3SOBH

The structure of the first ywtd beta propeller domain of lrp6 in complex with a fab
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
227
structure length
222
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFTNSYIHWVRQAPGKGLEWVGWITPYGGYTNYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGSGHVNAVKNYGYVMDYWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/immune system
molecule keywords antibody light chain
publication title Wnt antagonists bind through a short peptide to the first beta-propeller domain of LRP5/6.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 222
sequence length 227
ec nomenclature
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sobH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sobH01
6CGTA 2JIXB 1ZLVK 5JLZB 2XA8H 4HG4K 4WI7A 1UQSB 2X41A 5BV7C 2EDLA 4L9LA 1J0HA 3MV8A 3IAQA 3CLFH 1UB5A 4I9WE 5DC9B 2CKBL 1VKXA 5GSRB 5ICXB 2O93L 4PRBA 5GHWH 1B0GB 1JCKA 5EORL 4ENEC 2JCCF 1JHLH 1XT5A 2XPGB 3TT1H 2FL5B 3O9WA 4PRDB 3HFML 3ARQA 3VFVB 1NC4D 4YHPB 3ARDA 1R3JA 3LZFH 4YZFE 4BJLA 2N56A 3U36A 5E2UL 3BJ91 4LARL 3T1WA 1T7YA 5C0CA 4BH8A 3QNYB 4URTB 1ES0A 4ZO6A 1SMOA 3VRLF 4KKBC 3ZKXB 4JREB 3U7YL 5B4MD 3FT2B 4PLKD 2NY4D 4W4OC 5BVPL 3BX7C 3RWHB 3MLXH 4YHKH 1S9VB 4PJFE 1S7UB 1OSZA 25C8L 5C9KA 1FHGA 3OF6D 4PUBH 5D1QC 1DE4A 1T5XB 3QG7H 5L2KD 4PJDF 4CADB 5JIIA 4XBEH 2VISA 4HPOH 4AT6B 4Q9RL 3MLZH 4KC3B 1DEDA 3W81A 5I66B 2XXMB 3GMOA 2F74A 4WO4D 3CH1A 2DQFA 5C3LD 3W5MA 1CXEA 5E6ZA 4H1LB 5ESAB 2ATPB 3EOTL 3U46B 2IAND 4U6YA 4CN4A 2YRZA 4PRNB 4F9LC 5MENB 1N4XL 3VD4A 4U1IA 2HFGH 4OV5B 3M17A 3MXVL 5C0RH 4X6CA 3KPSD 3WHXB 3MLYL 5J1AA 2ZOKA 2RJMA 1I9JL 2IQ9H 5K9QG 2VXUH 4RIRB 4U4BA 5DQJB 3DURA 1UACL 4KRLB 4P4RA 1F4YL 5J12C 2PW1B 3WEXB 4ZAKC 1I3GH 1JHKH 3BPOB 5D70L 5JO5B 5CGYD 4HJGB 1T80A 5CZVH 3AU1A 3ZHKA 1J8HA 3VW3L 1DBBL 1KNOB 4H0IA 1I1YA 1BFSA 4MA3A 4FP8H 3T0EE 4NQDA 4PTUB 3UJJL 4MNGE 5HYJD 2FRGP 3PXHA 1F58L 2A83A 4M93B 2YSSB 3O6FD 4D2NA 3FO9B 2WZPD 1C5BH 1ADQA 2JJSC 4JFFA 3QO0B 4E41B 1D9KC 2H2PD 1YNTA 1P9MA 1DUZA 5T3ZH 1IGML 4L8DA 3IDMB 1MHHB 5DVLA 2A6IA 5E8DL 3BWUC 1XCTA 3MPCA 1UM6H 4C4KO 5I1CL 1N6QH 2D03L 4PJ7A 5GGTH 3VXRD 4YWGL 2L7JA 4LHUD 4Q2ZA 2EDKA 4IRSA 5FF6B 3T3PE 5DMKB 1GJIA 1X4YA 4M9OA 4MYWB 2MMXA 3S7GA 1CGTA 2DM4A 3GO1H 1RK0A 2NY6C 2DJUA 3GUTA 2FX8L 3D87B 2DQHL 3B6SA 4F15C 2Q6WB 5DFVD 4G8EA 1FNEA 1HH6B 4OLEA 2UV3A 1HKLL 4GRWF 2BHZA 3OKLB 4W6YB 1MJ7L 2R69L 1ZOXA 1FV1A 1UJ3B 3CFEB 2EDOA 2ERJC 1TNMA 2LVCA 3FO0L 3L1OL 5GRWA 1I7RB 2WQ8A 1PX4A 1DSFL 5L88H 4MQ7A 4Q0XL 3QEQB 3VG9C 1XGTB 4HIJB 3VFWB 4JFPB 3BXNB 2GTZA 4AEIH 3F7QA 4PTTA 3WIFA 3REVB 4MMZC 5D2NE 5L9DL 4BQ6A 3TA3A 2PXYC 4QXTA 4YUEH 2JIXD 3AS0A 3JXAA 1ORQA 4MAUH 4ZTPL 3VH8B 5CBAB 1A1OA 3DECA 2AJUH 1IC1A 1E4XH 3SKUD 4DEPB 3DPBA 5CILH 4TNWK 1D5ZA 1TXKA 1XR8B 3X14B 2BC4B 3MROB 5JDSA 5MERB 3I6GA 4NDMB 5JORA 5AAMA 1PYWA 4N5ED 4WENB 4PJFF 3D3VB 2GTWA 2ENYA 3I02B 3UDWA 3JV6A 4L3EB 4JPVH 3WFBL 1CIUA 1IFHL 3GM8A 3FO1B 1DFBL 3DVGA 3GBNL 1CU4L 2YR3A 5CEZL 4YBQC 4TRPL 4GS7C 3OKOA 1YEFL 5EBMB 2A1WH 3C2AL 4NNPH 1C5CL 2XKNB 3ULVC 4QYOA 4HULB 1RZIB 5IMLB 3BFOA 4HAFA 3QDGE 4H0HB 3ZSTA 5C0EA 4Y5VB 4EI5A 4O2CA 4RGMC 3VA6A 1EO5A 4YE4L 1NMCC 4JFYA 1GGBL 3OJDB 1PX3A 4LLAA 2GEEA 2Z4QA 3QA3A 1CF8L 2EIDA 2P48B 2JJTA 3FB7A 4LLDB 5MEND 2EC9T 4NT6A 4NHUB 1BZ9A 3T2PA 2IADA 3ESVF 5JR1L 5GS2H 5EO0A 4H20L 4FTVE 2XRAL 1SBBA 3NPSB 5EZIL 5BS0E 3R0MA 4XXCA 5DRWB 4L3AA 4WHYG 5D72L 3O9WC 5IF0A 1WSST 4JG1H 2H1PH 2P8MB 3GSXA 3IVKA 3ARDC 2ESVB 4M43H 2J4WH 3FFCA 1HKFA 1D5BB 4TVPD 4OD2B 4RQQB 1BQHA 3CUPB 3LS4L 1NAKL 3NAAL 1OF2A 2IH1B 3OHXB 3KAAA 1JZ6A 5KJRH 2PYEB 4E41D 5HYIA 4K94C 4KXZH 5FYJD 1TQCB 1J1PH 5IB5A 1ZGLA 3F7YB 1QLFA 3EDFA 4ZUTA 1TTUA 4KHTL 1Y6MR 4X6EB 3HR6A 4OZ4A 1EEYB 1F3JA 1NGPH 3LEVH 2P5WE 4EDXB 4HAGA 4P9ML 3C87A 4GQ9H 1JNHB 4NQEB 2R15A 1CXIA 3FQXB 1N7MH 5C8JB 5DJ6A 1QRNB 2CIIB 3WJJC 1ND0A 1YY9C 5CD5C 4R26H 5FYKU 1CGVA 3L5JA 4KUCD 5IB4B 4I77L 1LE5A 1RHHA 1BAFH 3NZHL 3N9GH 3G08B 2XN9A 3HCVB 1BX2B 2XTLA 1FJ1B 2V7HA 1B90A 1GVIA 4RZCB 5GJTL 1UXSA 3C5JB 1F02I 4QXUH 3CNKA 3CFDA 2JF1A 5C0JA 5IVXF 4WFGE 4K7PL 4P5KB 1XGRB 3QEQD 2BNUB 2IBGA 3QUZD 2XNAA 4S10A 3WN5C 5EU3A 1CVSC 4Y19E 5D96C 1R0AH 4JHAH 4QHKI 2A6KB 4Q58C 3TIEB 3MODL 4OZIA 3HPJA 1AC6A 4XCFL 3ZO0A 4MS8C 4M62H 3AS2A 4KJWC 5CSZB 5IJKC 4CN1A 3FKUS 5HYSB 5ISZE 3Q6FA 5GJSL 2NNAA 2X7LA 3JSSA 1A9EA 5HYEA 1D6VH 4PJCE 4U1SB 5C0IB 3LN9A 4OQTH 1NCDL 4ZFFB 3NCFB 4IRSC 1U92B 1GC1L 1XF5B 2DQIL 4NM4H 4UBDC 5D8JH 4MZ3A 3FO2A 3DUSB 1QP1A 5CUSL 3IDIA 2X1QA 3UC0L 2FBJH 2IWGA 2XZQL 1WT5A 2DJSA 4YHLH 3D3VD 3SDYH 3DIFA 4L3ED 1UB6B 4G6KL 1JRHI 5C07E 2NXZC 1G6RB 1RK1B 4NZDA 4ZUVA 1L0YA 4PRHA 3KWWA 3O2DH 5E6IB 3UX9B 1Z3GL 4OZFG 1INEL 2HN7B 2NXYC 1CFTB 1OAYH 5F7YC 5ID1A 3DX9B 3HMWH 1KEGL 1IT9H 1IEBB 3MUGA 5BCAA 1CBVH 4OZGB 1X5LA 2OR7A 5EBGA 2FR4B 3IXTB 4I5BB 3LOWA 4D0BB 1KELL 2E27H 2BVOA 1DQQA 5KAQG 3D39A 1NBVH 1EHLH 3KYNA 1YC7A 3GSUA 4UU9B 3TA3C 1S7VA 3G5ZA 3C9NA 4NQCE 1BVLA 2H32H 3FZUD 3QBTB 4A6YA 3WFCL 1T21B 3ZKSD 5JOPD 2Q7YB 1HEZA 5E0QA 1UWEH 1JPGA 2AEQL 2GW5A 4M1CC 2FATL 5DHVB 4ZYKA 1T89A 2N7AA 1FFPB 2W92A 1I1RA 1PG7H 4AG4H 1MNUL 3IFPA 1NAMH 2H41A 1QOKA 3B9VA 3VFGH 5J9PA 4NNYA 1W0WA 4UIKH 3RA7L 5EZLB 4ZO7A 4QRPB 2A0LD 4J8RA 3QIUD 2ESVD 4XPBH 1L4IA 2ORBH 1RJZA 4ZFZA 3U82B 1ED3B 1FZKA 2BCKA 2JE8A 4HIEA 4Z7QE 4OLWH 5DMIL 3DHMA 4NRYA 3CFCH 3TBSA 4RAUA 2PYED 5GGRY 3FHAA 5HHQB 3G5YA 1FNLA 4BUGA 4G80A 3MCG1 3N1PC 1INQA 3KPLA 2HKFL 4HD9A 1FYTB 3VWKB 4Z78B 4YQXH 1R5WB 1IARB 4KMTL 5SX5H 3C5SA 3D9AL 3IDJA 5D7KE 5CINL 4M61A 1U8OB 4MA1C 1Y18B 1TETH 1FL3A 2ICES 3I2CL 2DQJH 4KTDL 5GGUA 4JM2B 1M6OA 4PRPB 1ZHKA 1XF2B 2VE6B 3V6OC 5A40E 1W0VB 2HVKA 5T3XE 4NQED 2Z8SA 4L3CB 4Q74A 4U7KA 1QRND 3E8UL 3GHEH 1JNNL 3AMLA 2WQRA 2EDHA 4Y4KC 4JO2H 2LU4A 4YBHA 2BJML 4HS8L 2J8HA 2NW2A 5I8EB 5B22A 2AEIT 3NZ8B 4JE4B 3MLUH 1FFOB 4N68A 2DF3A 1T1YA 4JEGB 4AQOA 4LQFL 3E6HA 4JR9H 3CCHB 5DMJB 2HT2C 3V0VA 1QSFB 2R2CA 3MRFB 4ODTH 4QRRE 5IESL 3OKMA 4D0DB 4UTAH 5MEQA 4GOSA 5I17A 4OZFH 4HDIA 3A67H 3UTQA 4HUUB 4OBRA 5IHZA 3MJ9L 5KVEL 4HXAL 1CGYA 1R3LA 5TFSH 3CDFA 2HFEA 3PWLB 3ZDZE 5GS1B 2GIYA 2ILLA 4DGVH 4QF1A 1GAFL 4JO1H 4PJCF 3FMGL 4P0DA 4M4PA 5E8EB 3REWB 2EEBA 4NZRH 1L7IH 4PB0L 3LPGA 5FDWB 3MCLL 3IKKA 2V2TB 1IQDA 4NWTH 5DR5L 4XH2B 4G6AD 1HN1A 2G9HA 1A7OH 2NPLX 3KYAA 1LK3H 2P46B 4GMSL 3FQUA 4PJ9C 1YEKL 3CFIC 3DHJA 3NACL 2IPUG 2AAVA 3HI1B 4ZFOA 2EIEA 3HRZB 5TF1H 1CQYA 4D0CB 1L7TL 1NBZA 3JV5A 3WV0A 3N0PB 2ZUUA 3MLWL 5DUBB 4X9FA 2DQEL 3IFLH 3UP1A 4WHTB 4D9RD 5BV7H 1V7ML 2DBLH 3H0TA 5A1AA 5IR1A 2GSIA 1W8OA 3PP4L 1U8JB 2BERA 4PJGA 1T4KA 2DYPB 5JXEA 5EA0H 1LEGA 5D6DA 2W9LA 3MTRA 4HPYH 1WFTA 4C56B 1KCVL 1W0YT 4FFWC 1TIUA 1XIWB 1Q9OB 4JZNA 4HKJA 3GSWA 4ZUSB 2QR0A 3V2AR 3PNWB 3T0WA 3WDIA 3L7FA 3HG1E 5H37G 2VQUA 4PJEE 4MCYB 3G6JB 4NCC2 4I48B 3BIAX 1IC5L 2IFFL 3OKYA 3QQ3B 4FQ2H 4P2QA 1E6OL 3TO4A 4Y7MA 3SDCA 4ZOBA 3EYUL 4JFQA 2IBBA 3OXRB 1QFHA 3LQZA 3ZE2F 1H3PL 1PSKL 1MJJA 1SYVA 1GZPB 4GAYA 4R90H 3DSFH 1FLTX 5FEBA 5FUZL 5ACMA 5IVZA 2XQYG 3KPQB 3RFZC 4A2MA 2OMNA 4JRYA 1QSEB 5DWUL 5JIKA 4X4YA 4JO4H 3DNKA 3T4AA 3WIHA 2IG2L 4X80H 4QRPD 4XNZB 5E8PA 1KJ2A 3ROLA 4LP4A 4JQVA 5ANME 3BWAA 1XGPA 5EPMB 1H3GA 4JVPA 1OP3K 4AH2B 2V6HA 4G8GE 2HH0L 1XR9A 4XAKE 4HIHA 1B0RB 4BELD 2F5BH 1JF6A 4QCIB 2E7LA 2Z93A 5F71A 3VWKD 1FYTD 3HUJB 5EULV 5CBEA 1HDMB 4YO0A 5F1SA 1IMHC 3SKNB 1I3UA 4KROC 3QUML 4OCNC 1CFNA 4HUKB 5GGVL 2D7OA 4ETQA 4NO2B 4PG2A 1I9IL 3I75A 1YYML 2FEEL 2Y5TB 3V7AG 3DX8B 4IMKA 4NKMB 3KDMA 4OF3A 3L5IA 3HE7A 2HJKB 2QQQA 1SJHB 3C08L 5JHDA 1QVOA 3OGCB 5F89A 5FYLD 1T89C 3BIKA 1F42A 5CD3A 3WCYA 2EC8A 2PO6B 3U2SB 4JFEA 4LCUA 1AJ7L 4J12A 1J1XH 5E8NB 3O3EB 4F80A 4AZ8A 5F3HB 1QSFD 3QDGA 5B21A 2F8OA 5B8CA 3PGFL 1PGRB 3OKEA 2VOTA 2DQDH 2WSKA 1FIEA 1FZJA 4HGWB 3RGVB 2I9TB 2R23A 1BF2A 2W0FA 5DMGC 3RVTC 5IQ7H 1KIRB 1ZLUK 3C8KA 5B38B 2AJXH 1NDGA 1GPOL 3CX5K 2OSLA 4U49A 1T1WA 1KOAA 2ZPKH 5DYOA 1NJ9B 4OT1L 1LNUB 5H37H 4BFIB 3OPZH 4MA7L 2HRPL 1KSRA 4HC1A 2BMKB 4DFIA 3LS5L 3BP6A 2I5YL 1HOCB 1YEIL 4KK8C 3QPQC 1G9ML 2Z31D 3STZB 4LPWA 2Q87A 4NO5B 4HIXH 1K4CA 5AZ2H 3FOLA 3E3QE 4HHAA 1U8MA 4EN3C 5D1XB 1S3KL 4U1JA 2OTWB 2GI7A 2BRRH 3DXAB 4HQQL 4FFVC 3BRFA 3WUWB 1SBSH 1KG0A 4L1DA 3BSZL 5M94B 3AB0B 43C9A 1T0NA 2C1PA 3L3OA 1G1CA 1IL1B 4LRIC 5TPWL 3NPZB 2DYPD 5ICYA 3SE9L 5ESVB 3L3HB 4JZJB 3GSQB 5I8KH 2DQGH 4PJEF 4FQIH 4C56D 3SGJA 1GOGA 1H0DA 5I9QC 4JB9H 4Y4FB 3DTXB 3RNKA 5HI5C 4L8CB 4OLYH 1XIWD 3LDBC 4I3RL 4RDQF 3OAYH 2WP3T 3VGAC 3MLTB 1AHWA 1EO7A 3SO3B 3SDDB 3QDMB 1MH5A 1MFDL 3VFSB 3EHBD 5EORH 1IKNC 5DHYB 1AQKH 3LIZH 4XGZA 4G43B 4OIBA 1CQKA 3FQTB 4GJTB 1R24B 1W72B 2FNBA 4LSVL 4P23B 4YEFA 3OKNA 5I1JL 3WNOA 1EBAA 1J7VR 2FX9L 3LKQB 3O8XB 3VI4E 5CLTA 4G7YL 1AFVL 3ULVH 4MJIE 4YFDB 2VAJA 3W5NA 4GRMB 3PE9A 4MA8H 2XKUA 1SYSA 3ZYOA 4UILL 3P40A 5C0AE 4ONFH 3D6GA 2Y7QA 1F6FB 2XI9A 1NCWH 4PS4L 1QSED 4GW4B 3BGAA 1I4FA 2I07B 3OR6A 2IAMB 3T0EC 1T04B 4N0UE 1ZA3A 4Y2DD 4P5MB 5TE7H 1JI1A 4WW2A 3BPLC 1MOEA 1ORSA 1G7LB 1AD9A 5F1IA 5JXEC 5D6DC 2GT9B 2A77L 3ZE1E 1I7TA 1E4WH 3LRHA 4WI3A 3ES6B 1NMBL 3Q6GL 3O2WL 4MQTB 4W6XB 1BF8A 1F13A 3DI3B 3H6JA 2BNQE 5MEPB 5TDPB 3O3BA 4PJCA 3O4LE 3GB7A 3QPXH 2B1HL 4LRNL 4B41A 3TO2B 1A2YA 5JUEL 2YS4A 3QULA 2ADGB 3TO4C 3LB6D 3RKDC 4XMPH 4FFZH 1H3TA 1U8KA 1KGCD 3LKSA 1OB1A 5C07A 4K94H 3VXPA 2CDEB 3RJQB 3BAEL 3BPNB 1RZFL 4KV5E 3O45B 4JFZL 2OMBA 2JB6B 5HHXL 3ARTA 2PO6D 1Q8MA 1QA9A 1QR1A 4LCWA 1LHZA 32C2A 4N0CD 4WGVB 1S9WB 2R9HD 2ICWJ 3B3IA 3ZTNL 1A7PL 4O51B 2ZSWA 3KPRE 3QFJB 5C0FA 4YHML 1A6WL 3S88H 1HQ4B 2I25N 1IGMH 5D5ME 3QIWB 3RWIB 2HJFB 1KB5L 4IDJH 3BYYA 5DJAB 3QEHA 3RGVD 4JQVC 2XWBB 2F53B 3F12A 5GRJL 2D03H 5FO9A 1N3NB 4IOIB 5D2NC 4IMLB 1B6UA 4R97B 2VLRD 2DWEB 4Y89A 4DQOH 4F2MA 3GNML 2E7LC 2WWKO 4HWZA 1AI1L 2V2XA 4JY6B 4HEPG 1WIUA 3HMXA 4TNVK 4M7LH 2Z9TA 1MHCA 2ZUVA 4XMLH 5DD3H 1CGSH 4TULH 5C08A 4FZ8H 3IKCA 4HCRH 1QO3B 1IGJB 2IF7A 3V7MA 2WINB 4DZ8A 1INDH 3X3GH 2R1WA 3FL7A 3HE7C 5D1XD 2P5EE 1ADQH 3MNZB 5D7IE 3DXAD 1A02N 3L1OH 4XC3L 1IKFH 3CSYB 1QBML 1F90L 3FONB 1DQLL 4GBXB 1UH2A 1H15A 1KCKA 4G5ZH 5EO1B 1TITA 3NA4A 1U95B 1QKZH 4JVUA 1DUYA 1NFDE 3GM0A 4XVUD 2DLFH 5IMMA 3CJJA 1KTRL 2AK4A 1I3RB 4X7DC 2RAMA 5B8CC 4DVBA 5I1LB 2UZIL 2KBGA 2EIZA 4Y4FD 3VI4F 2MNUA 1UVQB 3IGAA 3MNWB 2RFXB 3CVIL 4Q9CA 3GIVA 3O2VL 1GGCL 2XICA 5IBLD 1FL6B 5E95B 3SDDD 2YK1H 2FIKA 2F54B 4LGPB 1E6JL 1N0XL 5FOBA 2EH8L 4PGBA 1X6LA 1VDGA 5E6YA 4P23D 4KKCC 4K3DH 1X5JA 4ZPTA 4Z0XB 3O8XD 1KPRA 3MRNB 4DTGL 3MOAL 4LKCB 1RU9H 2CKBA 1BQHG 1WEJH 5TGBA 4NJAL 3T08A 3AM8C 4AENB 2FECI 3MV7B 5C2UB 1WBZB 4M6MH 3HHRB 4ELME 1T0MA 3DV4A 1U93B 3KXFA 4LSTL 4CNIB 3LKNA 1IGTB 3ZE1F 4B7LA 2IAMD 4RAHA 4R7DA 3WNNA 1FE8H 3GI8H 1EXUA 1MWAA 4C55A 2NR6C 3SGKC 2XZCL 3IAPA 1LO5B 4XPFH 1MSPA 2BVQB 2NTFB 3QUKB 4LVNB 1NLBH 4PJXE 5FFLA 2YZ1A 4KI5E 5DF0A 1Z0NA 1OAQL 3E6FB 5ACZB 1BGXH 3M1BB 1LK2A 3SGJC 3D2UB 3QDJB 5HBBA 1D3CA 3W0WA 2R0KL 5IMOA 3L3JB 1RIVL 4MB4A 3ARBC 1J8KA 2GK0B 3IYLW 5E99H 5CGMA 3I6KB 4TVPL 4Q6IA 5TJWK 4JVWA 1MQ8A 4KV5F 3ZL4L 5JA9A 3PHQA 2W60B 4QRQA 4YEEA 4N1CA 4OFYA 4AK1A 1MIMH 3QFDA 2BOCB 2AABL 4D9LH 5FYJL 1JUFA 2BSRA 3ARGC 3RAJH 5I71C 1AGEA 4NWUL 4X4ZA 1ZEAL 1MQKL 4P99A 1WC7B 5D5MF 4H5SB 4Y1AE 4OUOA 3BN9C 4GAJL 3G5XB 5EO9B 4AMKL 3ORJA 3PWPB 3R1GH 3IETA 2DD8L 3SQBA 3NFNB 4X98A 4L8BA 4K23L 3VXMB 2Z0BA 5F7LB 4UT6H 3QFJD 4OLXL 4RWHA 3B5HA 3QIWD 5L0QC 1YN6A 1AXSB 1D5MB 4LMQE 3OR7A 2P8LB 2LU3A 1HZHH 1F4WL 2F53D 5CJOL 4DGYL 3HG1A 3V8OA 5JZ7C 3GIZL 3P0VH 4M7JL 4RISL 4XNQB 3U0PA 5IWLA 2FD6L 2R8SH 3O11A 4G6JH 4QT5A 3KJ4B 3B8SA 5DDHA 1AR2A 2R1YB 4IOFD 4PREA 5D7IF 5DRZA 3VRIA 1FZMB 4CU6A 1DVFB 1NH6A 2XQBL 4Q97A 2VO5A 1IAIM 1BEYL 5EOQH 3KYKL 4OKVA 2V5RA 4ETYA 3F5WA 4Q6YA 2GAZA 4POZC 1T66C 4IEFB 1NFDF 1FBIL 5BMFL 5F6HJ 1G7MB 4XZUB 1OGTB 2LAGB 1VACB 4ONGL 1JF5A 2YD5A 1ETZB 5LQBH 5JHLH 4XPHH 5F88B 3OG4B 1YNLL 3HNTL 1CLCA 3P4NA 1BMGA 3WIIL 5MI0B 2WBJC 3ARSA 4GBXD 4PRIB 1A7NH 3LRGA 1MCOH 2DIBA 3VXNB 3AS1A 3EYVB 4XNYH 1FRGH 1IGCL 2VWEE 3MREA 3QQ9C 1JV5A 2BFVH 3NOIA 4GSDH 4TQEL 3RRQA 5FYKE 4YDLB 2X4QB 3QRFM 1ROWA 5KZCB 1AIFA 4JFDE 4UQ2B 4M3JA 1CE6A 4G42A 3HZKA 4DVRH 4HFWA 2NY2C 2K1MA 1F11B 1KB9K 1S7QA 1YN7B 3B2UD 1NCTA 3L9RA 5IEKB 1NGWB 2F54D 4JZOB 4BZ2H 2P47B 3UAJC 4ELMF 4HJJL 2BHUA 1I8IB 5KS9B 1ZT1A 1Q9LB 2QLVB 5DJ2A 5IIEB 4FXGB 3K80A 4P2OB 1F4XH 4NZUL 5EU6E 4RX4A 1JL8A 4R4FH 5LXGH 2X9WA 4RGOH 3R8QA 3MV7D 5AYQA 4P59H 5T1DL 1OPGL 3VFUB 1E4XI 4HGMA 1MIEL 3PGDA 3SCMB 4ZS7H 4PJXF 4KI5F 2DOCA 1IAOB 3G04A 3RDTA 1KEGH 5SWSE 3WO3B 1TVBB 5FB8A 3CVHL 2E7BA 3L3DB 1DN2A 4UV4H 2BNRE 1T22A 4M02A 4LKXB 2I60H 1A6ZB 4S0SD 4JDTL 5JMOC 4FFYH 5T3ZD 4XVTL 3RL1B 1RUAH 4LL9A 3D2UD 3H3BC 3QDJD 4X0KA 3V4PL 5BXFA 5BQ7A 5JW4R 3ZKMC 4A2LA 3WLWC 4XCYA 1EUTA 2W0KA 4ZUUB 4LOUD 3X11A 2MTPA 3RQ3A 5DJYB 3EOYG 4P9HC 1YEGL 1RUML 2H45A 3L3IB 3U7WL 4WFFD 3ULSB 3BEWB 4XHJD 4FQJL 2X5PA 2IPKB 1A6PA 5AYUH 1I8MB 4LSQH 4MVBC 3QSKB 3MRKB 5ETUA 5DD0H 4UV7L 2WWMC 3P4MB 3TPKA 5JIHA 3MA9L 1UKQA 3IB4A 3NFSH 1ZT4B 3N1GC 3MCKB 1S7TB 1S9XB 3PWPD 1MJ8H 3KLAA 4JHZA 1JRHL 4D9QE 1IQWH 3GGWB 5DVNA 4ODSH 4L9DA 3WNMA 3EW3B 2XG5A 3VFOB 4OCWH 5CLWA 4O58L 3VXMD 1S7WA 5ERWB 3JTTB 2VYRE 1FG2A 1DQMH 4LLUA 4YXKL 1KLGA 3FQWA 4A6YH 3I2CH 2UVEA 3JWOL 4HH9A 4JPIB 4Z6AT 2APVA 1HHIA 2J1KA 3MRGA 4U6HA 4TTGA 4MCZB 4PG9B 3PQYB 4UB0H 5AEAA 5DK0B 1UWXH 4N1HB 1LWRA 1UFUA 4MJIA 4F8TA 5TDNA 1Z9SA 4NN7B 1HHGB 3OV6A 5DJZB 3A6CH 4PPTA 5SWQA 3IU4H 4GKSA 4M5ZL 5I2IA 4ZPVA 1DVFD 4KRMB 3UBXA 1LEIA 4KXZI 5IHLB 3L95B 5EOCH 3IJHA 1KIQB 4GAFB 4Q6IC 5D9SB 1AP2A 4OKDA 1JGDB 2YEZB 1QFWH 2Q86B 5IHUH 3S4SB 8FABB 1BD2B 3QXDA 3UPCA 3VD5A 3ARXA 1JTPA 3BQUA 3V5DB 3U9UB 4MNHA 3LKPA 5D1ZB 1ZV5A 2J8UB 3RWDA 4JRWA 4N0UA 4CMMB 4Z7NF 5CWSA 1T03H 3VFTB 3MOBH 4WUKL 1QFUH 2EDRA 4PRID 4U1KA 4WUUE 2UWEE 3VXQA 4DK6A 5FUCE 4OF8A 3EGSA 3RWJA 2FYYA 2Y06H 2VXQL 3SOBH 3OZ9L 3QJFA 3G6DH 1JGUL 3C6SA 4O5LH 1ZHNA 3JV4A 1HHHB 5KZCD 3W39A 2AJ3A 1TFHA 5DK2A 2Y6SD 3O0RH 3LQAL 4NM8L 5AG8A 1D6EA 1MHEB 2R0LH 3EYSH 4WDIB 5CJBA 4V2CB 3VD7A 4JQXC 5EUOE 4PJBE 4G9FD 3BW9A 5JPMB 3UZEA 2NW3A 5I1KL 3SY0A 1G7HA 4R0LB 5GS2D 3EKCA 3GJFK 3P9MA 5AD0A 2HA1A 1K5NB 1J18A 2APTA 1CL7H 1KJMB 4LCYA 1MLBB 5SV4A 2MHAA 1A7RL 3SQOH 1L9NA 4P2OD 1NAMB 5C09E 4XP1H 3HAEH 3OJVC 4KJQD 3UYRH 2B20A 1P2CA 2UVFA 5EOCJ 2O5ZH 2XY1A 3PP4H 1KEML 4UDTB 1RURH 1TCRB 2P7TB 4BQ8A 3KPRA 3FQRB 1XF1A 1CGWA 3SCMD 4JJHA 5K9KA 5GGSB 2C3VB 3VXSB 4ALAL 5C92A 3ZYJA 5DC4B 3VI3F 5F3BA 3Q2CA 4NQXA 4OSUL 1KPVA 1PJ9A 5JOFB 1S5HB 2VDRL 4WFEE 2X44D 4OZHF 4L5FH 4OCSH 3U30B 3MRDA 4O9HH 4FQCL 2NY5C 1YMMB 3PL6B 4JN1H 1YPZB 4XMKH 1G7JA 1PG7X 1ZWIA 4APQC 3BE1H 2LABA 1JTOA 3C60A 1IC5H 1DQJA 4JFHD 5HY9B 2JKXA 1DBAL 2BSSB 3NA9H 1DJSA 2QQLL 4YNYB 4X6BB 5CJQH 1BREA 3S96A 4NBYB 5I1IH 2EYSB 2MKWA 4ONHA 2VDPH 3DETC 4JDVA 4OB5L 2QQKL 1SJVA 1QPXA 1OT1A 4M6OH 3DI2B 4MDIB 4XNMB 3T2NL 4Y5YC 3O41B 4C4KT 2Q76B 4HS6B 1VADA 5T1KA 5ABDE 4WW1A 5KSVB 4UIMA 5D7LE 4Y5XA 1OTUC 4JANA 3KYMA 4LVEA 3QHZH 4OZFB 3P0YL 4F3FB 1HHJB 1FSKB 4S1DD 2JJWA 5DD1H 5KSAA 2AJYH 2AJSL 1WZKA 4RGNB 3RDTC 1C16B 3E1F1 1Q72H 4G9DA 1OWRM 1S5IH 5EB9A 4NQVA 3RWEA 4CVZA 4PJAA 2ZG3A 5HYQB 1Q9WB 5EU4A 5ITBL 1FAIL 4CDGC 2FB4H 3RWCA 3BGFB 3EOAB 1NL0L 1BP3B 1CDGA 5HHOA 3TZVA 3PQYD 2GQHA 4P2CG 3FRUB 1C1EL 5SWZE 2G60L 1BVZA 2DLHA 4H88H 2VZSA 4K07A 4KDTC 4BH7A 3QIBB 4NO0B 2QEJA 4CW1A 1CDCA 1SY6L 5DQDL 3IF1A 1KF9B 1KJ2H 3QO1B 2IMNA 3E3QC 2UWEF 5BVJB 5E4EC 4N9OB 1BD2D 3M8OL 5ALCH 3PHOA 3SDAC 2E8YA 2WLYA 1IAIL 5EOTA 5DUML 3P9LB 4JQIL 3MJ7A 3QISA 4U0RB 4XXDA 3BP5B 3Q5OA 4TPRL 2IALA 3RUGB 4PJXA 1FC2D 2DS4A 2VH5L 2H3NB 3WNPA 4Z76B 4PJHF 1ONQA 3H2WA 5EUOF 2VLKB 4YHZL 4LSRH 2AKRB 4H8WL 3GMMB 2VDNH 1JYVA 1ZANL 2CSPA 2VZVA 2XZAL 1I1FB 3MJ9A 1QHPA 5HHVL 3PJSB 4U1NA 1QD0A 3U4EA 1RZKL 4LPVA 3H42L 4HXBH 4OM1L 4F7MB 2VIRA 4QGYA 4XBGA 4N0FB 4PYHA 4U3CA 2X4SB 1FGVL 2EDYA 1KTDB 3ZHLA 2XYCA 1NGZA 3TYGL 4ZFGL 2EXWD 1TNNA 3HE6C 3RP1A 5I1HL 4L4TB 5ILTH 5DHXB 3BSZH 3CLEH 5DZNA 3MV11 3V52H 1KACB 4ODXB 1X6NA 2ZCKL 2EECA 3VXUA 4PJIE 4HKBA 3QDHA 5DSCA 1CR9L 3JVGA 2X70B 5F9OL 3E0GA 4QHNA 3VXSD 2QBWA 1FIGL 4B5EA 4XNXL 1EV2E 1FPTL 3DARA 3NIFE 5FGBC 4PV8B 5KVDH 4NBZB 2F58L 3EO0B 1NKOA 4HC1H 4X4MA 2FX7L 4YR6B 2B8OT 4J1UB 2W1NA 4PLNC 5J12B 1YMMD 3PL6D 4HUVB 1IEHA 4IOSD 3GSOA 2DM2A 2VXSL 4EOWH 3PGCA 3X17A 4I4WB 5D2LB 2FO1A 3G6AB 4FNLH 4U1HB 2OTPA 4WV1A 5FHBH 4RMQA 1A7QL 3OAZK 2C1OB 3J7HA 3IDNB 2R4RL 4LF3A 5CZXC 2CIKB 4GUPB 2K7PA 1D9KB 2ADJB 4LASL 4DN3H 4Z18A 1MCEA 4F7TA 5LKNA 5F7DB 1S7SA 3QWRA 3OB0H 6FABH 2OK0H 4NNXB 4QRSB 5HGAB 3BPCB 1RVFL 2IBZY 1EFXA 4LSUH 1FDLH 4R7NA 5IROC 1XMWA 3DUUA 1SEQH 5F7UA 4X6FA 1J5OL 4JFDA 1OP5K 1KYOJ 2AXHA 3QXAA 4RGND 4YDIL 3B4NA 3O2WH 1FORH 2GFBB 3KYOA 4RNRA 2EO9A 3H9HA 1DL7L 4YFLI 4OJFL 2YMXH 1QQDA 2NQCA 4KK6C 3MGOB 2Y07H 4ZXBB 4LIQL 4DK3A 2EICA 4AQ1B 4QRTA 1ZLUH 1VGEH 3MGTB 1ZE3C 3WXWL 3MRCB 3DGGB 4AM0A 1V5JA 3C60C 1EDQA 2M8XA 3U79A 2FSEA 5KSBA 2H8PB 2J6EA 2VJXA 5FCUL 3RIAF 3VG9B 3WFHA 3GSNB 3HZVA 4JRXE 3QIBD 3QUMA 4NO0D 3G5VB 4KTYA 1H8SA 1TTGA 2EKSB 3IJYA 3MXWL 3SPVB 2DMKA 4JJ5B 4BZ1L 3OX8A 1U3JA 5SWSA 3D85B 3QNXA 4M9PA 5E5MB 1KT2A 1A6WH 2MCPH 1LEKA 3EDDA 5LCVL 4D8PB 3CFJB 5KSUB 3S35H 4Y5XC 1CLOH 4V1DB 4N8VA 3QH3B 4Y16B 5CCKH 3MYJB 4ENED 4EVNA 5IGXH 4DZBB 3QUXC 3PABA 1OL0A 5HHNB 4P2YA 4P3DA 2VLKD 4ZS6C 1Z5LB 5BRZA 1RIHL 2DWDB 5KSAC 3SGEH 3VFMB 2RB8A 4LU5L 4DW2L 3U4BH 3H9SD 3VRJB 4UT9L 4EDWH 5F7EH 4K2UH 5MP6L 3MLSL 3ARFA 4BSVB 1MLCA 3TNNB 4JDZA 4KKBD 1S7XA 4RWYL 2CDFA 3BI9X 4FQLH 1UENA 2GY5A 4PJIF 3K74B 3HC0B 5DD5H 3P0GB 5D1QD 4LNRB 1TJHL 1KJ3H 5I15L 1QBMH 2ICWB 2C7UA 4L4TD 3HNSH 4RGMB 3NIFF 1DANT 4GKZB 3QYCA 4MQSB 4EUPA 4XCNA 3CX2A 3CDGB 1SHMA 2AXFB 4P4KA 1JWMB 5DFWH 4L4VD 3QEUA 1LE9A 1MPAL 5EIIA 2EC9U 1P4BH 4NO3A 4TSCL 3C6LB 3K2UL 1CFSA 3K8LA 4PBXA 3MV8B 3QAZB 5E08H 3NABH 3P4OB 1U6AH 2D31B 4HKXA 1UB5B 2C9AA 2X4OB 2Y36H 2PR4H 5FOJA 3U0WL 4KI5C 3AXLB 5FO8B 1JWUB 1MFAH 3MRMA 1PD6A 3U0TA 2A74B 1MELA 3DROA 4U1MB 5H94B 5T5FL 3NFPB 4K8RL 1NC4A 3TN0A 3X13B 3TPUA 3ROOA 4N0YL 4DKAA 1F3RB 3OG6B 1WTLA 5IFJA 1W2KT 4TUJA 4I2XA 5E9DD 5E2VL 3RNQA 1JYWA 4ZSOA 1D9KD 4BSWA 2GJ6E 3BKJL 1TJIL 5ENWA 2B0SH 3HPLB 1DN0A 1UZ8A 4U6TA 1MCCA 4AIZA 2CKNA 4CVXB 2DKMA 5HVHC 3OF6A 4M00A 1OAXH 5ICZA 1I1AC 4RFNB 1F00I 1SEBA 2IQAB 2WIIA 5EFIB 5L2KA 3GMOB 4I18C 2CLZB 4M5YL 1OY3B 5F9JA 1VFBB 2UY6A 5I1DB 1IEAB 4N8CH 2DICA 4P9HH 4PRAB 4BZYA 3TLRA 4KGJA 4BK5A 3DVIA 2ZUYA 3JVGC 4G6ML 2KQMA 5T3XH 1KUMA 2NZ9C 3H7BA 1H5BA 3VMPA 1Q9KB 5LG1A 2NY6D 2X4PB 2IANA 2ICWI 4G3YH 4F58L 3OKDB 3T77B 1U9KA 4HS3A 4JO3H 2IBZX 3M07A 3BKYH 2J3SA 2OLDA 4PJBA 4XRCA 1UJTA 4YPJA 3KPSA 5IMKA 3UTZB 1U8NB 4ZXBD 1OGAD 3X12A 1KCUL 2HVJB 1PVHA 3NTCL 3IDXL 1JTTA 2OL3A 5DUPH 5K9JH 3PV6B 3RY6A 2YD7A 1J8HB 4X99A 4XP5H 4KHXH 1AKJA 1T7VA 5DXWA 4QTIH 5D7JA 1ZEAH 3RIFF 3R06A 4KKLC 1BBDH 3WN5B 5HYJA 3OKKB 4GAJH 4MJ6B 2CUHA 1MWAH 3O6FA 3QCUH 4CBPA 3AGVA 4LLVA 1IGYA 2XA8L 2FECL 4LLWA 2R0WH 1M05B 1AC0A 3TCXA 2APXA 2Z92A 3F8UB 1SM3H 4F37F 3CLFL 4AIOA 3KNBB 5IVOA 3Q48A 4DCQB 2WLZA 5L8KB 2BVTA 4R4BB 2VWEC 2A73A 1X4ZA 4Q2ZB 2G5BA 3D25B 3RI5F 4V1DD 3VXRA 3MNVA 3PWJB 3I3BA 1MEXH 4Y16D 4LHUA 2DQCH 4GAGH 3TT1L 1D5XB 3MBEB 5I8CB 1DQDH 4KK9C 3LZFL 2AK1H 3SKOA 2E6QA 4LNVA 1L0QA 3OMZA 1PKQB 3QNZB 4GG8B 4JAMB 4NYLA 3BZEA 2NXZB 3VCLB 3G9AB 4OGAC 4YBQD 4LHQB 3V5KB 5DO2D 1BECA 2R2HB 3MLXL 5IW3A 2DIJA 35C8L 4YHKL 3AVEA 3JWDL 2Y72A 4HUXB 2VQ1A 4NQSA 3ULVD 1KLUB 3BUYA 4Y0GA 4NFDA 4E5XB 4PUBL 4KJPC 4G8IA 1EAPB 3QG7L 2KL6A 4XBEL 5HGDA 4HPOL 3MRHB 3VDCA 1FVCA 3MLZL 1F8TH 1WGOA 1N5AB 4PY8J 1LP9A 2GTZB 3PV7A 2IPTH 2VLJB 4NCC1 3TGXA 1MFCH 3L6FA 4KUZH 2O61B 3TA3B 1KV3A 5JPNB 3C8DA 2HFGL 3QCTH 5C0RL 2JIXA 3MV8D 1MRDH 5D93B 1A4JB 1UQSA 1JNJA 2X1PA 4O2FB 3BDYH 1FYTE 2VXUL 4UUJB 3TVMC 1KLFA 3B9DA 3TCLB 5GSRA 5ICXA 5CSGA 4F8QA 1I3GL 1JHKL 2P8PB 3O3UN 5SWZA 5CZVL 5L6YH 1IM9B 2CPCA 3EZJB 3TBWA 3O9WD 2OQJB 5L7XH 1UGNA 5E5RB 3PWUB 4FP8L 4PRPE 4NKIH 2XPGA 5JORB 2FL5A 4PRDA 4PBWD 5J56B 4JG0H 5MHSE 3TH2T 1H3UA 1LO0H 1C5BL 1LO2H 1MCQA 2X4RB 3OAUH 4NZUH 3ARFC 2W59A 3A6OA 4RFOH 3QNYA 2IEPA 1RHFA 3AREB 2BVUA 1LD9B 4E0RB 3EFFB 5T3ZL 1YJDC 3F7RA 2E7CA 3FT2A 2X4NB 1EEZA 2YPLB 3ELAT 1UM6L 3ECBB 2NY5H 1JYNA 3RWHA 2VQTA 1N6QL 3V6FB 1S9VA 3AY4A 5C0EB 4MA1B 1T20B 1S7UA 1U3ZA 1DDHB 4PP2B 3CVHH 1J87A 4LPUA 1ZA6B 3K4AA 4Z7VB 3PDOB 4JCMA 5C9JB 2VXVH 4AT6A 5I66A 4P4KC 1U8QB 3QXVA 5GRVK 1C7SA 2E7HA 4X7TA 2W65A 3GO1L 4S2SB 4R2GC 3ZSSA 4Y4KB 1YY9D 4H1LA 5ESAA 3RHWK 3D69B 3U46A 5CD5D 3WNLA 5MENA 4PRNA 1BZ9B 1OAUH 4GT7A 3UBXG 3QUYC 1HSBB 2YWZA 2E9BA 4OV5A 3F7VB 3WHXA 1AO7B 4MNQE 5GS0C 1RUMH 4RIRA 3EDJA 3C5ZC 5ADOL 3MRPB 2PW1A 3WEXA 5L88L 1J8HD 5JO5A 4JPKH 4HJGA 4XI5D 3TN0C 1RUQH 1KNOA 4K3GA 5C0BB 4AEIL 4PTUA 4LGSB 4PJIA 1A14H 1JZ5A 1WVZA 2QQNH 2YSSA 3TBTB 4CL7A 2JJUA 4F57H 3FO9A 4YUEL 2Q8AH 1XGYH 4CJ0A 1VGKB 3QO0A 4O00A 3GMPB 4E41A 5B4MC 4PGCB 4MAUL 2NY4C 4MS8D 5KAQF 4KJWD 4O58H 1RI8A 4ZUTB 2AJUL 5F6HI 3OQ3B 1E4XL 3FB8B 5TQ0L 3WBDA 3BKMH 5CILL 4XWOD 2P24B 4PJ9B 1MHHA 2E9JA 5FUCC 5DD6B 4C56E 1A1MB 4F9PA 4UBDD 3MBED 4R4NC 4WI4A 4PD4K 5DMKA 4IRJC 4KZDH 4X9GA 1DEEB 2D4FA 1ND0B 1H5BC 4JPVL 2FGWH 5DJXB 3QDAA 3G6JE 2VZ1A 1WF5A 2JCCB 2NXZD 2H6PB 2Q6WA 2A1WL 5T1LB 3THMH 2D7MA 1HH6A 4NNPL 4X5LA 5DQ9B 2IC2A 3P4LA 2NXYD 3BP7B 3GBMH 4G6FB 4U1LB 1FFQA 4GW5B 2NX5E 5AUMA 2VDMH 3RY6C 5HVWA 4OBSA 1UJ3A 3CFEA 4KDWA 5CGYC 1Q1JH 2DB8A 4LFHG 2CD0A 1I7RA 5CEZD 5D7JC 3OTTA 3RI5K 4X6DE 3I9GH 2XNAB 3QEQA 1XGTA 4EXPX 2NY3B 2BX5A 1K4DB 5GS3A 3VFWA 2AEPH 4JFPA 2Y25A 3BXNA 3JWDC 2VLJD 1Y0LB 2HKHH 5FO7B 2Z91B 2X6MA 3TA3D 2YWYA 4PJDB 3RZCB 3REVA 5C3TA 1OAZH 1DBJH 4DOHE 3K8MA 1M7IB 3KHOA 4M1CD 3VH8A 4Z7WF 5CBAA 2WP3O 2FLBT 3HUJE 3R0NA 1A9EB 3UTSB 4OM0H 4PV9B 4DKDC 2Y23A 3IXAB 1OW0A 4G7VH 1ZLWK 1CXFA 2HJLB 1XR8A 4JG1L 2H1PL 3X14A 2PETA 3V7AE 3ILPB 3RPKA 2BC4A 4M43L 3MROA 5KVFH 1G9NC 2X42A 2J4WL 4NUGH 4TSBL 3SDXE 5MERA 4NDMA 4PJ5B 3D3VA 3I02A 4F7PB 4Z77B 5KJRL 4Z7UE 1MFBH 1MCSA 2I26N 2A6DB 4FOMA 2VUYA 4WGWB 1J1PL 1P7QB 2WUCH 2PN5A 4LSPH 5I6XC 3HI6H 2XKNA 4XPAH 5IMLA 3B8YA 3LEVL 1NGPL 3IT8D 4Y5VA 3QWQB 1ZXQA 1N7ML 3GSUB 1S7VB 1U3HA 3I50H 1KN2H 4R26L 4Y4KD 2UZXB 3HLAB 5DEGB 1WIPA 4LLDA 3INUH 1BAFL 3KR3H 3N9GL 1C08B 4ZYKB 1J0ZA 1YYLH 5GIRB 4NHUA 3BO8B 3BP4B 2HFTA 43CAA 4UDUB 1AO7D 3H3PH 4QXUL 5DRXB 2HT2D 1JPSH 5J9PB 3EJYC 5DRWA 1G0YR 2V2WB 4M1DH 4O2EB 1WBXA 4J8RB 4Z95H 4GRWB 2P8MA 2ESVA 1N26A 5C0BD 1R0AL 1X5HA 4JHAL 4RQQA 4YHOH 3CUPA 4LLYB 4XAWH 2FJHB 3OHXA 2WWKT 4M62L 1OM3H 4JREC 1INQB 1KCRH 2PYEA 1T1ZB 5DT1H 1CLZH 1AR1C 1E4KA 3NCJH 3AY4C 3FQNB 4OLVH 3AAZB 3F7YA 3P73B 1D6VL 4PJ9D 4YXHH 3V6ZB 4OQTL 5C6WH 2XG4A 4JLRA 4X6CE 3UTTB 4X6EA 5K9OA 4NM4L 4YDKH 5D8JL 3TH3T 1EEYA 3UPRB 2XY2A 2FBJL 4EN3B 1EIBA 1JNHA 2A9NH 5KVEH 1KXVC 1T6WA 3QDME 4YHLL 3SDYL 5T1MB 4NQEA 4R8WH 1RUKH 3FQXA 5C8JA 3PWVB 1QRNA 2CIIA 2QJDA 4GO6B 5F44A 1V3JA 1FNSH 2X40A 4NQDE 3O2DL 5GXBB 2UYLB 5IB4A 5T1LD 4X6DF 5ACLA 4PLOB 1Q38A 2ICCA 1OAYL 3G08A 5H2BB 1BX2A 1FJ1A 4JFFE 4PJFB 3HMWL 1IT9L 4G6FD 4RZCA 1CBVL 3W11C 3C5JA 3O6LH 1T83A 3HAEB 4FFWD 4P5TB 5MEQB 1A4KA 3GJFH 3LDBB 3UTQB 1F6LL 5KW9H 1IAIH 2YPVL 1R3LB 3VGAB 2E27L 1ZS8B 4PJ7E 1NBVL 3UO1H 1EHLL 3A0OA 4P2RE 2BNUA 3ZDXE 4HX1A 2CK0H 2LFGA 3NGBC 2A6KA 3TIEA 2M26A 2Y9RT 1UWEL 4JGMA 1QFWI 5IBUG 1WITA 2BVPB 1ACZA 4N90E 5HYSA 1NEZB 3SDXF 1PG7L 4AG4L 5KG9B 3UTSD 1NAML 1OSPH 3VFGL 4Z7UF 4HWBA 4U1SA 1OOAA 4UIKL 5A3IC 5TE4H 5C0IA 1IAKB 5LJYH 3RPIB 4ZFFA 1JF1B 5D7SH 3VGBA 1U92A 2ORBL 4LLMB 4YK4C 3T0EB 1V8HA 2XXCB 3DUSA 3ULUE 2OZ4A 4MNGB 1NSNH 4OLWL 2BXYA 5SX4H 3CFCL 4PJ5D 5HD8C 1RAMA 1UB6A 5A2KH 3HR5B 4JM4H 1G6RA 1P84J 1RK1A 4EEEA 2X10A 1P7QD 4NQTA 4YQXL 5E6IA 1CR9H 4Q9QH 2HN7A 5INDB 4P46A 3X3FH 1CFTA 3KPNB 4AY0A 1TETL 1UJ3C 3CIQA 2DQJL 1QPPA 1IEBA 3UYPA 4OZGA 4J3SA 3T8XB 1DBKH 3VD9A 5JQ6H 2FR4A 4MXQC 1CL7I 3IXTA 1OTSD 4I5BA 2ED9A 2BY2A 3ILQD 3GHEL 1T1XB 3TO4B 4JO2L 4ZTOH 1CDBA 4MJ5B 2D9CA 4UU9A 2KZWA 1KJVB 1T21A 4M4RA 3MLUL 2Q7YA 4KZEH 4YAQB 5DHVA 1A7BA 4JR9L 1BJ8A 3OWEA 4DKEH 1FFPA 4DEPC 3MACH 3VE0B 4ODTL 2PCPB 4HIIA 5F9DC 5GZOC 4ODBD 4UTAL 3FAWA 4MD0B 4IBLT 1M7DB 3A67L 3WDJA 2NTSP 4PGZA 5EZLA 5TFSL 3ZLQC 3ROLB 4QRPA 3QHTC 4DGVL 4JO1L 5F1KC 1ED3A 5DMGD 3QRGH 4N8VG 3RVTD 1QLEH 5D2NB 3KS0H 4NZRL 4X6CF 3BRGC 5HJ3B 1L7IL 5IVXB 1ZVSA 3NIDF 4NWTL 1CICB 1A7OL 5HHQA 3WFEH 1LK3L 2GITB 4I9WD 4R9HA 1TQBB 3S37H 4OGXH 3VWKA 1FYTA 3GMNB 4Z78A 4YDIH 1R5WA 1DTUA 3EUUA 2Y4SA 3WSQH 5C0DB 1U8OA 1Y18A 4Y5VC 1U8LB 5TF1L 4LEXH 5C6TH 1DL7H 4JM2A 2OI9C 5INCB 4P3CH 4PRPA 5GSVB 4EN3D 1XF2A 2VE6A 3HE7B 5CIPA 3DUHA 2B2XH 1W0VA 1T5WB 1U3HC 1G7IB 4FFVD 3IFLL 4L3CA 5BV7L 4NHCH 2DBLL 1FCCA 1A64A 1IGFH 3MJ8A 1K6QL 4N8PA 5EA0L 3CXDL 5JTWA 1VFAB 5I8EA 4EUPG 3TJHC 2B7DT 4HPYL 4PJ7F 3GK8H 4BA8A 1FFOA 5IJVB 4JPWH 3ZDXF 3CCHA 5FYKH 1QSFA 2ARJB 4XHQA 3D0LB 5HI5D 5F93C 4P5TD 2DBJA 3RBGA 1CLYL 3ZDYF 4D0DA 1CFBA 1K9TA 1FZJB 1IC4L 2RHEA 4HUUA 2VLME 4PR5B 2AJZB 1A6UH 3HN3A 3PWLA 4S1QH 4FQ2L 5GS1A 3KS0J 4KK5C 3MRQA 4K55A 5J11C 5DYOB 2CRYA 5E8EA 2AI0H 5FKPB 3REWA 1A3LH 5FDWA 4PLJD 3DV6B 1E4KC 1FCGA 4H26B 5BW7A 4FTVB 2V2TA 3ULUF 4XH2A 4R90L 2UUDK 3DSFL 5BS0B 4UT9H 4I3SH 4O02L 1FZOB 1N2RB 1XFPA 1KN4H 2J6EH 5IFHH 2XN9E 4JO4L 4PP1D 1AGFB 3RWGA 4X80L 1U8MB 3HRZA 4X7EC 5IB3B 2PNDA 3V5HB 2DKUA 4MQXC 2QSCH 3T0ED 4D0CA 1B0WA 2FJFB 5E4IA 5C7XH 4LVHC 2ZP0T 4Z9KB 4PGJA 2DI8A 3RGHA 5DUBA 3S36H 5HGBB 1OCWH 4WHTA 3OAZH 2F5BL 4WO4B 4I0PB 3ARVA 1U8JA 1OT2A 2DYPA 3DVNB 1ZHBB 5HXMA 1OAKL 1T2JA 1G6VK 3ETBF 4OZIE 1T83C 4NOFA 4QTHB 4C56A 4DGIH 3K2UH 1CVRA 1PLGH 3ARBB 4XP4H 3NH7H 3L3GB 4KMQA 1XIWA 1Q9OA 4WI6A 2P5WB 1FNGB 5I1AB 3FT3B 4NKDB 4ZUSA 1BOGB 4OCXH 4X5WB 1TVDA 3T04D 3PNWA 4JFOB 4P3WA 3WFDH 3TO4D 3OKNB 3G6JA 1Y6KR 4MCYA 1OP5H 3RKDD 4EKXA 4R96B 4I48A 3ARGB 3QQ3A 5I71B 1YJDH 1IM3B 4F7CB 4LCIH 4HT1H 1X5XA 5C0NC 2VNCA 4M7ZB 4OLUH 4LEOB 3OXRA 1YEHH 2ICEB 1N6UA 1J1XL 1SYSB 3SO5A 5FHAH 1F97A 2HT3C 4QRUB 2AVGA 1GZPA 4PRHE 2NX5A 5CKAA 5DRNA 2DQDL 3KPQA 4OIIH 5BZWB 4EUPH 1QSEA 5DS8B 1KIPB 1QRKA 1A5FH 1ZA3B 1JWSB 5IQ7L 2EYRB 4Y19B 2XWJB 3MRLB 1ZVHA 2AJXL 5CJXC 5ELIA 4LHUG 1YQ2A 2ZPKL 4LAQH 4AH2A 1ODAA 3VD3A 3MV01 3D39E 1CICD 4TOYH 1B0RA 5E6IC 3OPZL 5KVMC 1KB5B 3AS3A 5GS0H 5ISZB 1AE6L 4QCIA 4P46C 4EIGB 3OBAA 3WYRA 1EVTC 3HUJA 2CO6B 3BJLA 3O3BB 3WLBB 4PJCB 5HDQH 2CUMA 4HIXL 5AZ2L 1ZGLM 1HDMA 1CT8A 3LN4B 3VJ6B 4MD4B 1EMTL 3SKNA 1A6TB 3BN3B 1BQLH 4H0GA 2YD3A 4NO2A 1ZT7B 3B5GA 1JZ2A 1ZMYA 2BRRL 2Y5TA 3HE7D 1BHGA 3DX8A 4RAVB 1SBSL 1BWWA 5GRXG 2HJKA 1OB1B 5C07B 5EU5B 1YQVH 5E5UB 1NBQA 1MRCH 2WBJB 2PTVA 1SJHA 3VWJC 3L7EB 3OGCA 1GZQB 1QR1B 1CCZA 5I8KL 2DQGL 3U2SA 4FQIL 3S35X 2VL4A 1EZVY 4JB9L 5E8NA 3O3EA 4O4YH 3O4OC 4M1GH 4OLYL 2D2OA 5F3HA 1XH3B 4OFKA 4NC2B 1X4XA 1PAMA 2NY2B 3KVQA 5GPRA 3QEHB 1XEDA 4OFVA 3QHFH 4KQ4H 1AQKL 3LIZL 4HGWA 3RGVA 1BLNA 2BP3A 2I9TA 1HH9B 5E24E 4NQCB 2EXYD 1G7QB 1XCQB 4NN5C 5B38A 4CUCA 2AXGB 5HHPB 4NFCA 3ULVL 4DAGH 4S0TD 1NJ9A 2OL3H 2NLJA 4MA8L 3VWKC 4FTVD 1LNUA 3DBXB 4BFIA 2XKSA 3A6BH 1BZ7B 4ONFL 5BS0D 1IRAY 4R6UA 2BMKA 2L0DA 1E28B 1KENH 2EE3A 1HOCA 1NCWL 1J0IA 4JM2C 3STZA 3L5XH 2BHYA 4NO5A 1Q0YH 2EDFA 2R1WB 35C8H 5F7WC 1VB9A 3JWDH 5FDYA 1JZ3A 5D1XA 4GQPH 5TE7L 1KCSH 4OZIF 2NR6D 3WUWA 1VHPA 3SGEI 1YDPB 1RMFL 1E4WL 4I0PD 4CU7A 1MCIA 1AY1H 3K46A 2XV6B 3LVEA 1IL1A 1H3XA 4WHDA 5E7BA 5ESVA 5IUSA 4JZJA 4PB9H 4Y88A 4H1LG 2JB5H 2YC1B 3S5LB 1YEEH 3ARBD 3DTXA 4L8CA 4Z5RB 3RTQB 1U0QA 3IGAB 3QPXL 1G9NH 1I8KB 5HDOA 2P5WD 4HUWB 4UAOB 4D94A 5KOMC 3MLTA 5GS1C 3SDDA 2CDGB 3QDMA 4XMPL 4HFUH 4FFZL 3VFSA 2YD6A 5DHYA 4NBXB 3BEVB 3KJ6H 4K94L 4FXKB 5HI4C 4ZPTB 1R24A 1W72A 3ARGD 4P23A 5BW7C 4LDEB 2ZG1A 3LKQA 3O8XA 5I73C 3BN9D 1VA9A 2CRMA 4GRMA 2WV3A 2ATKA 4ZOCA 4QRRB 5IT2H 4PJGE 5FA3B 2GJJA 4WFGD 1JGLH 3S88L 1CIDA 4KRPC 3AUVA 4IDJL 2EIBA 3TM6A 4NC1C 1EXUB 1X5KA 3BD3A 2I07A 2IAMA 1A9BB 1T04A 1MWAB 4ZOEA 1GXEA 4FMKA 4P2RA 1EFQA 4Y19D 3WKNA 3O3AB 4P5MA 4XP6H 3WJLC 4DQOL 5JZ7D 3FB5B 1IZJA 3BISA 1QFWM 2LU7A 4QOKB 2SEBB 1AGCB 4JKPH 1P7KB 3HS0B 4XB7A 1PQZB 3DX7B 1CDYA 4FQXB 4P2QE 5ISZD 4M7LL 3SBWA 3ES6A 5E2WL 4XMLL 2OBGA 4PGEB 5DI8B 2BXZA 5DD3L 1CGSL 1QBLH 4TULL 4FZ8L 4AEHH 4HCRL 4WWKC 2CUIA 5BOZG 5I74B 5TDPA 5MEPA 4YGVA 4J3OC 1INDL 4KU1A 3X3GL 4POZD 1WV7T 1T66D 1BIIB 1ADQL 1U58A 2D0HA 4XTRD 5K93A 1IKFL 4JRYE 3TO2A 4POYA 5ADOH 4OUUB 2ADGA 5C07D 5D6CB 1WJ3A 2ZG2A 4G5ZL 2WBJD 4EI6B 1QKZL 3QUZB 3S8WA 2CDEA 2GUOB 4ODVH 2DLFL 3ZKND 1NMAH 2FWOB 3O45A 2JB6A 5I1GH 1RJYB 1UH4A 1R5IB 2K9UA 1S9WA 7FABH 1KXTB 1N8ZB 4MXVE 5BJTB 2NY2D 3QFJA 3U6RB 2BDNH 3UCRA 5TQ0H 3SE3C 1HQ4A 4YZFF 4ZQKB 3OR7B 3QIWA 1CTOA 3VH8G 2YK1L 2HJFA 3HG1B 5DJAA 4PJEB 1RIUH 4LLQB 2XWBA 4PY8I 5LGKA 1EZVX 1N3NA 3JV0A 3UAJD 1AXIB 4NQCD 4IMLA 3C09B 4K3DL 3T65B 2HRLA 2DWEA 3EOBA 2APWA 1RU9L 1MY5A 4JY6A 8CGTA 4YHYC 1WEJL 4QHLB 4MDJB 3L5WB 4M6ML 4X7SH 5JHDE 1A6AB 5EWIH 4OKVB 3FRPA 4IS6B 4JFEE 1IBGH 5KTEH 1QNZH 1VEOA 1IGJA 5JW4N 3TF7C 2HG5B 2P49B 1FE8L 3EFDH 3GI8L 2VN4A 2YZ8A 5A43C 4ODWA 3U1SH 2ZCHH 3IDGB 3MRRA 1MCJA 3EO9H 3MNZA 5ANMB 2GJZB 1W8NA 4G8GB 2BRQA 3CSYA 5BZDA 4HZLA 4NCDA 3FONA 3RWFB 3LH2H 4XPFL 1ZGLP 2W9DH 1NLBL 5EO1A 1U95A 1BGXL 1IVLA 4APQB 3GHBH 4N0CC 5D7KD 1HINL 1TDQA 5J6HB 2HTKC 3CVHB 3K8KA 1I3RA 2R9HC 1B6DA 4L9LC 3ZKMD 2AV1B 4GW1B 3WLWD 5E99L 5I1LA 5AWNH 1A1NB 3RTQD 2VL5B 2PYFB 1S7QB 4NN6B 4TUKL 1UVQA 4XX1G 3MNWA 2RFXA 1MIML 5T3XD 4X4XB 5LGJA 1RY7B 3O81A 3LAFA 1C5DB 3GRWH 1FL6A 3MLRH 3KPMB 3TWCH 4D9LL 2F54A 3RAJL 1ZT1B 4PJGF 2R2EA 4MVBD 4N9GB 3QIUB 4Y5YB 1UA6H 3ISWA 2VDLL 2VABB 5IBTH 2WWMD 4Z0XA 4TSBH 4EXKA 3UJTH 1EGJA 3BD4A 1V05A 3DWTA 3R1GL 15C8H 4LKCA 4WY7H 1L0XA 2DTMH 3NCBB 3MMEB 4QRRD 5H35B 4AENA 1AQDB 3MV7A 3I84A 1WBZA 3T3PF 2V17L 4UT6L 5GZNC 1U93A 3R8BB 4CNIA 3UEZA 1IGTA 4L29B 1R6VA 5DGQA 4TVSa 4XVJH 3T1FB 1HZHL 4GLRH 1MREH 2JK5B 3P0VL 2R8SL 3GI9H 4G6JL 2EDDA 1EX0A 3HC3H 4QOKD 4HLZG 1LO5A 1UT9A 2DQUH 3MFFB 4XVUC 2H9GB 2NTFA 3QUKA 4FQXD 5EBLB 4JZJC 2KZ1B 2YN3A 3E6FA 5ACZA 3M1BA 2R56H 1OWWA 3D2UA 5GGTA 1NUDA 1NCBH 5EOQL 1HWHB 3L3JA 5IM7B 3VFNB 3BMVA 1QBBA 3I6KA 4GRLB 4GG6E 3SDDC 1WCBA 3SDAB 5LQBL 2W60A 5JHLL 3DRQB 4XPHL 2QSTA 4QHMB 5ITFB 2EYTB 2BOCA 4QKXB 4WNQB 1M71B 3WO4C 4P23C 1N59B 1A7NL 1MCOL 1BBJB 1PDKA 1HILB 4XNYL 1FRGL 4QEGA 2IJ0C 1WC7A 3IDYB 2BFVL 3PWNB 4GSDL 5EO9A 3G5XA 3HZYB 5F96H 3IFOB 3ZYZA 4Y4HB 2HLAB 1P9MC 4DVRL 5IP4A 1QZ1A 3NN8A 3F7PC 3VXMA 2IAMC 5HYSG 3DYPA 4KKNA 5IB2B 3HG1D 1D5MA 1EO8H 1Z9MA 3B9EA 4BZ2L 5LAXB 2P8LA 1TZGH 3MRGB 2Y5EA 4RMRA 1A47A 4L8SB 4JFXB 1NGQH 4ORGB 1FH5L 1F4XL 2VXTH 4WHYH 5SWQB 2R1YA 4R4FL 5LXGL 4RGOL 3HE6B 1MCRA 5C0AB 5CSBA 4P59L 3MZGB 2ZKHH 1FZMA 3PDDA 1DVFA 1HK6A 2O26U 4ODUB 4ZS7L 4LCWE 1IE5A 1ZLWH 4LCCB 3ULUC 3CK0H 4KVNH 4YPGB 1G7MA 4XZUA 1OGTA 4J23A 5CWSB 1VACA 2NYYC 2AEWA 4UV4L 2RQ8A 2APBA 2NY7H 2I60L 4G8GD 5F88A 2YPVH 3GMRB 4XAKD 4U1KB 4FFYL 4U1GC 1RJLB 4PRIA 2KPNA 3VXNA 3BKCH 3EYVA 1RUAL 1ACYH 1C12B 4APQD 3CPLB 1HXYB 2BNQB 4WTWA 1U8PA 3W9DB 4M48H 3IS1X 1TPXC 3GMQB 2X4QA 5GRUH 2OXGA 2ZZUT 3O4LB 1TJGH 3VXOB 3TT3H 2BSED 4UQ2A 1FN4B 4UQ3B 2R0ZH 4U6VH 3QIWC 4J4PD 4ONOA 5C08E 1F11A 4OCYH 3RVWC 1YN7A 5HGHB 2BSTB 3IJSA 3BHBB 3DETD 5AYUL 4LSQL 5IEKA 1NGWA 4JZOA 2V7NB 3SY0B 3SKJH 2R39A 5DD0L 1I8IA 2YUWA 5KS9A 5IEHB 1Q9LA 3UDWC 1U2CA 4OCLC 4HK0B 3NFSL 3O3DA 5IIEA 1FGNH 4FXGA 4NRZB 1SJEB 1MJ8L 4P2OA 1IQWL 1P2CB 1OTUD 4KQ3H 1JP5A 4ODSL 4DUWA 4OCWL 4KAQH 5I75C 5D5MB 4NSKB 2AK4E 3VFUA 1DQML 5LWYL 5K9KB 1DQTA 1LILA 1G9EA 3SCMA 3UBXI 5I8OH 4A6YL 4U33A 3TEUA 1IAOA 3C8HA 4EI5C 1OP9A 1TVBA 3L3DA 3LCYA 1V3KA 1JZ4A 3UTPE 3HNVH 4MWFB 3MRDB 4LKXA 1A6ZA 4UB0L 4KPHH 2JJTC 2RCSH 3QT2A 2AJVH 1DLFH 3A6CL 3S34H 3RL1A 3IU4L 2I24N 1CS6A 3MJGX 1UXWB 4IDLA 5EOCL 1S8DB 2YA1A 1QFWL 4ZUUA 2OZ4H 5IHUL 5DJYA 4ONHB 4XXCC 4LPTA 2W0PA 4UNUA 1MCWM 4GRLD 2P5EB 4FXLA 3I3DA 3PIQA 5IW1B 5D7IB 4WW2F 2D0GA 3L3IA 3SDAD 3RVXD 3ULSA 1VFOA 2VDKH 3HRPA 3KXFE 5DJ0B 4ZD3H 1T03L 1G6RH 1OVZA 3MOBL 5D71H 1QFUL 1I8MA 1JPFB 5T1KB 4JN2B 3MRKA 1I8LA 1NFDB 1YY8A 2Y06L 3P4MA 3SOBL 3G6DL 3QCVH 3QUXB 2YRPA 4O5LL 3PUCA 1ZT4A 3GJFB 3MCKA 1S9XA 1S7TA 1F6AB 1FLRH 5ALBH 2UY7A 1G7PB 3GGWA 4Y4HD 1R3KB 4DN4H 1BFOB 5I16B 3O0RL 3VFOA 4CJ1A 1JK8B 3W0WE 1HXMB 2K3TA 5ERWA 2W07A 2R0LL 3JTTA 4MAYA 3TBYB 3EYSL 2Z31B 5CP3H 3P30H 3B9KA 4JPIA 4YX2H 5DHVH 3CFKB 5T5NF 5EC2B 1CL7L 3GDBA 4MCZA 12E8H 1JPTH 1UWGH 3PQYA 4MJID 4PG9A 3SQOL 3VFRB 4NRXB 5DK0A 3UZVB 4XP1L 2W9EH 3UYRL 2ADFH 1EHNA 1HHGA 1J05A 1SMAA 3G9VA 3HE6D 4LHJB 5DJZA 5C0AD 4ELMB 5DTFB 4OQTA 1DANU 2O5ZL 3LPWA 4LOUC 1RURL 2VZ3A 1K6QH 3L95A 3CXDH 1KIQA 5D9SA 1JGDA 2CXGA 1P4LB 2Q86A 3DO3A 3S4SA 5FM5M 1BD2A 4M8QB 3V5DA 4KVCH 3U9UA 5SX5K 1T2QH 5D1ZA 1CLYH 4CMMA 1LDPH 1EHAA 3VFTA 4L5FL 4OCSL 3TFKC 3O2DA 5JQHC 4O9HL 1IC4H 4I13B 4JN1L 2NY0B 4PJXB 4XMKL 1X5GA 4ESKA 3BE1L 1ZKAA 4ZFOL 1FFRA 5HGGS 5GGQH 1NPUA 1XGQB 3NA9L 2BNQD 3O4LD 1HHHA 5CJQL 5CIPH 2R4SH 5H8DA 5ADPH 1MCNA 5I1IL 2FO4B 2VDPL 4Z7QF 3QXTA 4S1SH 2KDGA 4O02H 1MHEA 1IAII 3BZFB 5CZXD 4WDIA 4M6OL 5IHBA 1BIHA 5FYLH 1WZLA 1NFIB 1T0PB 2NCMA 5GGRB 1WT5C 5JPMA 1YEDB 2F15A 1CFQB 4CU8A 4R0LA 3BH8B 4Y1AB 4Y2DB 2AW2A 4OLZH 5HVHB 1K5NA 5J89A 5J06A 1KULA 1KJMA 1N64H 1MLBA 1I1AB 2X1XR 4Z8FH 1DVFC 2CRZA 1NAMA 4I18B 3QHZL 4KRNA 2HLFC 4OTXH 1RZGB 5DD1L 4AL8L 1XF4B 3KPRD 2AJYL 3MRIB 4UDTA 2AGJH 2P7TA 5E94A 1OAKH 5GISH 3FQRA 1Q72L 1S5IL 5GGSA 4WJ5B 2C3VA 3VXSA 4BFGA 5I0ZA 1FO0H 2FB4L 1R5VB 1S78C 3RX8A 1HWGB 5MI0C 1VERA 4KK6D 5JOFA 1U91B 3P11H 2CMRH 4FABH 5LVEA 5I76B 5SX4I 3WKMH 4H88L 3WHE1 3PL6A 3C60D 1YPZA 4OI8A 4YDLC 5TDOB 4TNVF 5FGCE 3EAKA 4MB3A 5HY9A 3FFDB 3IRPX 2BSSA 3SGDH 1KJ2L 2VZOA 3MRJA 4YNYA 2ED8A 4PGDB 4BQCA 4X6BA 3ZDZF 5BOPA 1KXQE 5ALCL 3E2HC 5E8OB 2EYSA 2PF6A 3QI9B 2P5ED 5GRYA 1O0VA 1FFNB 3FCTB 1WWBX 2N1KA 4C59B 4MDIA 5CGTA 5T1KD 5HPOA 3SE4A 3O41A 2Q76A 5BO1L 3S37X 2ZJSH 4HS6A 2EZ0C 4D3CH 5KSVA 2VLRB 3QUXD 1O5DT 3J8F7 4LSRL 5CEZE 3DUUB 1EJOH 4ZS6D 5B38G 2VDNL 3ALPA 2ZUSA 2YRLA 4OZFA 4F3FA 1HHJA 3QEGH 1AE6H 3MO1B 1KFAH 2O5XH 1C16A 4CMHB 4HXBL 2EDBA 1OD7A 1Q0XH 1CI5A 5FYJU 5HYQA 1Q9WA 4ACPA 1EMTH 1NBYA 3O6KH 2FZ3B 2YPKB 3D0VB 3EOAA 4LMQI 4AM0B 5EU6B 3FRUA 1MUJB 2ZUQC 5ILTL 3BH9B 3CLEL 3WUWG 1QLRB 1OHQA 3V52L 2UUDH 4FA8A 3KGRA 1YNKH 2ITDA 2GSGB 3LN5B 2A6JB 1R3IL 3QIBA 4NO0A 5I18H 3QO1A 3DGCR 4XNUH 5BVJA 1SVZA 5SWSB 4N1EA 3QNXB 2FJGB 3ABZA 1BVKB 1MFNA 1GH7A 2BNRB 5KVDL 4KFZC 1LEKB 5IVNA 2QKIB 1T3FB 1I8LC 4HC1L 4J3TA 2YPLE 3TVMB 2J88H 2EH7H 2NY0D 5CEYB 5I30H 4BKLB 4UTBH 2HYMA 4KI5D 4ZMAT 3BP5A 3PABB 1CFVH 4EOWL 3RUGA 3T2QA 4M3KB 4PJ8B 3NBNA 4FNLL 2VLKA 1KBGH 2AKRA 3QQ4B 2GYSA 5FHBL 4OZHB 1HYSD 3GMMA 1A6VH 4MAYC 3FJTA 5F6IC 1PZ5B 5J3HD 1I1FA 3ARFB 4K7FA 4GG6A 3L3KB 3PJSA 1LO3H 1S7XB 3B9KC 3CXHK 4DN3L 3S36X 1QUNA 1DCLA 2ZNXA 1HNGA 1M1SA 4YDJB 1E27B 5C0GB 4F7MA 2CLRB 3I3EA 6FABL 2OK0L 3LSOB 5L2JB 3Q1SH 2OP4H 4Y1AD 5EG6C 1U36A 2X4SA 4KY1H 2FLRT 2MFNA 1JNLH 4C54A 1KTDA 4LSUL 1I1AD 5FM4A 1FDLL 2ZCLH 1SEQL 4L4TA 4CN6A 5J13B 5L8LB 1RMFH 2C5DC 4HBQA 3VA2C 4ODXA 4EBQH 5C0BE 5FECB 3P3YA 3F6IA 2PW2B 5EIIB 4I0CC 2NZ9D 1FORL 1QEWB 4KTEL 2G5RA 2X70A 5FCSH 5D1ZC 4PIRF 3DO7B 4DKFH 2YMXL 1F45A 3QUYB 3QWOB 3RY5A 2Y07L 1PW3A 4NP4H 4PV8A 1VGEL 2V5TA 3EO0A 1JHTB 4YR6A 2OJEB 4J1UA 3C5ZB 5IQ9B 5CHNB 3WUZA 3LEXB 4HUVA 2B1AH 5CJ8A 3SDCC 3ARRA 5IG7A 1HQRA 2FEDC 2DDQL 2MPAH 1ERNA 4XPTH 4WCYH 2VSCA 1DLHB 5D2LA 3TPUB 3G6AA 1NCAH 4KKLD 3ROOB 4U1HA 3T0XA 1RZ7H 5IFJB 3D18A 2C1OA 4XWGH 2JCCE 1FP5A 3QI9D 3GJEB 4E42B 3IDNA 5B39A 2OS7A 4BSWB 3KPPB 4GUPA 2BVEA 5ENWB 5CS7A 1D9KA 2MCPL 2ADJA 3QWRD 2NZIA 2QHRH 4R0LC 4WUUB 1TMCB 4M6AA 2UWEB 3EYFB 5F7DA 1KPUA 3S35L 1CLOL 4NZJA 1GOFA 2DL9A 3P77B 5CCKL 4NNXA 5IGXL 5HGAA 3BPCA 5FK9B 4LQ1A 5FYKD 3VMOA 4ZNEA 1D7FA 1MAJA 2XWTB 4JFDD 4IRJB 4KK9D 3U4AA 1BFTA 2AQ2A 1ZLVH 4XP9H 3LQMA 3H7BB 3U4BL 2L7UA 2G75B 4EDWL 5F7EL 3NMEA 4K2UL 4Y8AA 5E2WH 1N5YH 2CRIA 4HS3B 4PJHB 1W72H 4OCRH 2GFBA 5EUOB 4OGAD 5F7HA 1XF3B 5C2BH 4PG2C 1MY7A 4FQLL 3FRPG 4GKNB 3PXJA 3FTGA 4IMKC 1B4JH 3MGOA 5DD5L 4ZXBA 2XIDA 3PL6C 2CJUH 4NC0B 4KJPD 4WEBH 4CGTA 1MCPH 3MGTA 2Z35B 1KJ3L 3MRCA 5EU6D 5C09B 2QHLA 3DGGA 1YMHB 2GKIA 3HNSL 4JY5H 2OR9H 3V95A 2H8PA 2VDOH 4WFHE 3GSNA 5F7MC 1TZIA 2DLIA 1MF2H 2ZOLB 3MRBB 1P4BL 1X5YA 4EZMA 5E08L 5SWSD 2P4AB 3NABL 1U6AL 3SPVA 4JJ5A 2Y36L 2BNRD 2PR4L 3D85A 3FOMB 5E5MA 3SE4C 3T0AA 3TVMD 4PJAE 3CFJA 1XGUB 3MNVB 1MFAL 2RIKA 5KSUA 4M7LT 4V1DA 5GRZA 3QH3A 4Y16A 1U8HB 3MYJA 5HHOE 1FL5B 3SJVE 5HHNA 1NGYB 4PJ8D 5DGRA 4JCLA 1AGDB 1FSKC 1Z5LA 2DWDA 4HG4J 3ULUH 4RGNC 3VFMA 2D7TH 3CU1A 3ARFD 1QHOA 3LRSA 3VRJA 1HIMH 2MCG1 5JW3H 1TVHB 3R4DA 4BSVA 3N50A 3TNNA 2GHWB 4KGLA 4POUB 3BVNA 2B0SL 4K9EC 5LGHH 1A21A 4K8RD 1AD0B 2OTUB 4G8IB 4KH2A 5F8QC 4TTDD 2I9LB 3HC0A 3CD4A 5D7LB 1OAXL 4LNRA 3T4YB 1PKOA 4D9QD 2R2BB 2ICWA 2YXFA 4GRWE 4N8CL 4OAWB 4ZDHB 4P9HL 1G84A 2B4CC 4ISVB 2K7QA 4P4KD 4H25B 3CMOH 4GKZA 4UZGA 5T3XL 3TNMB 2ZSVB 3WHE0 3W2DH 3CDGA 2AXFA 1JWMA 4G3YL 4R2GD 5LBSH 1HINH 4MSWB 2PKDA 4JO3L 3C6LA 3BKYL 3QUYD 3P4OA 1AHWC 2D31A 2RR3A 4U0RC 2X4OA 4NJ9H 4TUKH 3W9EB 5GS0D 3ARWA 1NCCH 5DUPL 5K9JL 5E2TL 1JGEB 5SWZB 1QG3A 3OXSB 2C3HA 3AXLA 3C5ZD 3TBWB 3UTTE 5HI3C 1JWUA 4XP5L 5FO8A 4KHXL 2CXKA 2A74A 2ADIB 4QTIL 1CZ8H 4U1MA 1MI5B 3OJMB 5H94A 3TN0D 2AERT 1BBDL 3NFPA 2VDLH 1WLHA 4FQHB 1CD1B 1MWAL 3QCUL 3X13A 5CZKA 2Q7NA 4XBPB 2R0WL 1WQVT 1NUNB 2HT4D 3DMMB 1SM3L 1X9QA 3GSRB 4FG6C 1Z6JT 3RJDA 1K8DB 1P4IH 3VXUE 5IB1B 2V17H 4W81A 1TTFA 1EEZB 4CRPA 4HF5H 2X9YA 4X7CC 2DI7A 1A0QH 4WUUD 3HPLA 2Z8RA 1NKRA 4Z0BH 2XOTA 4QY8B 3GSVB 4WW2C 4CVXA 1MEXL 4JHBA 2DQCL 3ARZA 4GAGL 5CP7B 3LKOA 2IQAA 4XC1H 1DQDL 5EFIA 4X4ME 4R4ND 2CLZA 1WAAA 2AK1L 1TZHA 3BGMB 4Q7DA 4X7TB 2W65B 4IRJD 3ZTJG 1VFBA 3MBXH 3K7UA 5I1DA 1IEAA 5E1AA 4PRAA 1K3ZA 1UKTA 3VFPB 3WJJA 1Q9KA 2HWZH 2X4PA 4KJYB 3OKDA 4GMTH 3T77A 4XCEB 3VXTA 1EGJH 4MB5A 4HKZB 3UTZA 1U8NA 2HVJA 4ODHH 2AQ1A 1F8TL 5C09D 5DJ8B 2HAZA 3PV6A 1AKJD 4P57B 4HCRA 1UH3A 4XCCH 5D7JD 2EDXA 3K4DA 3DOSA 2IPTL 4PJIB 5HHME 1NLDH 1RZJC 4F7EB 1MFCL 3ZE0E 4KUZL 4NGHH 3WN5A 4PJAF 3OKKA 2X1OA 3NGBB 4MJ6A 5EZOH 4BK4A 4LAJH 3QCTL 5F70A 1MRDL 4LBEA 3VG0H 1I75A 1M05A 4YHNB 4OD1H 3FT4A 3BDYL 5IJKA 4WFED 2VC2H 3KNBA 1II4E 2DJ4A 2D4DA 3RVUC 4DCQA 1P1ZB 5DC0A 3VGHA 1ZHLB 4R4BA 3DX6A 4G9FB 5L6YL 4YC2B 3D25A 5L7XL 1DBMH 3PWJA 4AEFA 3UTOA 2J5LC 4NKIL 5IKCB 1D5XA 3MBEA 4YK4B 2KH2B 4JG0L 3F65A 5I8CA 2V9QA 1RFDH 1LO0L 1LO2L 1FH5H 3OAUL 4J6RH 2PTTB 5I19L 4RFOL 3TBVB 5KSBE 2DTSA 4YGAB 1PKQA 3QNZA 4GG8A 4JAMA 3VCLA 5F9WC 5DVMA 5DJCB 3UJIH 3V5KA 4ZXBC 3WD5H 2NY5L 2R2HA 4K3EH 5AUMB 4HUXA 1KLUA 4FS0A 4E5XA 5D7LD 3V4UH 1EAPA 1NANH 3MUZ1 2XTJE 1PBYA 5K9QI 2VXVL 3MRHA 1N5AA 2HFFB 1NGXB 4YHIA 3V9FA 4N5UA 4WU7B 2VLJA 3N1MC 2WANA 1JGVH 3CZJA 2O61A 2X9XA 5BRZE 1OAUL 5IVXE 5JPNA 3ZTJH 1U8IA 1A22B 1A4JA 4O2FA 2AV7B 3K1DA 4UUJA 3TCLA 2J7LA 5KANG 3HZMA 5SWZD 4Y16C 1RUPH 3EJYD 1G1YA 1RD6A 2P8PA 2RBLA 4JPKL 1IM9A 4WEMB 5TH2B 3STLA 1RUQL 2OQJA 4JRXB 3PWUA 1MI5D 3MR9A 2A9MH 1A14L 1BFVH 3FN0H 1FC1A 1OARH 4LVOC 4UT7H 2QQNL 3WS3B 2YBRB 4F57L 2Q8AL 2X4RA 1XGYL 5I1EH 2P45B 4JY4B 3DMMD 5DZOA 5CEXB 1S7RB 3AREA 1EUUA 1LD9A 5DO2C 3MFGB 4ERSH 1WK0A 3EFFA 4E0RA 3BKML 5LWYH 4QXGH 1AR1D 2X4NA 4WVRA 3UZQA 5FXCH 2YPLA 5HYFA 3ECBA 3MYZA 3V6FA 1T20A 3SKMB 1DDHA 4PP2A 1GIGH 1ZA6A 2UZYB 4Z7VA 3PDOA 1WISA 4R3SB 5C9JA 2OI9B 1BJ1H 4KZDL 3V6OA 1U3HB 4TN9A 2FGWL 1U8QA 2X4TB 4S2SA 4Y4KA 2B5IB 3C6LC 4J3VA 3THML 3D69A 3QAZC 3BZ4B 1NEUA 1ZLSH 4NUJB 5IFAH 1HSBA 4ZUWB 2FCBA 43CAB 3GBML 3F7VA 4OFDA 4DWHA 4GLRI 3ZE0F 5JXAH 1AO7A 2VDML 3DRTB 4I2XE 3S4SG 1I7ZB 4ZSOE 3W11D 3ZT7A 1Q1JL 1JYXA 1WBXB 3GKZA 1HI6A 3MRPA 4M7KH 3S98A 4ELKA 2ID5A 3I9GL 1IGIH 1UEYA 4IRZH 2ITCB 1R3HA 2IH3B 4TSAH 2AEPL 2HKHL 3FN3A 5C0BA 3F58H 5L2KE 4L4JA 2G2RB 5DEZA 3UPAA 1OAZL 5J11B 3TBTA 2XFXB 1DBJL 1VGKA 4TUOB 3GMPA 4PGCA 1QTYT 3O6MH 4OM0L 2IANE 3FB8A 1WCQA 1RZ8B 4JLRB 2P24A 1BWMA 5KSBF 4PJ9A 1WWWX 4G7VL 5DD6A 3QZWA 2H32B 2N4IA 5K9OB 2VDQH 1LDSA 1A1MA 4RFNC 3N1QC 3KPSE 5A3ID 5IWLC 3KPOB 5KVFL 1I7UB 3WE6B 1BJ1J 4NUGL 2EE9A 1WBYB 4MX7A 2DAVA 4LVHB 2Q8BH 1DEEA 4LSSH 4YDVA 5F7NC 1MFBL 5DJXA 1EA9C 5HD8D 1ITBB 2JCCA 1F2XK 4FZEH 2H6PA 3LV3B 5HYJE 1EBPA 2WUCL 2GJ6B 3N06B 5T1LA 2HMIC 4LSPL 1S9YB 5DQ9A 2ZWLT 3HI6L 4XPAL 2OJZH 4RFEB 4XPGH 3BP7A 2WM0A 1B88A 2WW8A 1TLKA 4FQQB 1A4KB 4U1LA 4GW5A 1MRFH 2LV4A 2DI9A 2IFGA 1I9RH 4XI5C 5EZJB 1Q94B 4MXQD 3WL9B 3VXRE 4HX1B 3I50L 1K4DA 1KN2L 1Y0LA 5FO7A 3INUL 5I0DA 2Z91A 4U6XA 1UWXK 3KR3L 1DP0A 4PJDA 3RZCA 1YYLL 1M7IA 1IC7H 4XWOC 3H3PL 4IIQB 4I1NB 1ZAGA 1JPSL 3UTSA 4PV9A 5GZOD 4MD5B 4M1DL 3IXAA 2VB5A 5FKAB 2CGRH 2ZUWA 4Z95L 3LMJH 2EKJA 2HJLA 3MBEC 3ILPA 4G8FA 5EUKB 2VITB 3CFBB 4JRXD 1O7SA 3HI5H 3S3PA 4YHOL 4PY7B 3FB6A 1LP9E 4XAWL 3MV9B 4PJ5A 2MQCA 4F7PA 4Z77A 3RX5A 3EYOB 1OM3L 3V6BR 1KCRL 2A6DA 5DT1L 4AL8H 2NMSA 1CLZL 1P7QA 3NCJL 1Z2KA 4HEME 4OLVL 4P46B 1L6ZA 4YXHL 1A3RH 1GSMA 3DJ9A 3EJZD 4KKAD 4I3GA 1ZTXH 2LTQC 4YDKL 5FA4B 2JTDA 4QWWD 3QG6B 3SJVA 2A9NL 3Q3GB 1BPVA 1T6VN 3IFNH 3KG5A 4R8WL 1RUKL 1U3HD 4MXWH 4YBLC