZVY 2OQJA 1CLZL 2A0LC 1ADQH 1JRHI 4FMFA 5EG6C 1DQML 4XBEL 1S9KC 3LKRA 4JFOA 4U6HB 1W72B 4OD3H 1LMKA 4KMTH 3W0WE 2YA2A 4R2GD 1N0XH 2DQIH 4LAJH 1NSNH 1QFWM 4MGXA 4UMGA 5TDNA 3DTXB 3VFVA 2AEIT 4P2OA 1UJ3A 1YUHA 2FO1A 2MKWA 4MXQC 3SBWA 3AU1B 2FD6L 1EMTH 5D8JL 3MV7A 4X6EA 1AHWB 1G9ML 3ROLA 4GKNA 1MEXH 3KPNA 3D3VA 4NZRH 4YLQT 5D2NB 2A9NH 4M93B 5ADOH 1XH3B 4TULL 2PETA 1W0WB 1JGUL 4PJXA 4HGWB 3MV8A 4B0MM 4K8RL 3AAZB 1IGFH 4X5XA 1FZKB 3MBXH 2IAMA 1TDQA 5SX4H 2ORBL 4XPGL 5JORB 2Y5TB 1VENA 3LN4A 4U1HB 5HI4D 2Y7QA 3ZKSD 5EUOE 5KANG 3WFEL 2E3VA 1I7TA 2FHCA 3O3BB 3FQRB 1FL6B 2KH2B 4P0DA 2D7NA 4QYOA 1S7TB 1YY8B 3LPGA 1J1XL 1ZKAA 1KJ2B 3H9YA 3ARDA 1OTUC 3PXJA 4QXGH 4JKKA 2VXQH 4M8QA 3ZDXE 4P3CH 4OV5A 1Q0XL 3MRBA 4NQDA 3F8UB 5C0FB 1X7QA 4FA8A 3MMEB 3U30B 5F3HB 2BVPB 5EBGA 4XAWH 1AI1L 2XTJC 4NZUH 3BZDA 1GRWA 3EOAA 2Q3ZA 4KTDH 3U6RB 4NKMB 1JN6B 3I02B 1MCEA 3DVGB 2WIIB 4NZDA 5JHDD 3QHFH 2NY0B 4LSUL 3DXAE 4ZUWB 3WFZA 2XN9A 5FV2A 4FP8L 1KLFA 4KZEL 3RX5A 5DSCB 4KHXL 2ZOKA 3UTQA 1FFOA 4MNQA 4LBEB 4M6OH 5DR5H 1QYGH 4MQXD 4IRJC 3FTGA 2F19L 4ONGH 4MS8C 1U8QB 5EFIB 3S35L 2G5BB 3O3EB 1GYAA 2H1PL 1JYNA 3U46A 5BZWB 8FABB 4UNTA 2YPLD 4Z0XA 3FFCB 5TDOA 5L0QC 1NMCB 4M6MH 3UJJH 1Q9KB 3PL6B 1RJZB 3GSNA 1XF5A 4F9LA 4GKSB 4Z18A 5D6CA 3IJHB 4HG4J 2RHEA 3PWNB 2I26N 4JVUA 4JHWL 2GY5A 2HJKB 3WUWA 2VDLH 1IM3A 4G7VL 4MD5B 2EDRA 1AO7E 4ONFH 3O4OC 1A9BB 4NJAH 1OAUL 2YBRB 1HN1A 1F2QA 3WXWL 3LEYL 1QRNA 3SDCA 4XP6L 3MBEA 1BJ1J 5HDOA 4WU5B 4HF5H 4GG6A 2C7UB 5L88L 4PGBA 2QHRH 1WC7B 3KPRD 2PO6B 4PLNC 2G75B 2NR6C 5F72S 4L9LA 5H35B 4KTEL 3RX7A 4EI5B 3VRJB 4XC3L 4D0CB 4HCRA 5CEXB 5FYKU 4P23D 1JPTL 1RHHB 2JIXD 5F7NC 2H6PB 5KSVA 1RUMH 1F2XK 4LVOB 4Z7VB 4MSWA 2LE9A 3L7FB 3CX5K 3UTSB 1TETH 1ZVSB 3CCHA 4M1GL 1MIEL 3C5ZC 1MHEB 4K3GA 1R6VA 4Q6IC 5I1IH 2DDQL 1K6QH 3GGWB 4OLEA 4YIQB 4BFBD 1PKQB 1JL8A 4IMLA 3UZEA 1U8MA 1QUNA 3S37L 4BK4A 2LVCA 5DI8A 1JHKL 3C6SB 3MLTB 1WWBX 1G6RB 3BO8B 1MAKA 3VXME 2HP4A 1YNTB 1IAIH 3OF6A 4LFHD 2R4SL 5J0BA 4P4KA 2BC4A 3GSNH 2AJVH 2OI9C 3NOIA 3A0OA 4PRBA 1MY7A 4ZAKA 3AREA 4OI9A 3CZFB 1G7PB 5GS0C 1XCTB 3LSOA 5DD0H 1CICD 2R9HD 1T6VN 3HLAB 4IOFC 4BUHA 1R5VB 1NEZG 1YECL 5GJTL 1INDL 1C08B 1MCIA 4GMTL 4WI7A 1YPZA 3OB0K 2FEDC 4I3SL 5F7UA 1FLTX 3LKPB 4ORGB 3DGGB 3LOWA 3IJSB 2Y72A 2ICES 3NCBB 5I17B 2CR6A 2VAJA 4N8VG 4XTRC 3B9VA 2V2TA 3MRCA 5FOBB 4BFIB 2X1QA 1ZVYA 4O51B 4UB0H 3MLUL 4ALAH 1OWWA 3N85H 5E00A 1MHPH 3OB0H 3VG9C 1N2RB 3UEZA 1J0YA 4KKCC 3CU1A 4N1EA 3IFOA 4WWKA 4ZS7H 4GW4A 4R0LB 5JW4Q 4HDIA 2ED9A 2GTZB 4NNYA 2VOTA 4HCRH 2IANE 4Z7OF 1N8ZA 2CMRL 5K9KB 2EH8H 4F7CB 4JFYB 3WDHA 5L6YH 4HW6A 4K7PY 4FMKA 3NTCL 3H7BB 4ISVB 5TF1H 1PG7W 4MB3A 3QG7H 3D2UB 5L2KE 3S88H 2OS7A 5CEZH 3O4LE 3DIFA 1DVFB 1ORSA 4LSTH 5IVZA 1ZLVH 3TZVC 1EFXB 2R4RH 3HR5A 4JM4H 3U9UA 5E9DB 1FNHA 2RB8A 5I1GH 4M7ZB 5GRJL 2KZWA 1CD8A 1W8OA 4PRAA 3U83A 1X4YA 1N6QL 2QADD 4F3FB 4O5LH 4UINH 5HGBB 4H26B 3UCRA 3QWOA 4F2MA 3IDNA 1FBIH 4JFDE 4OT1H 3BOVA 5J9PB 4I18B 3RZWA 5CLTA 5IVOA 5HHQA 1A4KB 2X4OA 4Z7WB 1CFVH 5F7EH 3OAZK 2DLFH 3FO2B 3OKKA 3L3DA 1K2DA 3C2SA 3DRTA 1BQHB 3MCKA 2KZ1B 3IFNH 5D7KE 4D9RE 2OSLB 3SGEI 5IVXE 1NDMB 5GZND 4LVNB 4KPHL 5I1DB 5C09A 1FO0L 3F62A 5TDNB 2F5BL 3W81A 2W60B 3VFVB 1FYTB 4YEEA 4P2OB 3A6CL 5DVNA 4P2QA 3SKOA 2DQTL 4C56E 1N64L 5HVHB 4RFNC 1U95A 3SKNA 1N5YH 4S1SL 2ITDA 2I27N 3WLBA 3F5WB 4ONOA 3ROLB 4F7PB 2UWEE 1IGTA 2OP4H 3UO1L 2NY6C 3OAZH 5JOPD 1CN4A 1OP9A 5FA3B 2C1OB 1HILB 2DBLH 1FH5L 1B9ZA 4OM0H 4LHUA 2YUWA 3GMQA 1LE5A 4EVNA 4OCWH 2LAAA 2WNGA 1KV3A 4H8WC 4E5XA 2AABH 1Z5LA 4IMKC 4JKWA 4PRIE 5E4EB 4XCCH 3S5LA 4Z76B 1JJUA 4PJEA 1REIA 1H3XA 2IAMB 5C8JB 4X9FA 3P77B 3MA9L 3GKWL 1O7VA 1K8IA 3HI1B 3OJDA 4XPBH 4UUJA 2P8LB 2YN5A 4IBLT 2HKFL 2Y7QB 4S0TD 4XNYL 3G6AA 2CO7B 2AEPL 2Y06H 2BNRA 3LKOB 4M4PA 1HHKB 1I7TB 4NT6A 3CLFL 4M7KL 5FCSH 2KQNA 4QY8A 4JFHD 4B7LA 1MCLA 3V0AC 2YEZA 4U0QB 3FQNA 2APWA 5I19L 4JFEB 5C9KA 5BRZD 2NY1C 2RR3A 4OUOA 4Y5VB 3ARGC 3MRJA 3B2UC 5CZXC 5HYSG 2VL4A 2ARJA 5FYKE 3SE3C 4GLRH 2IF7A 4PJHE 5C86A 1M7DB 3F7YB 1LNUB 2ZUTA 5MERA 3U2SA 4N5UA 2WBKA 4OCSL 1BOGB 3VRIB 3KPPA 1CFSA 2CDFB 1SQ2N 3DUHA 5KZCB 4RDQF 5C07D 3S9DB 2VITB 1XGRA 5AAWA 1G7MA 1CFBA 4QNPE 5F6IC 3UTQB 4EDXA 1FFOB 3L6FA 1F4AA 5KG9B 4PD4K 4G6FD 3ZDYF 3EJYD 4QRTA 1RZFH 5DLML 3S4SB 4YHML 4CVZB 2YMXH 3GI9L 1AXIB 1CF8L 1AD9B 3U46B 5C0RH 5HGAA 5CUSL 3V2AR 5ACLA 4Z0XB 5TDOB 5D96B 5TGBB 1BHGA 3FB8A 3IFPA 1HINL 4XC1L 5TQ0L 4ZFZA 4PRHB 3BKYH 5DUPL 3D48R 4M6AA 1NKOA 5LGJB 5D6CB 1JF1B 4IOIB 4ZS6D 3K4DA 3HAEB 3PWPB 2Q87A 3SHSA 2H45A 3JV4B 4R7DB 4QRSB 1CDCA 3G6JB 5JA9A 2Q8BL 3BZEA 1XZ0B 4OUUA 5ITFB 3KYKH 2EDYA 3NVQA 3NZHH 3CVHL 3UTTA 3ULUD 4JO1L 5EA0H 4C4KO 4YPGA 3BIKB 5IFJB 4BQBA 5JMOC 2P5WB 1GCFA 3H2WA 3MUGA 4LLUA 5I0DA 4CJ1A 2BSTB 4L8DA 5I1EL 4OV6F 3O0RL 4F8QA 4S1DC 1B90A 2HLAB 3QI9D 3VFOA 1TCRB 4ZG1A 1UYWL 3KPOB 3RHWK 4XP9H 1KXTB 1U8JA 4OLXH 2CRIA 5FYJL 5IEKB 4KROB 2R15A 1YYML 1IQWH 2F8XC 3SCMB 1UM5L 2JB6A 3FN0H 4F33A 3AY4C 4WEUD 5GZOC 4P2YA 2VR5A 3CAFA 3KPSE 5IW3A 2E7HA 4YE4L 1JFQL 3QEHA 2WSKA 3UX9B 2D2OA 2X2YA 1JZ4A 2B1HH 3WIFA 3KLHC 4P59H 4UILH 3OJMB 5DQJB 4P9ML 3B9KD 2QR0B 4NN6C 4PB9H 4YXKL 5L7XH 5CGYD 3HZVA 4X6CF 5CP3H 5D72L 3QDGA 5IVNA 4JFPA 3PWUB 5CGTA 3FONB 3W39B 5SWZE 1RJLA 2IFGA 3BX7C 4HMEA 4G6JL 1FSKB 3K2UH 2VLRA 1OARL 1PX3A 1UADC 2XFXA 3ZE2F 5DS8A 2V7HB 3WYRA 3FO9A 4J3TA 3QQ3B 4F58H 2Q3AA 2HJLB 1PY4A 4P4KB 4KY1L 1D5MA 2BC4B 4H25A 4X5LA 5IJVB 4DKEL 5E2VL 3GO1L 4PRBB 2AVGA 4Z95L 3AREB 3PP3K 3QPQD 1FNLA 4NQEA 4XNUL 3AMKA 3T0XA 3TBVB 4KVCH 1EZVX 5GGRY 1YPZB 3MJ7B 3NN8A 5TFSH 3QXDA 5AYQA 1T22B 2VLKE 3QP3A 4C57C 4NQCA 2YWYA 5F9OH 2WQ8A 1MCWM 1E4JA 1YMMA 2W1NA 2YD9A 1NGXB 4KK5C 2BSSB 3EYOB 3MRCB 1MFAL 4S1RH 2X40A 3RWJB 3PP3H 4LF3B 1X5HA 5I1HH 1FVCB 2EICA 4DTGL 1FNSH 3QQ9C 2B1AH 2XG4A 3EO9L 2XWJA 4QTHB 3TM6A 5C0AD 5T1KB 3WFBH 2OM5A 3TZVA 4XCFH 3VE0B 1MRCL 2WIMA 3BE1H 3D0VA 5IR1B 1A6PA 4OAWA 4FQXC 5D7IB 4JJ5A 3DI2B 4N0UB 4HDIB 4XPAL 4WUKH 3DVFA 4IIQC 5FECA 2PCPB 4LMQI 2DMKA 3B6SB 4JKPH 3IDGA 2HVKB 5FO9B 2GKIA 5SX5K 2GSIB 2NXYC 4HEME 4BFGA 3VXNA 3O6ML 2KPNA 3IDMA 3MV7E 1PVHA 3O8XB 3TBSB 2NY2C 5C0IB 3BW9A 3RVXD 5IIEB 2QBWA 4ELMB 3EOTH 4NWUH 5MI0C 1BP3B 4LVEA 3DRQA 5GS0H 4JM2D 3RNKA 4PJXE 2HFEB 2NY5C 5DURB 3MV8E 4M48L 2Q20A 2FO4A 5LXGL 2GQHA 5IBTH 3G5VA 5E6IC 4I77H 3V4UH 5SX5H 3ARZA 1U3HD 4QRUA 1OPGH 2R56L 1WSST 3QWOB 1KCVH 3SQBA 3VG0L 3WKMH 4YBQD 3WIIL 4Y4HC 2E7BA 5D1ZC 3ARFD 4KI1A 1KG0B 1SEQL 4L8BB 2VRAA 3D1MC 3FOMA 4PRNB 3C6LA 1SVCP 3I6GB 1T0MB 3DYOA 5DD3H 3L3GB 2X4OB 2B0SL 3Q1SH 1T1ZA 3BVNA 1AO7D 3DRTB 4F7MB 1LQSR 4AIZB 4CU8A 4YBLC 2VB5A 5DHXB 3ULVF 1T5XA 1H0DA 3B9AA 4AJ0A 2EC9T 1NMAL 3P9MB 5F89B 1MCFA 1M6OA 4NQDE 4XVJL 2VLME 1U95B 4HZAA 5IMKB 4D3CL 1OY3B 1ZGLA 5HHXH 4LARL 5AZ2L 2FEEL 3LEVH 3DURA 3ESVF 1ROWA 1WICA 3ARYA 4HK3J 1I3RB 3HMXH 4UDUA 1XMWA 3HFML 1NBVH 3RDTC 3W2DH 4JPIA 1HDMA 3QIWD 5CILH 2XN9E 3QXVA 1Z5LB 1ZK9A 4TRPH 5DEFB 5DEGB 4LSVH 2DL2A 5A3ID 4YDKH 4KZDL 1B2WH 1NFIB 2EC8A 1R3LA 2XACC 4MNQE 2FH8A 2Y36H 1NC2B 2H2PC 5FKPA 4NN7C 2D7QA 5EORH 5T3ZL 3OJDB 1S7WB 2VAAB 4UUJB 1KGCE 1TNNA 4QRRA 3T2NL 4GO6B 3GK8H 3VH8G 3SE3A 4OD2A 2XTJB 3OAUH 1X4ZA 5T1LB 2IGFL 4QHKI 3MXWL 1AE6L 4LSPL 2ARJQ 4Y4KD 4YQXL 4XB8A 5J6GB 4IJ3C 2EDKA 4I0PB 4U3HA 4X6FB 3VXMD 1Y0LB 4U6XB 1I4FB 4NOBA 2A6JB 1LVEA 5EOTB 1AR1C 4G42B 1SY6A 1J1OH 4HHAA 1YYLL 1U58B 1D5XA 4XGZA 2GT9B 4IRJB 1C5BL 3DARA 4NQTA 3TN0A 4OIAA 4OQTA 3REVB 3ULVC 1SYVA 3U2SB 2E6PA 3QFDA 1CIDA 3QDMA 1QRNE 4JN2B 3KPPB 1CFSB 5JXAH 1NAMB 4GG6E 3VXUA 2X5PA 4TOYH 4MQSB 4RZCB 4YZFF 2CSPA 1AXTH 1G7MB 5I1AA 1DLHB 3FAWA 1JGLH 3FZUD 3OXRB 4H8WH 3L6FB 1R3HB 4FOMA 5K59E 3SJVA 4QRTB 4GRMA 4OB5H 1F90H 5KJRL 3QWRA 5DVMA 3MC0A 3O4OB 5GS2D 1QVOA 4QXWA 3OZ9H 3W5NA 4YUEL 3MLWH 3QQ4B 5HGAB 2GK0A 2WINB 4K9EC 3W0WB 4K07A 1D6VL 2IAND 2DTMH 3QIUC 4BYHA 5CGMA 5F7MC 5CEZE 1KXQE 4FXKA 2CDGB 3JWOL 3VWJC 4UDTB 1LEGB 2FBJL 3GI8H 1IBGH 4DQOL 3LB6D 1XF4A 1DLFL 3F12B 4OUUB 5L2KD 3TA3D 5ICZB 5J8OA 3O4LD 2HTKC 2PF6A 2X1PA 1FQ9C 4TUOA 5E08L 3AY4A 4P9HC 4X4XA 4KJWC 2ZOLA 3OWEA 2B4CC 4NPYB 1LK3L 4K3DL 1JUFB 1J0HA 1UB5A 3GMMB 3C5ZB 2BDNH 2BXYA 4LIQH 1U2HA 3CXHK 4X9IA 4JFDD 4Q6IB 5B38A 2XWTB 3LAFA 2OZ4A 1UVQA 4LCCC 4U4BA 5DXWA 3CXDH 3V6FB 1SY6H 3GM8A 1D6EB 3NH7H 4BSJA 3GSUA 4F33B 2Z4QA 5ACZA 4NRXA 4OQTH 3RTQA 4HT1L 3G9AB 5FUCE 2EE6A 5I66A 1RU9L 4LCYA 5DMJB 2X4TB 3WIFB 3P4MA 5CD5C 3HNVL 4K7PX 4PJ9D 2NNAA 4RAVA 3HUJA 1WBYB 1M7XA 4YXHL 2OI9B 4CKVX 1BF2A 2COQA 4C56D 1GGIL 5JW4M 4UIKH 1F6AB 4WEBL 1JK8A 1GC1L 3WMSA 2DIBA 1GGCL 1RJLB 2CUMA 1I8LC 3MJ8A 4JO3L 3ZTNH 3MFGB 1D5ZA 3DROA 5JW3L 3OKOA 4IS6A 1G7HB 2XFXB 1R5WA 4GAFB 3RUGE 1MCCA 2CKBA 2DM4A 1NCTA 1HQRB 4D9LH 1KEGL 1SBSL 5TE7H 1K5NA 1D5MB 5DJ6A 4NC1C 2A2QT 5DJYA 1GXEA 4GAJL 1FAIH 1OSZA 1F4YL 3VD4A 4JCMA 4JFQA 2EIEA 4NQEB 3ZSSA 3V4VL 3IKCA 1I8KA 3STLA 5DD6B 2HKHH 4YH6A 3ILPA 4YDJA 3VG9B 3W11C 3NN8B 3GBML 3QXDB 4FQXA 4LSQH 4MNHA 1GGBL 2VLLB 4QT5A 1X4XA 2GEEA 3RWCB 2Q76A 5DT1H 4IIQA 4PJ7A 3CGTA 3MFFA 4PJDF 3GMOB 1MFEH 1MNUL 3BP5A 1MWAB 1UWGL 3GFUA 1J0KA 1Q9OB 3TYFA 3T3PE 2Q7YA 2ESVB 1A7NH 1NGWB 4G8GA 5F70A 4ZTPH 3ISWA 2ADJB 1IAKB 5H37G 1Z6JT 5SWQA 2UY6A 5FYKD 4KQ3H 4ZYKB 2OZ4H 3RPKA 5BXFA 3WLWC 5DK3