3SOVA

The structure of a beta propeller domain in complex with peptide s
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
306
structure length
306
Chain Sequence
APLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Wnt antagonists bind through a short peptide to the first beta-propeller domain of LRP5/6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/antagonist
molecule keywords Low-density lipoprotein receptor-related protein 6
total genus 80
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00058 Ldl_recept_b Low-density lipoprotein receptor repeat class B
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3sovA02
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3sovA01
3F6UL 2KB9A 4OTYA 2P3FL 2WPKE 3CA7A 3S2KA 2DSOA 1IP0A 1RWLA 2K2TA 3ELAL 2FLBL 4DG6A 1UZQA 1EBVA 4NGAL 2P16L 1SZBA 3NTGA 4JYUL 2KL7A 1TLEA 4JYVL 3Q3KB 1KLIL 3DASA 1OB1C 2KV4A 2Y5GL 2IAWA 1WHFA 2GVUA 4M11A 3R05A 3BPSE 1G1SA 3K9XA 1CRZA 1HAFA 3TBDA 5L30L 1IJQA 2IAOA 3HLIA 2QE8A 5JBAE 1F7EA 2P95L 2POOA 4RS0A 3HS7A 1FAKL 3ZYGA 1KLOA 1PFXL 3SREA 1LPZA 1ATDA 3GISX 1HRFA 2Y5FL 3Q7DA 2NPRA 4JZEL 2P3TA 1NFXB 4Y6DB 5KN5C 1HX2A 2WPHE 1JBUL 1IQML 1G2MB 2MGRA 1DX5I 4GNCA 3LC5B 2VWOL 1V04A 2P26A 3KK6A 1HZ8A 1AUTL 6COXA 1XFEA 2PHBB 5IKVA 2GVWA 4Z0LA 1CQ1A 1TPGA 2Y38A 2XC0L 3G4EA 1LPGA 3LN1A 3HS5A 1NFUB 1HCGB 1IQJL 1IOEL 2IAXA 3U73A 3QH0A 1EGFA 2I9AA 4NA9L 3SOBB 3S8ZA 3IITB 1IQHL 1JV2B 3BYCA 1EZQB 1ATEA 3SW2A 2DG1A 1IQGL 3N8WA 1EPHA 2WYJB 5COXA 4IMBA 1KSNB 3N8YB 4JMLA 1RFNB 5IKRA 1NZIA 1N7DA 4MMXB 3HLHA 3RR3A 4R40A 2HQSA 2W26B 4LORA 2VH6B 2FPCA 3SRGA 5GX1A 5JBCE 3S94A 1J9CL 1FF7A 2Y5HL 5CKNA 1GK5A 5JBBE 3POYA 1CX2A 2IARA 4RRYA 3V1SA 4Y7AB 2BQ6A 1HT8A 2G00L 4ZHAB 3HO5A 2J95B 5D9DA 3S8VA 1APQA 3KGGA 1EMNA 1HJ7A 3KYAA 2W86A 2XBVL 2OYUP 4BDXA 3FVZA 2VWLL 4O5TA 3QCWA 3PGHA 2WYGB 1FJSL 2XC5L 1CCFA 1EPIA 1PTHA 2BQ7A 4RRWA 1CVMA 2XC4L 4BXSA 1CQEA 2MGPA 1IQNL 2M74A 3Q6KA 1MOXC 1EQHA 1DVAL 5JB8E 2W2QE 1NT0A 1K37A 4D90A 3TC9A 4BXWA 3CFWA 3TK5B 3FCSB 1HT5A 4D0EA 1F0SB 1L5GB 1DQBA 1WHEA 1X7AL 2K2SB 2B7DL 2IAUA 1PJXA 1F7MA 4NG9L 3LTFB 3NT1A 4FM5A 1W7XL 4HHOA 3U0SA 1IQKL 2UWPB 2W2OE 2WG3C 4BDWA 5JW1A 1IQFL 5GX3A 3F1SB 3ZYJB 1ZAQA 3SOVA 2PUQL 1I0UA 2W3IB 2Q1JB 1HAEA 3KQBL 4CUEA 2AYLA 4Q1UA 3IJEB 4GNBA 2EI7B 3KL6B 2W3KB 1EPJA 2P28B 5FDQA 3M37L 3N8WB 1XDTR 4O02B 2VH0B 4Y76B 5F1AA 3IAXA 1IGZA 2IASA 3GCXE 5JVZA 3ENSA 1Q4GA 2P94L 2TGFA 4ZXYL 2W8BB 1CVWL 4COXA 2IAQA 1XKAL 4A7IA 3U7UG 4O5SA 1G1RA 1KLJL 5F19A 4RUTA 4ZXXL 1V3XB 1QLGA 3MDLA 1FFMA 1MQ6L 1C5KA 1P0SL 1P9JA 5EGMB 3TZIA 3Q6PA 1L3YA 1DDXA 2J34B 3KCGL 4GNAA 3OLTA 4PWZA 1WU1B 2CJIB 2Y82B 4O1ZA 4C16A 1G1QA 1UZJA 3LI5A 2FP9A 5L2ZL 2IVZA 1C5MF 2Y7XB 4X8UL 2J2UB 4MMZB 2RNLA 3LN0A 3KQCL 1EAIC 2PR3B 3QMOA 5CISA 4RRZA 2OYEP 2FPBA 2XBXL 4X8SL 3O4PA 1YGCL 3HS6A 1Z6EL 4BTIA 1G1TA 3NJPC 3CENL 3LI3A 1UZKA 4BTTA 5CKQA 2F9BL 1C9UA 3EGFA 3V65B 2RHPA 2FZZL 3LTGD 4X8TL 4YZUB 1RWIA 5IKQA 1XKBA 4Z6AL 4ISIL 2I9BA 2BOXA 4A0PA 2UWOB 1IQIL 1DIYA 4M10A 1JL9A 3TH3L 1NPEA 3N8VA 1BF9A 2W8BA 1TOZA 3FW0A 4RRXA 1O5DL 4OTJA 4TGFA 4X8VL 4AQTA 1APOA 1U8CB 1PGEA 4YT7L 4XBMA 3NTBA 1EPGA 1B9WA 3I1CA 5KIRA 1EQGA 3ZYIB 1IQLL 4Y79B 3LI4A 4CUDA 3A9HA 4Z0KB 3WW9A 3CS7L 3TGFA 1MQ5L 2JKHL 3HO4A 5GTQA 2WPJE 4E1GA 4XLWA 3AMSA 2VVVL 2IAVA 3N8YA 4YT6L 3P5BL 2FP8A 1M1XB 4GN7A 1CCVA 1NFYB 4ISHL 4MMYB 2RA0L 2OJHA 3N8XA 3KQDL 2FD6A 1YUKB 2DDUA 2BQWA 2J38B 2YGOA 5IKTA 1FSBA 5E8DA 1CVUA 1YUGA 4CUFA 5GX2A 5JVYA 2GVVA 3A9GA 2MHPA 4JZDL 2G8SA 4XL1A 2VWMK 3FFGL 1H6LA 2P3UA 2EI6B 4LMFA 2J4IB 2GVXA 4JZFL 1YO8A 2ISMA 1ADXA 1NPEB 1K36A 3LC3B 2VJ3A 3BT2A 1LMJA 2V91A 1Z6CA 1CRUA 2VVUL 4G1MB 3V64C 5K0HB 1N1IA 1LPKA 1CEJA 3C9AC 1HREA 4PH9A 2BZ6L 2VWNL 3OLUA 3DEMA 1IQEL 1U67A 2WPIE 1QBIA 4HW6A 2BO2A 2YGPA 3KQEL 4ZH8B 2IAPA 1PRHA 3LAQA 2Y80B 4HHQA 2VVCK 2BMGA 2WG4B 1IVOC 2WFTA 2VAQA 3WWAA 2BOUA 3G4HA 3H5CB 2XBYL 2UWLB 3N8ZA 2IATA 5GX5A 2D1JB 2P93L 3GCWE 4ZLRA 2Y7ZB 1FAXL 3TK6B 3M36L 5I46L 1G2LB 1URKA 3LIWB 5D9BA 5GX4A 1IOXA 1UZPA 4Y71B 3AMRA 3HRPA 5FWWA 2W2NE 3FBYA 1NQLB 2J94B 2GHSA 2W2PE 3BT1A 2DG0A 5EX7A 2BOKL 3KRKA 1Q7FA 4GN8A 1ATBA 1A3PA 4CSYA 1LQDA 1POOA 3SOQA 2W2ME 1QFKL 2H9EL 3HO3A 5CKMA 1IGXA 2WPLE 4D0FA 1E1AA 5L2YL 2FLRL 1COUA 4Y7BB 1F0RB 1W8BL 5JB9E 2WFXB 3ASIA 3MQEA 4BTUA 5D9CA 1FE2A 3E5ZA 2EI8B 3Q6TA 2GD4A 2Y81B 2P3FN 2FLGA 4GN9A 1YUFA 1ATAA 4IYGA 2ADXA 3DR2A 1PXXA 3HPTA 4ZAEB 2P4OA 1KIGL 2XBWL 1NFWB 2WPME 2BOHA 1EMOA
chains in the Genus database with same CATH superfamily
1EUSA 3F6UL 2KB9A 4OTYA 1B9TA 1W0OA 2P3FL 2WPKE 2WZPP 1N6DA 4FPJA 5FZNA 3CA7A 4XYXA 3S2KA 4XJ8A 2F28A 2DSOA 4SLIA 1ZGKA 4I00A 1V1IA 1IP0A 3VNGA 1RWLA 2K2TA 4YZ3A 1V1HA 3ELAL 2FLBL 2ZW9A 1UZQA 4WEGA 4DG6A 1EBVA 4NGAL 1V3EA 2P16L 4MWXA 1SZBA 2BF6A 3NTGA 4JYUL 2HTQA 4ZY3A 5M1ZA 2KL7A 1TLEA 4JYVL 4MWUA 3Q3KB 1KLIL 3DASA 3H6JA 1OB1C 2KV4A 2Y5GL 1F8BA 2HT8A 4MX0A 2BERA 2F27A 2IAWA 5F9TA 1WHFA 1E8UA 2GVUA 4FOQA 4M11A 2XN4A 3R05A 3BPSE 1USXA 1G1SA 1S0JA 3GVLA 2H9EC 3TI6A 3K9XA 1CRZA 5H47A 1IVFA 1HAFA 3TBDA 1MS8A 5L30L 1IJQA 2IAOA 3TI4A 4AH4A 3HLIA 2QE8A 4GZOA 5JBAE 1F7EA 2P95L 1X2RA 2AH2A 5F72C 2FHRA 2POOA 2DYHA 4RS0A 4KS5A 3HS7A 1FAKL 3ZYGA 1KLOA 1PFXL 3SREA 1LPZA 1ATDA 4FZHA 4YZ2A 1SNTA 3L6VA 3GISX 1HRFA 2Y5FL 3Q7DA 2NPRA 4JZEL 1EUTA 2P3TA 1NFXB 4K1IA 2HOXA 4Y6DB 5KN5C 4XJWA 1HX2A 2F11A 2WPHE 2X9MA 1N1SA 2F26A 1JBUL 4M4VA 1IQML 1G2MB 2MGRA 1DX5I 1F8DA 4GNCA 3LC5B 2VWOL 4WA3A 1V04A 3CL0A 4YZ4A 2P26A 3KK6A 1HZ8A 1AUTL 6COXA 2JJLA 4CPNA 1XFEA 2PHBB 3H71A 5IKVA 1NMBN 4XJZA 2GVWA 4Z0LA 1CQ1A 1TPGA 2Y38A 2XC0L 3G4EA 1LPGA 4FPEA 4FOWA 4QN5A 3LN1A 3HS5A 1Z4VA 2WOZA 1NFUB 1HCGB 1IQJL 1IOEL 2IAXA 4YW1A 3U73A 3QH0A 2VK7A 1EGFA 2I9AA 2W20A 3PJQA 2BT8A 4GZPA 4GJTA 4QN7A 2QWFA 3II7A 1NCBN 1V0FA 4NA9L 3SOBB 4K1KA 4XIOA 3S8ZA 3IITB 1IQHL 1JV2B 3BYCA 3B7EA 1EZQB 1ATEA 3SW2A 1WCQA 2HTUA 4KS4A 4KS3A 4X4AA 5NN9A 4N1BA 2DG1A 3TI8A 1IQGL 3N8WA 2F12A 1EPHA 3H72A 4YW3A 1USRA 2WYJB 5COXA 4IMBA 1N1TA 2BT7A 4YW4A 3SALA 1KSNB 3N8YB 4DGRA 3ZGCA 4JMLA 1RFNB 5IKRA 4G3NA 1NZIA 1N7DA 4MMXB 3HLHA 3RR3A 4R40A 3K39A 2HQSA 2W26B 4LORA 2VH6B 5FZJA 2FPCA 4MZAA 3SRGA 5GX1A 5JBCE 1INFA 2VSKA 4YY8A 3S94A 1J9CL 4CH9A 1FF7A 2Y5HL 5CKNA 1GK5A 2AEPA 1NMAN 5JBBE 3CL2A 1QIUA 3POYA 4WA5A 1CX2A 1NSBA 4IFNX 4MWLA 4XE9A 2IARA 4AGTA 2SIMA 4RRYA 2VVZA 1V0ZA 3SILA 3V1SA 4Y7AB 2BQ6A 4XOGA 2F29A 4GEZA 1HT8A 2G00L 4ZHAB 4X49A 1W21A 4GDJA 1ZI0A 4MWYA 3HO5A 1LK9A 2J95B 5D9DA 3S8VA 4XHXA 1APQA 3B69A 3KGGA 3TIAA 1EMNA 1HJ7A 1W0PA 3KYAA 4L7BA 2W86A 3GVKA 2XBVL 2OYUP 2VWDA 4HZVA 2HORA 1SLIA 4BDXA 1OFZA 2VWLL 3FVZA 4XJUA 1NNCA 4O5TA 3QCWA 3PGHA 3K3AA 2WYGB 4MC7A 1FJSL 2XC5L 1X2JA 1MS9A 1CCFA 1EPIA 1PTHA 4NCSA 2BQ7A 2BSFA 2VSMA 1MWEA 4RRWA 1CVMA 4FPLA 2XC4L 3K36A 4BXSA 1NCAN 1CQEA 2C4LA 2YA4A 4FPOB 2MGPA 6NN9A 1MS3A 4H52A 4XJ9A 1IQNL 2BZDA 2M74A 3Q6KA 1MOXC 2XZIA 1EQHA 4D4UA 1DVAL 5B2DA 1NSCA 1Z4YA 2QWEA 1E8VA 5JB8E 2W2QE 1NT0A 1K37A 4D90A 3TC9A 4BXWA 3CFWA 3TK5B 4FPCA 3FCSB 1A14N 1V3BA 1HT5A 4D0EA 1F0SB 1L5GB 1DQBA 1WHEA 4YW5A 1X7AL 2YA5A 4GU4A 2K2SB 2B7DL 2IAUA 1PJXA 1F7MA 1SO7A 4NG9L 3LTFB 1S18A 3NT1A 4FM5A 1W7XL 2QWIA 4HHOA 4CHBA 3U0SA 3O9JA 1IQKL 2UWPB 2W2OE 2WG3C 4BDWA 5JW1A 3SLIA 1IQFL 2VRSA 1S1DA 5GX3A 3F1SB 3ZYJB 2AGSA 1ZAQA 3SOVA 1NCCN 2PUQL 1I0UA 2HT5A 2W3IB 2Q1JB 1V3DA 1HAEA 2QWAA 1V2IA 1V3CA 2QWGA 3KQBL 3S6XA 4X47A 1MS1A 5HUNA 1N6FA 4CUEA 2F24A 4KS1A 3TIBA 2AYLA 1DILA 4Q1UA 3IJEB 4GNBA 4XILA 2EI7B 3KL6B 1LMMA 2W3KB 1DIMA 1F8EA 3BEQA 2RKCA 4WA4A 5HUMA 4CPMA 1EUUA 4D52B 1EPJA 1B9SA 4IFLX 4NC5A 3WN7A 2P28B 2XZJA 5FDQA 2W5NA 1N1YA 3M37L 3N8WB 1XDTR 4O02B 1VCUA 4CPLA 4L7DA 5FNQA 4Q6KA 1INHA 1IUBA 1XOEA 2F25A 1L7HA 4HZYA 2VH0B 4Y76B 5F1AA 3IAXA 4B7JA 4C1YB 4MWWA 4GB1A 3NN9A 1IGZA 2IASA 2YDTA 3GCXE 5JVZA 3ENSA 3NSSA 1Q4GA 2P94L 2TGFA 4ZXYL 2W8BB 1CVWL 2HTYA 2SILA 3D11A 4JF7A 4COXA 2IAQA 1XKAL 4A7IA 4GZQA 4K1HA 4UF7A 3TI3A 3U7UG 4O5SA 1G1RA 1KLJL 5F19A 2B8HA 4RUTA 4ZXXL 1NMCA 5FNRA 4BBWA 4D8SA 1V3XB 1IUCA 4AGIA 1QLGA 4FP3A 4YZ1A 3MDLA 1FFMA 1MQ6L 1INVA 1C5KA 1P0SL 2XZKA 3JU4A 1P9JA 5EGMB 3VNHA 3TZIA 1Z50A 3T1EA 4XJRA 3Q6PA 1L3YA 1DDXA 4HZZA 2J34B 1KKEA 3KCGL 4GNAA 2FLUX 3OLTA 4PWZA 1WU1B 2CJIB 2Y82B 4O1ZA 4C16A 4FPGA 1W8OA 1G1QA 2QWBA 4FOVA 4H53A 1MS0A 1UZJA 3LI5A 2FP9A 1KITA 2YA7A 5L2ZL 2IVZA 1C5MF 2Y7XB 4X8UL 4FPKA 4GDIA 2J2UB 3LN0A 2RNLA 4MMZB 3GVJA 3KQCL 5FNUA 1EAIC 2PR3B 3QMOA 5CISA 1MZ5A 4RRZA 2HU0A 3OPZA 2OYEP 2HTWA 4MWQA 2FPBA 2QWJA 5EO8A 2XBXL 4CPOA 4X8SL 1BJIA 1IVDA 4X6KA 1N6EA 4KS2A 3O4PA 1YGCL 3HS6A 1Z6EL 2QWKA 4XJAA 5JYYA 4BTIA 1E8TA 1NSDA 1G1TA 3NJPC 2W5OA 3CENL 3LI3A 2SLIA 5FNTA 1UZKA 4BTTA 1Z4WA 2VPJA 5CKQA 2F9BL 1C9UA 2VW2A 3EGFA 3V65B 4QNPA 2RHPA 2FZZL 3LTGD 4X8TL 2H2NA 4YZUB 1NN2A 4FP2A 4MZEA 1RWIA 1IVCA 3A71A 3ALWA 5IKQA 1XKBA 4Z6AL 4ISIL 2I9BA 2BOXA 1N1VA 4A0PA 2UWOB 1IQIL 4L7CA 4AHAA 1DIYA 4M10A 1JL9A 3TH3L 1WCSA 1NPEA 2W38A 2ZB5A 3N8VA 1BF9A 2VK6A 1TOZA 2VW1A 2VW0A 2W8BA 4RRXA 3FW0A 1O5DL 2YDPA 3SANA 4OTJA 4TGFA 4X8VL 4CSDA 4AQTA 1APOA 1U8CB 5HX0A 1PGEA 4YT7L 1MS5A 4XMIA 4XBMA 3NTBA 1EPGA 1B9WA 5CGJA 3I1CA 5KIRA 1EQGA 2F10A 3ZYIB 1F8CA 1XOGA 2HTVA 1IQLL 4Y79B 4MWRA 4GZTA 4CPZA 3LI4A 4CUDA 2YGQA 3A9HA 4Z0KB 1VCJA 4UOUA 3WW9A 3CS7L 3TGFA 4B7NA 4MWVA 1MQ5L 2JKHL 3HO4A 2VK5A 2WPJE 4QN4A 5GTQA 4E1GA 4XLWA 2A75A 3AMSA 3TI5A 2VVVL 2IAVA 3N8YA 4WEFA 2F13A 1A4GA 4YT6L 3P5BL 2FP8A 1M1XB 4GN7A 1CCVA 1NFYB 4ISHL 4MMYB 2RA0L 2OJHA 3N8XA 4K3YA 5HUKA 2BATA 3KQDL 2FD6A 2ZB6A 4B7MA 1YUKB 1WP5A 2DDUA 5HUGA 1S0IA 3A72A 2BQWA 2J38B 2YGOA 5IKTA 1W8NA 4FVKA 1FSBA 5E8DA 4XHBA 1CVUA 1YUGA 2C4AA 4CUFA 2HT7A 4MJUA 5GX2A 3K38A 1NCDN 5JVYA 2GVVA 3A9GA 2MHPA 4JZDL 2G8SA 4XL1A 2VWMK 3FFGL 2H2UA 1EURA 4MJVA 5FNSA 4ASCA 3UC1A 1H6LA 2P3UA 4FQ4A 1INYA 4HZXA 2QWDA 3D12A 1K32A 2EI6B 4LMFA 2J4IB 4FPHA 4GZWA 3CKZA 2JKBA 4XMBA 1V0EA 2GVXA 2ZWAA 4JZFL 1SLLA 4D52C 1YO8A 2ISMA 1ADXA 1Z4ZA 1NPEB 1K36A 3LC3B 2VJ3A 3ALXA 3BT2A 1LMJA 2V91A 1Z6CA 1CRUA 2VVUL 4G1MB 3V64C 5K0HB 4B7QA 4FJ6A 4FPYA 1N1IA 1LPKA 1CEJA 3C9AC 1Z4XA 1HREA 3CYEA 4PH9A 4FOYA 2BZ6L 2VWNL 3OLUA 3DEMA 2ZZKA 4FPFA 2QWCA 1IQEL 1U67A 2WPIE 1QBIA 4HW6A 2BO2A 2YGPA 3KQEL 2KNIA 4ZH8B 4MWJA 2IAPA 1INXA 1PRHA 3LAQA 2Z32A 2Y80B 4XMAA 3TICA 1SUUA 3K37A 2VVCK 2BMGA 2WG4B 1IVOC 2WFTA 1U6DX 2VAQA 4HHQA 4HIZA 4IFJA 4IN4A 2YA8A 3WWAA 2YA6A 3H73A 4J9TA 2F0ZA 2BOUA 3G4HA 3H5CB 2XBYL 1MS4A 4YW2A 2UWLB 1W1XA 3N8ZA 1MR5A 2IATA 2AEQA 5GX5A 3ADEA 2D1JB 2P93L 3GCWE 1L7FA 4ZLRA 2Y7ZB 4YZ5A 2HU4A 1FAXL 3INBA 4M4UA 3TK6B 3M36L 5I46L 1MZ6A 4M4NA 1NNBA 1G2LB 1URKA 3LIWB 5D9BA 5GX4A 1IOXA 1A4QA 2HTRA 4C1YA 1UZPA 4Y71B 2CMLA 3AMRA 3HRPA 4NN9A 1IVEA 5FWWA 2W2NE 3FBYA 1NQLB 2J94B 2GHSA 4HZWA 5B2CA 2W2PE 3BT1A 2DG0A 4XJQA 5EX7A 2BOKL 3KRKA 4ZGCA 1Q7FA 4GN8A 4B7RA 3WDZA 1IVGA 1ATBA 1A3PA 4CSYA 1LQDA 1POOA 3SOQA 2W2ME 1QFKL 2H9EL 4QN6A 3HO3A 5CKMA 4GZXA 1W20A 1IGXA 1IVBA 4XIKA 2WPLE 4CPYA 4D0FA 1E1AA 5L2YL 2FLRL 1COUA 4Y7BB 4M3MA 1F0RB 1W8BL 4IQKA 2XCYA 5JB9E 2WFXB 3ASIA 1L7GA 1INWA 3MQEA 3W09A 4D52A 4BTUA 4GZSA 5D9CA 1FE2A 3E5ZA 2EI8B 3Q6TA 1NNAA 2GD4A 2Y81B 4QN3A 2QWHA 2P3FN 2FLGA 4GN9A 1YUFA 1B9VA 1INGA 1ATAA 4IYGA 2ADXA 3DR2A 1PXXA 3O9KA 3HPTA 4ZAEB 2P4OA 3ZGDA 1KIGL 2XBWL 1NFWB 2WPME 3NO0A 4GU3A 2BOHA 4A94C 5EO7A 4K1JA 1EMOA 7NN9A
chains in the Genus database with same CATH topology
3F6UL 2KB9A 4OTYA 2P3FL 2WPKE 2WZPP 3CA7A 3S2KA 2DSOA 1IP0A 1RWLA 2K2TA 3ELAL 2FLBL 4DG6A 1UZQA 1EBVA 4NGAL 2P16L 1SZBA 3NTGA 4JYUL 2KL7A 1TLEA 4JYVL 3Q3KB 1KLIL 3DASA 1OB1C 2KV4A 2Y5GL 2IAWA 1WHFA 2GVUA 4M11A 3R05A 3BPSE 1G1SA 2H9EC 3K9XA 1CRZA 1HAFA 3TBDA 5L30L 1IJQA 2IAOA 3HLIA 2QE8A 5JBAE 1F7EA 2P95L 2POOA 4RS0A 3HS7A 1FAKL 3ZYGA 1KLOA 1PFXL 3SREA 1LPZA 1ATDA 3GISX 1HRFA 2Y5FL 3Q7DA 2NPRA 4JZEL 2P3TA 1NFXB 4Y6DB 5KN5C 1HX2A 2WPHE 1JBUL 1IQML 1G2MB 2MGRA 1DX5I 4GNCA 3LC5B 2VWOL 1V04A 2P26A 3KK6A 1HZ8A 1AUTL 6COXA 1XFEA 2PHBB 5IKVA 2GVWA 4Z0LA 1CQ1A 1TPGA 2Y38A 2XC0L 3G4EA 1LPGA 3LN1A 3HS5A 1NFUB 1HCGB 1IQJL 1IOEL 2IAXA 3U73A 3QH0A 1EGFA 2I9AA 4NA9L 3SOBB 3S8ZA 3IITB 1IQHL 1JV2B 3BYCA 1EZQB 1ATEA 3SW2A 2DG1A 1IQGL 3N8WA 1EPHA 2WYJB 5COXA 4IMBA 1KSNB 3N8YB 4JMLA 1RFNB 5IKRA 1NZIA 1N7DA 4MMXB 3HLHA 3RR3A 4R40A 2HQSA 2W26B 4LORA 2VH6B 2FPCA 3SRGA 5GX1A 5JBCE 3S94A 1J9CL 1FF7A 2Y5HL 5CKNA 1GK5A 5JBBE 3POYA 1CX2A 2IARA 4RRYA 3V1SA 4Y7AB 2BQ6A 1HT8A 2G00L 4ZHAB 3HO5A 2J95B 5D9DA 3S8VA 1APQA 3KGGA 1EMNA 1HJ7A 3KYAA 2W86A 2XBVL 2OYUP 4BDXA 3FVZA 2VWLL 4O5TA 3QCWA 3PGHA 2WYGB 1FJSL 2XC5L 1CCFA 1EPIA 1PTHA 2BQ7A 4RRWA 1CVMA 2XC4L 4BXSA 1CQEA 2MGPA 1IQNL 2M74A 3Q6KA 1MOXC 1EQHA 1DVAL 5JB8E 2W2QE 1NT0A 1K37A 4D90A 3TC9A 4BXWA 3CFWA 3TK5B 3FCSB 1HT5A 4D0EA 1F0SB 1L5GB 1DQBA 1WHEA 1X7AL 2K2SB 2B7DL 2IAUA 1PJXA 1F7MA 4NG9L 3LTFB 3NT1A 4FM5A 1W7XL 4HHOA 3U0SA 1IQKL 2UWPB 2W2OE 2WG3C 4BDWA 5JW1A 1IQFL 5GX3A 3F1SB 3ZYJB 1ZAQA 3SOVA 2PUQL 1I0UA 2W3IB 2Q1JB 1HAEA 3KQBL 3S6XA 4CUEA 2AYLA 4Q1UA 3IJEB 4GNBA 2EI7B 3KL6B 1LMMA 2W3KB 1EPJA 2P28B 5FDQA 3M37L 3N8WB 1XDTR 4O02B 2VH0B 4Y76B 5F1AA 3IAXA 1IGZA 2IASA 3GCXE 5JVZA 3ENSA 1Q4GA 2P94L 2TGFA 4ZXYL 2W8BB 1CVWL 4COXA 2IAQA 1XKAL 4A7IA 3U7UG 4O5SA 1G1RA 1KLJL 5F19A 4RUTA 4ZXXL 1V3XB 1QLGA 3MDLA 1FFMA 1MQ6L 1C5KA 1P0SL 1P9JA 5EGMB 3TZIA 3Q6PA 1L3YA 1DDXA 2J34B 3KCGL 4GNAA 3OLTA 4PWZA 1WU1B 2CJIB 2Y82B 4O1ZA 4C16A 1G1QA 1UZJA 3LI5A 2FP9A 5L2ZL 2IVZA 1C5MF 2Y7XB 4X8UL 2J2UB 4MMZB 2RNLA 3LN0A 3KQCL 1EAIC 2PR3B 3QMOA 5CISA 4RRZA 2OYEP 2FPBA 2XBXL 4X8SL 3O4PA 1YGCL 3HS6A 1Z6EL 4BTIA 1G1TA 3NJPC 3CENL 3LI3A 1UZKA 4BTTA 5CKQA 2F9BL 1C9UA 3EGFA 3V65B 2RHPA 2FZZL 3LTGD 4X8TL 4YZUB 1RWIA 5IKQA 1XKBA 4Z6AL 4ISIL 2I9BA 2BOXA 4A0PA 2UWOB 1IQIL 1DIYA 4M10A 1JL9A 3TH3L 1NPEA 3N8VA 1BF9A 2W8BA 1TOZA 3FW0A 4RRXA 1O5DL 4OTJA 4TGFA 4X8VL 4AQTA 1APOA 1U8CB 1PGEA 4YT7L 4XBMA 3NTBA 1EPGA 1B9WA 3I1CA 5KIRA 1EQGA 3ZYIB 1IQLL 4Y79B 3LI4A 4CUDA 2YGQA 3A9HA 4Z0KB 3WW9A 3CS7L 3TGFA 1MQ5L 2JKHL 3HO4A 5GTQA 2WPJE 4E1GA 4XLWA 3AMSA 2VVVL 2IAVA 3N8YA 4YT6L 3P5BL 2FP8A 1M1XB 4GN7A 1CCVA 1NFYB 4ISHL 4MMYB 2RA0L 2OJHA 3N8XA 3KQDL 2FD6A 1YUKB 2DDUA 2BQWA 2J38B 2YGOA 5IKTA 1FSBA 5E8DA 1CVUA 1YUGA 4CUFA 5GX2A 5JVYA 2GVVA 3A9GA 2MHPA 4JZDL 2G8SA 4XL1A 2VWMK 3FFGL 1H6LA 2P3UA 2EI6B 4LMFA 2J4IB 2GVXA 4JZFL 1YO8A 2ISMA 1ADXA 1NPEB 1K36A 3LC3B 2VJ3A 3BT2A 1LMJA 2V91A 1Z6CA 1CRUA 2VVUL 4G1MB 3V64C 5K0HB 1N1IA 1LPKA 1CEJA 3C9AC 1HREA 4PH9A 2BZ6L 2VWNL 3OLUA 3DEMA 1IQEL 1U67A 2WPIE 1QBIA 4HW6A 2BO2A 2YGPA 3KQEL 2KNIA 4ZH8B 2IAPA 1PRHA 3LAQA 2Y80B 4HHQA 2VVCK 2BMGA 2WG4B 1IVOC 2WFTA 2VAQA 3WWAA 2BOUA 3G4HA 3H5CB 2XBYL 2UWLB 3N8ZA 2IATA 5GX5A 2D1JB 2P93L 3GCWE 4ZLRA 2Y7ZB 1FAXL 3TK6B 3M36L 5I46L 1G2LB 1URKA 3LIWB 5D9BA 5GX4A 1IOXA 1UZPA 4Y71B 3AMRA 3HRPA 5FWWA 2W2NE 3FBYA 1NQLB 2J94B 2GHSA 2W2PE 3BT1A 2DG0A 5EX7A 2BOKL 3KRKA 1Q7FA 4GN8A 1ATBA 1A3PA 4CSYA 1LQDA 1POOA 3SOQA 2W2ME 1QFKL 2H9EL 3HO3A 5CKMA 1IGXA 2WPLE 4D0FA 1E1AA 5L2YL 2FLRL 1COUA 4Y7BB 1F0RB 1W8BL 5JB9E 2WFXB 3ASIA 3MQEA 4BTUA 5D9CA 1FE2A 3E5ZA 2EI8B 3Q6TA 2GD4A 2Y81B 2P3FN 2FLGA 4GN9A 1YUFA 1ATAA 4IYGA 2ADXA 3DR2A 1PXXA 3HPTA 4ZAEB 2P4OA 1KIGL 2XBWL 1NFWB 2WPME 4A94C 2BOHA 1EMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F6U L;  2KB9 A;  4OTY A;  2P3F L;  2WPK E;  3CA7 A;  3S2K A;  2DSO A;  1IP0 A;  1RWL A;  2K2T A;  3ELA L;  2FLB L;  4DG6 A;  1UZQ A;  1EBV A;  4NGA L;  2P16 L;  1SZB A;  3NTG A;  4JYU L;  2KL7 A;  1TLE A;  4JYV L;  3Q3K B;  1KLI L;  3DAS A;  1OB1 C;  2KV4 A;  2Y5G L;  2IAW A;  1WHF A;  2GVU A;  4M11 A;  3R05 A;  3BPS E;  1G1S A;  3K9X A;  1CRZ A;  1HAF A;  3TBD A;  5L30 L;  1IJQ A;  2IAO A;  3HLI A;  2QE8 A;  5JBA E;  1F7E A;  2P95 L;  2POO A;  4RS0 A;  3HS7 A;  1FAK L;  3ZYG A;  1KLO A;  1PFX L;  3SRE A;  1LPZ A;  1ATD A;  3GIS X;  1HRF A;  2Y5F L;  3Q7D A;  2NPR A;  4JZE L;  2P3T A;  1NFX B;  4Y6D B;  5KN5 C;  1HX2 A;  2WPH E;  1JBU L;  1IQM L;  1G2M B;  2MGR A;  1DX5 I;  4GNC A;  3LC5 B;  2VWO L;  1V04 A;  2P26 A;  3KK6 A;  1HZ8 A;  1AUT L;  6COX A;  1XFE A;  2PHB B;  5IKV A;  2GVW A;  4Z0L A;  1CQ1 A;  1TPG A;  2Y38 A;  2XC0 L;  3G4E A;  1LPG A;  3LN1 A;  3HS5 A;  1NFU B;  1HCG B;  1IQJ L;  1IOE L;  2IAX A;  3U73 A;  3QH0 A;  1EGF A;  2I9A A;  4NA9 L;  3SOB B;  3S8Z A;  3IIT B;  1IQH L;  1JV2 B;  3BYC A;  1EZQ B;  1ATE A;  3SW2 A;  2DG1 A;  1IQG L;  3N8W A;  1EPH A;  2WYJ B;  5COX A;  4IMB A;  1KSN B;  3N8Y B;  4JML A;  1RFN B;  5IKR A;  1NZI A;  1N7D A;  4MMX B;  3HLH A;  3RR3 A;  4R40 A;  2HQS A;  2W26 B;  4LOR A;  2VH6 B;  2FPC A;  3SRG A;  5GX1 A;  5JBC E;  3S94 A;  1J9C L;  1FF7 A;  2Y5H L;  5CKN A;  1GK5 A;  5JBB E;  3POY A;  1CX2 A;  2IAR A;  4RRY A;  3V1S A;  4Y7A B;  2BQ6 A;  1HT8 A;  2G00 L;  4ZHA B;  3HO5 A;  2J95 B;  5D9D A;  3S8V A;  1APQ A;  3KGG A;  1EMN A;  1HJ7 A;  3KYA A;  2W86 A;  2XBV L;  2OYU P;  4BDX A;  3FVZ A;  2VWL L;  4O5T A;  3QCW A;  3PGH A;  2WYG B;  1FJS L;  2XC5 L;  1CCF A;  1EPI A;  1PTH A;  2BQ7 A;  4RRW A;  1CVM A;  2XC4 L;  4BXS A;  1CQE A;  2MGP A;  1IQN L;  2M74 A;  3Q6K A;  1MOX C;  1EQH A;  1DVA L;  5JB8 E;  2W2Q E;  1NT0 A;  1K37 A;  4D90 A;  3TC9 A;  4BXW A;  3CFW A;  3TK5 B;  3FCS B;  1HT5 A;  4D0E A;  1F0S B;  1L5G B;  1DQB A;  1WHE A;  1X7A L;  2K2S B;  2B7D L;  2IAU A;  1PJX A;  1F7M A;  4NG9 L;  3LTF B;  3NT1 A;  4FM5 A;  1W7X L;  4HHO A;  3U0S A;  1IQK L;  2UWP B;  2W2O E;  2WG3 C;  4BDW A;  5JW1 A;  1IQF L;  5GX3 A;  3F1S B;  3ZYJ B;  1ZAQ A;  3SOV A;  2PUQ L;  1I0U A;  2W3I B;  2Q1J B;  1HAE A;  3KQB L;  4CUE A;  2AYL A;  4Q1U A;  3IJE B;  4GNB A;  2EI7 B;  3KL6 B;  2W3K B;  1EPJ A;  2P28 B;  5FDQ A;  3M37 L;  3N8W B;  1XDT R;  4O02 B;  2VH0 B;  4Y76 B;  5F1A A;  3IAX A;  1IGZ A;  2IAS A;  3GCX E;  5JVZ A;  3ENS A;  1Q4G A;  2P94 L;  2TGF A;  4ZXY L;  2W8B B;  1CVW L;  4COX A;  2IAQ A;  1XKA L;  4A7I A;  3U7U G;  4O5S A;  1G1R A;  1KLJ L;  5F19 A;  4RUT A;  4ZXX L;  1V3X B;  1QLG A;  3MDL A;  1FFM A;  1MQ6 L;  1C5K A;  1P0S L;  1P9J A;  5EGM B;  3TZI A;  3Q6P A;  1L3Y A;  1DDX A;  2J34 B;  3KCG L;  4GNA A;  3OLT A;  4PWZ A;  1WU1 B;  2CJI B;  2Y82 B;  4O1Z A;  4C16 A;  1G1Q A;  1UZJ A;  3LI5 A;  2FP9 A;  5L2Z L;  2IVZ A;  1C5M F;  2Y7X B;  4X8U L;  2J2U B;  4MMZ B;  2RNL A;  3LN0 A;  3KQC L;  1EAI C;  2PR3 B;  3QMO A;  5CIS A;  4RRZ A;  2OYE P;  2FPB A;  2XBX L;  4X8S L;  3O4P A;  1YGC L;  3HS6 A;  1Z6E L;  4BTI A;  1G1T A;  3NJP C;  3CEN L;  3LI3 A;  1UZK A;  4BTT A;  5CKQ A;  2F9B L;  1C9U A;  3EGF A;  3V65 B;  2RHP A;  2FZZ L;  3LTG D;  4X8T L;  4YZU B;  1RWI A;  5IKQ A;  1XKB A;  4Z6A L;  4ISI L;  2I9B A;  2BOX A;  4A0P A;  2UWO B;  1IQI L;  1DIY A;  4M10 A;  1JL9 A;  3TH3 L;  1NPE A;  3N8V A;  1BF9 A;  2W8B A;  1TOZ A;  3FW0 A;  4RRX A;  1O5D L;  4OTJ A;  4TGF A;  4X8V L;  4AQT A;  1APO A;  1U8C B;  1PGE A;  4YT7 L;  4XBM A;  3NTB A;  1EPG A;  1B9W A;  3I1C A;  5KIR A;  1EQG A;  3ZYI B;  1IQL L;  4Y79 B;  3LI4 A;  4CUD A;  3A9H A;  4Z0K B;  3WW9 A;  3CS7 L;  3TGF A;  1MQ5 L;  2JKH L;  3HO4 A;  5GTQ A;  2WPJ E;  4E1G A;  4XLW A;  3AMS A;  2VVV L;  2IAV A;  3N8Y A;  4YT6 L;  3P5B L;  2FP8 A;  1M1X B;  4GN7 A;  1CCV A;  1NFY B;  4ISH L;  4MMY B;  2RA0 L;  2OJH A;  3N8X A;  3KQD L;  2FD6 A;  1YUK B;  2DDU A;  2BQW A;  2J38 B;  2YGO A;  5IKT A;  1FSB A;  5E8D A;  1CVU A;  1YUG A;  4CUF A;  5GX2 A;  5JVY A;  2GVV A;  3A9G A;  2MHP A;  4JZD L;  2G8S A;  4XL1 A;  2VWM K;  3FFG L;  1H6L A;  2P3U A;  2EI6 B;  4LMF A;  2J4I B;  2GVX A;  4JZF L;  1YO8 A;  2ISM A;  1ADX A;  1NPE B;  1K36 A;  3LC3 B;  2VJ3 A;  3BT2 A;  1LMJ A;  2V91 A;  1Z6C A;  1CRU A;  2VVU L;  4G1M B;  3V64 C;  5K0H B;  1N1I A;  1LPK A;  1CEJ A;  3C9A C;  1HRE A;  4PH9 A;  2BZ6 L;  2VWN L;  3OLU A;  3DEM A;  1IQE L;  1U67 A;  2WPI E;  1QBI A;  4HW6 A;  2BO2 A;  2YGP A;  3KQE L;  4ZH8 B;  2IAP A;  1PRH A;  3LAQ A;  2Y80 B;  4HHQ A;  2VVC K;  2BMG A;  2WG4 B;  1IVO C;  2WFT A;  2VAQ A;  3WWA A;  2BOU A;  3G4H A;  3H5C B;  2XBY L;  2UWL B;  3N8Z A;  2IAT A;  5GX5 A;  2D1J B;  2P93 L;  3GCW E;  4ZLR A;  2Y7Z B;  1FAX L;  3TK6 B;  3M36 L;  5I46 L;  1G2L B;  1URK A;  3LIW B;  5D9B A;  5GX4 A;  1IOX A;  1UZP A;  4Y71 B;  3AMR A;  3HRP A;  5FWW A;  2W2N E;  3FBY A;  1NQL B;  2J94 B;  2GHS A;  2W2P E;  3BT1 A;  2DG0 A;  5EX7 A;  2BOK L;  3KRK A;  1Q7F A;  4GN8 A;  1ATB A;  1A3P A;  4CSY A;  1LQD A;  1POO A;  3SOQ A;  2W2M E;  1QFK L;  2H9E L;  3HO3 A;  5CKM A;  1IGX A;  2WPL E;  4D0F A;  1E1A A;  5L2Y L;  2FLR L;  1COU A;  4Y7B B;  1F0R B;  1W8B L;  5JB9 E;  2WFX B;  3ASI A;  3MQE A;  4BTU A;  5D9C A;  1FE2 A;  3E5Z A;  2EI8 B;  3Q6T A;  2GD4 A;  2Y81 B;  2P3F N;  2FLG A;  4GN9 A;  1YUF A;  1ATA A;  4IYG A;  2ADX A;  3DR2 A;  1PXX A;  3HPT A;  4ZAE B;  2P4O A;  1KIG L;  2XBW L;  1NFW B;  2WPM E;  2BOH A;  1EMO A; 
#chains in the Genus database with same CATH topology
 1EUS A;  3F6U L;  2KB9 A;  4OTY A;  1B9T A;  1W0O A;  2P3F L;  2WPK E;  2WZP P;  1N6D A;  4FPJ A;  5FZN A;  3CA7 A;  4XYX A;  3S2K A;  4XJ8 A;  2F28 A;  2DSO A;  4SLI A;  1ZGK A;  4I00 A;  1V1I A;  1IP0 A;  3VNG A;  1RWL A;  2K2T A;  4YZ3 A;  1V1H A;  3ELA L;  2FLB L;  2ZW9 A;  1UZQ A;  4WEG A;  4DG6 A;  1EBV A;  4NGA L;  1V3E A;  2P16 L;  4MWX A;  1SZB A;  2BF6 A;  3NTG A;  4JYU L;  2HTQ A;  4ZY3 A;  5M1Z A;  2KL7 A;  1TLE A;  4JYV L;  4MWU A;  3Q3K B;  1KLI L;  3DAS A;  3H6J A;  1OB1 C;  2KV4 A;  2Y5G L;  1F8B A;  2HT8 A;  4MX0 A;  2BER A;  2F27 A;  2IAW A;  5F9T A;  1WHF A;  1E8U A;  2GVU A;  4FOQ A;  4M11 A;  2XN4 A;  3R05 A;  3BPS E;  1USX A;  1G1S A;  1S0J A;  3GVL A;  2H9E C;  3TI6 A;  3K9X A;  1CRZ A;  5H47 A;  1IVF A;  1HAF A;  3TBD A;  1MS8 A;  5L30 L;  1IJQ A;  2IAO A;  3TI4 A;  4AH4 A;  3HLI A;  2QE8 A;  4GZO A;  5JBA E;  1F7E A;  2P95 L;  1X2R A;  2AH2 A;  5F72 C;  2FHR A;  2POO A;  2DYH A;  4RS0 A;  4KS5 A;  3HS7 A;  1FAK L;  3ZYG A;  1KLO A;  1PFX L;  3SRE A;  1LPZ A;  1ATD A;  4FZH A;  4YZ2 A;  1SNT A;  3L6V A;  3GIS X;  1HRF A;  2Y5F L;  3Q7D A;  2NPR A;  4JZE L;  1EUT A;  2P3T A;  1NFX B;  4K1I A;  2HOX A;  4Y6D B;  5KN5 C;  4XJW A;  1HX2 A;  2F11 A;  2WPH E;  2X9M A;  1N1S A;  2F26 A;  1JBU L;  4M4V A;  1IQM L;  1G2M B;  2MGR A;  1DX5 I;  1F8D A;  4GNC A;  3LC5 B;  2VWO L;  4WA3 A;  1V04 A;  3CL0 A;  4YZ4 A;  2P26 A;  3KK6 A;  1HZ8 A;  1AUT L;  6COX A;  2JJL A;  4CPN A;  1XFE A;  2PHB B;  3H71 A;  5IKV A;  1NMB N;  4XJZ A;  2GVW A;  4Z0L A;  1CQ1 A;  1TPG A;  2Y38 A;  2XC0 L;  3G4E A;  1LPG A;  4FPE A;  4FOW A;  4QN5 A;  3LN1 A;  3HS5 A;  1Z4V A;  2WOZ A;  1NFU B;  1HCG B;  1IQJ L;  1IOE L;  2IAX A;  4YW1 A;  3U73 A;  3QH0 A;  2VK7 A;  1EGF A;  2I9A A;  2W20 A;  3PJQ A;  2BT8 A;  4GZP A;  4GJT A;  4QN7 A;  2QWF A;  3II7 A;  1NCB N;  1V0F A;  4NA9 L;  3SOB B;  4K1K A;  4XIO A;  3S8Z A;  3IIT B;  1IQH L;  1JV2 B;  3BYC A;  3B7E A;  1EZQ B;  1ATE A;  3SW2 A;  1WCQ A;  2HTU A;  4KS4 A;  4KS3 A;  4X4A A;  5NN9 A;  4N1B A;  2DG1 A;  3TI8 A;  1IQG L;  3N8W A;  2F12 A;  1EPH A;  3H72 A;  4YW3 A;  1USR A;  2WYJ B;  5COX A;  4IMB A;  1N1T A;  2BT7 A;  4YW4 A;  3SAL A;  1KSN B;  3N8Y B;  4DGR A;  3ZGC A;  4JML A;  1RFN B;  5IKR A;  4G3N A;  1NZI A;  1N7D A;  4MMX B;  3HLH A;  3RR3 A;  4R40 A;  3K39 A;  2HQS A;  2W26 B;  4LOR A;  2VH6 B;  5FZJ A;  2FPC A;  4MZA A;  3SRG A;  5GX1 A;  5JBC E;  1INF A;  2VSK A;  4YY8 A;  3S94 A;  1J9C L;  4CH9 A;  1FF7 A;  2Y5H L;  5CKN A;  1GK5 A;  2AEP A;  1NMA N;  5JBB E;  3CL2 A;  1QIU A;  3POY A;  4WA5 A;  1CX2 A;  1NSB A;  4IFN X;  4MWL A;  4XE9 A;  2IAR A;  4AGT A;  2SIM A;  4RRY A;  2VVZ A;  1V0Z A;  3SIL A;  3V1S A;  4Y7A B;  2BQ6 A;  4XOG A;  2F29 A;  4GEZ A;  1HT8 A;  2G00 L;  4ZHA B;  4X49 A;  1W21 A;  4GDJ A;  1ZI0 A;  4MWY A;  3HO5 A;  1LK9 A;  2J95 B;  5D9D A;  3S8V A;  4XHX A;  1APQ A;  3B69 A;  3KGG A;  3TIA A;  1EMN A;  1HJ7 A;  1W0P A;  3KYA A;  4L7B A;  2W86 A;  3GVK A;  2XBV L;  2OYU P;  2VWD A;  4HZV A;  2HOR A;  1SLI A;  4BDX A;  1OFZ A;  2VWL L;  3FVZ A;  4XJU A;  1NNC A;  4O5T A;  3QCW A;  3PGH A;  3K3A A;  2WYG B;  4MC7 A;  1FJS L;  2XC5 L;  1X2J A;  1MS9 A;  1CCF A;  1EPI A;  1PTH A;  4NCS A;  2BQ7 A;  2BSF A;  2VSM A;  1MWE A;  4RRW A;  1CVM A;  4FPL A;  2XC4 L;  3K36 A;  4BXS A;  1NCA N;  1CQE A;  2C4L A;  2YA4 A;  4FPO B;  2MGP A;  6NN9 A;  1MS3 A;  4H52 A;  4XJ9 A;  1IQN L;  2BZD A;  2M74 A;  3Q6K A;  1MOX C;  2XZI A;  1EQH A;  4D4U A;  1DVA L;  5B2D A;  1NSC A;  1Z4Y A;  2QWE A;  1E8V A;  5JB8 E;  2W2Q E;  1NT0 A;  1K37 A;  4D90 A;  3TC9 A;  4BXW A;  3CFW A;  3TK5 B;  4FPC A;  3FCS B;  1A14 N;  1V3B A;  1HT5 A;  4D0E A;  1F0S B;  1L5G B;  1DQB A;  1WHE A;  4YW5 A;  1X7A L;  2YA5 A;  4GU4 A;  2K2S B;  2B7D L;  2IAU A;  1PJX A;  1F7M A;  1SO7 A;  4NG9 L;  3LTF B;  1S18 A;  3NT1 A;  4FM5 A;  1W7X L;  2QWI A;  4HHO A;  4CHB A;  3U0S A;  3O9J A;  1IQK L;  2UWP B;  2W2O E;  2WG3 C;  4BDW A;  5JW1 A;  3SLI A;  1IQF L;  2VRS A;  1S1D A;  5GX3 A;  3F1S B;  3ZYJ B;  2AGS A;  1ZAQ A;  3SOV A;  1NCC N;  2PUQ L;  1I0U A;  2HT5 A;  2W3I B;  2Q1J B;  1V3D A;  1HAE A;  2QWA A;  1V2I A;  1V3C A;  2QWG A;  3KQB L;  3S6X A;  4X47 A;  1MS1 A;  5HUN A;  1N6F A;  4CUE A;  2F24 A;  4KS1 A;  3TIB A;  2AYL A;  1DIL A;  4Q1U A;  3IJE B;  4GNB A;  4XIL A;  2EI7 B;  3KL6 B;  1LMM A;  2W3K B;  1DIM A;  1F8E A;  3BEQ A;  2RKC A;  4WA4 A;  5HUM A;  4CPM A;  1EUU A;  4D52 B;  1EPJ A;  1B9S A;  4IFL X;  4NC5 A;  3WN7 A;  2P28 B;  2XZJ A;  5FDQ A;  2W5N A;  1N1Y A;  3M37 L;  3N8W B;  1XDT R;  4O02 B;  1VCU A;  4CPL A;  4L7D A;  5FNQ A;  4Q6K A;  1INH A;  1IUB A;  1XOE A;  2F25 A;  1L7H A;  4HZY A;  2VH0 B;  4Y76 B;  5F1A A;  3IAX A;  4B7J A;  4C1Y B;  4MWW A;  4GB1 A;  3NN9 A;  1IGZ A;  2IAS A;  2YDT A;  3GCX E;  5JVZ A;  3ENS A;  3NSS A;  1Q4G A;  2P94 L;  2TGF A;  4ZXY L;  2W8B B;  1CVW L;  2HTY A;  2SIL A;  3D11 A;  4JF7 A;  4COX A;  2IAQ A;  1XKA L;  4A7I A;  4GZQ A;  4K1H A;  4UF7 A;  3TI3 A;  3U7U G;  4O5S A;  1G1R A;  1KLJ L;  5F19 A;  2B8H A;  4RUT A;  4ZXX L;  1NMC A;  5FNR A;  4BBW A;  4D8S A;  1V3X B;  1IUC A;  4AGI A;  1QLG A;  4FP3 A;  4YZ1 A;  3MDL A;  1FFM A;  1MQ6 L;  1INV A;  1C5K A;  1P0S L;  2XZK A;  3JU4 A;  1P9J A;  5EGM B;  3VNH A;  3TZI A;  1Z50 A;  3T1E A;  4XJR A;  3Q6P A;  1L3Y A;  1DDX A;  4HZZ A;  2J34 B;  1KKE A;  3KCG L;  4GNA A;  2FLU X;  3OLT A;  4PWZ A;  1WU1 B;  2CJI B;  2Y82 B;  4O1Z A;  4C16 A;  4FPG A;  1W8O A;  1G1Q A;  2QWB A;  4FOV A;  4H53 A;  1MS0 A;  1UZJ A;  3LI5 A;  2FP9 A;  1KIT A;  2YA7 A;  5L2Z L;  2IVZ A;  1C5M F;  2Y7X B;  4X8U L;  4FPK A;  4GDI A;  2J2U B;  3LN0 A;  2RNL A;  4MMZ B;  3GVJ A;  3KQC L;  5FNU A;  1EAI C;  2PR3 B;  3QMO A;  5CIS A;  1MZ5 A;  4RRZ A;  2HU0 A;  3OPZ A;  2OYE P;  2HTW A;  4MWQ A;  2FPB A;  2QWJ A;  5EO8 A;  2XBX L;  4CPO A;  4X8S L;  1BJI A;  1IVD A;  4X6K A;  1N6E A;  4KS2 A;  3O4P A;  1YGC L;  3HS6 A;  1Z6E L;  2QWK A;  4XJA A;  5JYY A;  4BTI A;  1E8T A;  1NSD A;  1G1T A;  3NJP C;  2W5O A;  3CEN L;  3LI3 A;  2SLI A;  5FNT A;  1UZK A;  4BTT A;  1Z4W A;  2VPJ A;  5CKQ A;  2F9B L;  1C9U A;  2VW2 A;  3EGF A;  3V65 B;  4QNP A;  2RHP A;  2FZZ L;  3LTG D;  4X8T L;  2H2N A;  4YZU B;  1NN2 A;  4FP2 A;  4MZE A;  1RWI A;  1IVC A;  3A71 A;  3ALW A;  5IKQ A;  1XKB A;  4Z6A L;  4ISI L;  2I9B A;  2BOX A;  1N1V A;  4A0P A;  2UWO B;  1IQI L;  4L7C A;  4AHA A;  1DIY A;  4M10 A;  1JL9 A;  3TH3 L;  1WCS A;  1NPE A;  2W38 A;  2ZB5 A;  3N8V A;  1BF9 A;  2VK6 A;  1TOZ A;  2VW1 A;  2VW0 A;  2W8B A;  4RRX A;  3FW0 A;  1O5D L;  2YDP A;  3SAN A;  4OTJ A;  4TGF A;  4X8V L;  4CSD A;  4AQT A;  1APO A;  1U8C B;  5HX0 A;  1PGE A;  4YT7 L;  1MS5 A;  4XMI A;  4XBM A;  3NTB A;  1EPG A;  1B9W A;  5CGJ A;  3I1C A;  5KIR A;  1EQG A;  2F10 A;  3ZYI B;  1F8C A;  1XOG A;  2HTV A;  1IQL L;  4Y79 B;  4MWR A;  4GZT A;  4CPZ A;  3LI4 A;  4CUD A;  2YGQ A;  3A9H A;  4Z0K B;  1VCJ A;  4UOU A;  3WW9 A;  3CS7 L;  3TGF A;  4B7N A;  4MWV A;  1MQ5 L;  2JKH L;  3HO4 A;  2VK5 A;  2WPJ E;  4QN4 A;  5GTQ A;  4E1G A;  4XLW A;  2A75 A;  3AMS A;  3TI5 A;  2VVV L;  2IAV A;  3N8Y A;  4WEF A;  2F13 A;  1A4G A;  4YT6 L;  3P5B L;  2FP8 A;  1M1X B;  4GN7 A;  1CCV A;  1NFY B;  4ISH L;  4MMY B;  2RA0 L;  2OJH A;  3N8X A;  4K3Y A;  5HUK A;  2BAT A;  3KQD L;  2FD6 A;  2ZB6 A;  4B7M A;  1YUK B;  1WP5 A;  2DDU A;  5HUG A;  1S0I A;  3A72 A;  2BQW A;  2J38 B;  2YGO A;  5IKT A;  1W8N A;  4FVK A;  1FSB A;  5E8D A;  4XHB A;  1CVU A;  1YUG A;  2C4A A;  4CUF A;  2HT7 A;  4MJU A;  5GX2 A;  3K38 A;  1NCD N;  5JVY A;  2GVV A;  3A9G A;  2MHP A;  4JZD L;  2G8S A;  4XL1 A;  2VWM K;  3FFG L;  2H2U A;  1EUR A;  4MJV A;  5FNS A;  4ASC A;  3UC1 A;  1H6L A;  2P3U A;  4FQ4 A;  1INY A;  4HZX A;  2QWD A;  3D12 A;  1K32 A;  2EI6 B;  4LMF A;  2J4I B;  4FPH A;  4GZW A;  3CKZ A;  2JKB A;  4XMB A;  1V0E A;  2GVX A;  2ZWA A;  4JZF L;  1SLL A;  4D52 C;  1YO8 A;  2ISM A;  1ADX A;  1Z4Z A;  1NPE B;  1K36 A;  3LC3 B;  2VJ3 A;  3ALX A;  3BT2 A;  1LMJ A;  2V91 A;  1Z6C A;  1CRU A;  2VVU L;  4G1M B;  3V64 C;  5K0H B;  4B7Q A;  4FJ6 A;  4FPY A;  1N1I A;  1LPK A;  1CEJ A;  3C9A C;  1Z4X A;  1HRE A;  3CYE A;  4PH9 A;  4FOY A;  2BZ6 L;  2VWN L;  3OLU A;  3DEM A;  2ZZK A;  4FPF A;  2QWC A;  1IQE L;  1U67 A;  2WPI E;  1QBI A;  4HW6 A;  2BO2 A;  2YGP A;  3KQE L;  2KNI A;  4ZH8 B;  4MWJ A;  2IAP A;  1INX A;  1PRH A;  3LAQ A;  2Z32 A;  2Y80 B;  4XMA A;  3TIC A;  1SUU A;  3K37 A;  2VVC K;  2BMG A;  2WG4 B;  1IVO C;  2WFT A;  1U6D X;  2VAQ A;  4HHQ A;  4HIZ A;  4IFJ A;  4IN4 A;  2YA8 A;  3WWA A;  2YA6 A;  3H73 A;  4J9T A;  2F0Z A;  2BOU A;  3G4H A;  3H5C B;  2XBY L;  1MS4 A;  4YW2 A;  2UWL B;  1W1X A;  3N8Z A;  1MR5 A;  2IAT A;  2AEQ A;  5GX5 A;  3ADE A;  2D1J B;  2P93 L;  3GCW E;  1L7F A;  4ZLR A;  2Y7Z B;  4YZ5 A;  2HU4 A;  1FAX L;  3INB A;  4M4U A;  3TK6 B;  3M36 L;  5I46 L;  1MZ6 A;  4M4N A;  1NNB A;  1G2L B;  1URK A;  3LIW B;  5D9B A;  5GX4 A;  1IOX A;  1A4Q A;  2HTR A;  4C1Y A;  1UZP A;  4Y71 B;  2CML A;  3AMR A;  3HRP A;  4NN9 A;  1IVE A;  5FWW A;  2W2N E;  3FBY A;  1NQL B;  2J94 B;  2GHS A;  4HZW A;  5B2C A;  2W2P E;  3BT1 A;  2DG0 A;  4XJQ A;  5EX7 A;  2BOK L;  3KRK A;  4ZGC A;  1Q7F A;  4GN8 A;  4B7R A;  3WDZ A;  1IVG A;  1ATB A;  1A3P A;  4CSY A;  1LQD A;  1POO A;  3SOQ A;  2W2M E;  1QFK L;  2H9E L;  4QN6 A;  3HO3 A;  5CKM A;  4GZX A;  1W20 A;  1IGX A;  1IVB A;  4XIK A;  2WPL E;  4CPY A;  4D0F A;  1E1A A;  5L2Y L;  2FLR L;  1COU A;  4Y7B B;  4M3M A;  1F0R B;  1W8B L;  4IQK A;  2XCY A;  5JB9 E;  2WFX B;  3ASI A;  1L7G A;  1INW A;  3MQE A;  3W09 A;  4D52 A;  4BTU A;  4GZS A;  5D9C A;  1FE2 A;  3E5Z A;  2EI8 B;  3Q6T A;  1NNA A;  2GD4 A;  2Y81 B;  4QN3 A;  2QWH A;  2P3F N;  2FLG A;  4GN9 A;  1YUF A;  1B9V A;  1ING A;  1ATA A;  4IYG A;  2ADX A;  3DR2 A;  1PXX A;  3O9K A;  3HPT A;  4ZAE B;  2P4O A;  3ZGD A;  1KIG L;  2XBW L;  1NFW B;  2WPM E;  3NO0 A;  4GU3 A;  2BOH A;  4A94 C;  5EO7 A;  4K1J A;  1EMO A;  7NN9 A; 
#chains in the Genus database with same CATH homology
 3F6U L;  2KB9 A;  4OTY A;  2P3F L;  2WPK E;  2WZP P;  3CA7 A;  3S2K A;  2DSO A;  1IP0 A;  1RWL A;  2K2T A;  3ELA L;  2FLB L;  4DG6 A;  1UZQ A;  1EBV A;  4NGA L;  2P16 L;  1SZB A;  3NTG A;  4JYU L;  2KL7 A;  1TLE A;  4JYV L;  3Q3K B;  1KLI L;  3DAS A;  1OB1 C;  2KV4 A;  2Y5G L;  2IAW A;  1WHF A;  2GVU A;  4M11 A;  3R05 A;  3BPS E;  1G1S A;  2H9E C;  3K9X A;  1CRZ A;  1HAF A;  3TBD A;  5L30 L;  1IJQ A;  2IAO A;  3HLI A;  2QE8 A;  5JBA E;  1F7E A;  2P95 L;  2POO A;  4RS0 A;  3HS7 A;  1FAK L;  3ZYG A;  1KLO A;  1PFX L;  3SRE A;  1LPZ A;  1ATD A;  3GIS X;  1HRF A;  2Y5F L;  3Q7D A;  2NPR A;  4JZE L;  2P3T A;  1NFX B;  4Y6D B;  5KN5 C;  1HX2 A;  2WPH E;  1JBU L;  1IQM L;  1G2M B;  2MGR A;  1DX5 I;  4GNC A;  3LC5 B;  2VWO L;  1V04 A;  2P26 A;  3KK6 A;  1HZ8 A;  1AUT L;  6COX A;  1XFE A;  2PHB B;  5IKV A;  2GVW A;  4Z0L A;  1CQ1 A;  1TPG A;  2Y38 A;  2XC0 L;  3G4E A;  1LPG A;  3LN1 A;  3HS5 A;  1NFU B;  1HCG B;  1IQJ L;  1IOE L;  2IAX A;  3U73 A;  3QH0 A;  1EGF A;  2I9A A;  4NA9 L;  3SOB B;  3S8Z A;  3IIT B;  1IQH L;  1JV2 B;  3BYC A;  1EZQ B;  1ATE A;  3SW2 A;  2DG1 A;  1IQG L;  3N8W A;  1EPH A;  2WYJ B;  5COX A;  4IMB A;  1KSN B;  3N8Y B;  4JML A;  1RFN B;  5IKR A;  1NZI A;  1N7D A;  4MMX B;  3HLH A;  3RR3 A;  4R40 A;  2HQS A;  2W26 B;  4LOR A;  2VH6 B;  2FPC A;  3SRG A;  5GX1 A;  5JBC E;  3S94 A;  1J9C L;  1FF7 A;  2Y5H L;  5CKN A;  1GK5 A;  5JBB E;  3POY A;  1CX2 A;  2IAR A;  4RRY A;  3V1S A;  4Y7A B;  2BQ6 A;  1HT8 A;  2G00 L;  4ZHA B;  3HO5 A;  2J95 B;  5D9D A;  3S8V A;  1APQ A;  3KGG A;  1EMN A;  1HJ7 A;  3KYA A;  2W86 A;  2XBV L;  2OYU P;  4BDX A;  3FVZ A;  2VWL L;  4O5T A;  3QCW A;  3PGH A;  2WYG B;  1FJS L;  2XC5 L;  1CCF A;  1EPI A;  1PTH A;  2BQ7 A;  4RRW A;  1CVM A;  2XC4 L;  4BXS A;  1CQE A;  2MGP A;  1IQN L;  2M74 A;  3Q6K A;  1MOX C;  1EQH A;  1DVA L;  5JB8 E;  2W2Q E;  1NT0 A;  1K37 A;  4D90 A;  3TC9 A;  4BXW A;  3CFW A;  3TK5 B;  3FCS B;  1HT5 A;  4D0E A;  1F0S B;  1L5G B;  1DQB A;  1WHE A;  1X7A L;  2K2S B;  2B7D L;  2IAU A;  1PJX A;  1F7M A;  4NG9 L;  3LTF B;  3NT1 A;  4FM5 A;  1W7X L;  4HHO A;  3U0S A;  1IQK L;  2UWP B;  2W2O E;  2WG3 C;  4BDW A;  5JW1 A;  1IQF L;  5GX3 A;  3F1S B;  3ZYJ B;  1ZAQ A;  3SOV A;  2PUQ L;  1I0U A;  2W3I B;  2Q1J B;  1HAE A;  3KQB L;  3S6X A;  4CUE A;  2AYL A;  4Q1U A;  3IJE B;  4GNB A;  2EI7 B;  3KL6 B;  1LMM A;  2W3K B;  1EPJ A;  2P28 B;  5FDQ A;  3M37 L;  3N8W B;  1XDT R;  4O02 B;  2VH0 B;  4Y76 B;  5F1A A;  3IAX A;  1IGZ A;  2IAS A;  3GCX E;  5JVZ A;  3ENS A;  1Q4G A;  2P94 L;  2TGF A;  4ZXY L;  2W8B B;  1CVW L;  4COX A;  2IAQ A;  1XKA L;  4A7I A;  3U7U G;  4O5S A;  1G1R A;  1KLJ L;  5F19 A;  4RUT A;  4ZXX L;  1V3X B;  1QLG A;  3MDL A;  1FFM A;  1MQ6 L;  1C5K A;  1P0S L;  1P9J A;  5EGM B;  3TZI A;  3Q6P A;  1L3Y A;  1DDX A;  2J34 B;  3KCG L;  4GNA A;  3OLT A;  4PWZ A;  1WU1 B;  2CJI B;  2Y82 B;  4O1Z A;  4C16 A;  1G1Q A;  1UZJ A;  3LI5 A;  2FP9 A;  5L2Z L;  2IVZ A;  1C5M F;  2Y7X B;  4X8U L;  2J2U B;  4MMZ B;  2RNL A;  3LN0 A;  3KQC L;  1EAI C;  2PR3 B;  3QMO A;  5CIS A;  4RRZ A;  2OYE P;  2FPB A;  2XBX L;  4X8S L;  3O4P A;  1YGC L;  3HS6 A;  1Z6E L;  4BTI A;  1G1T A;  3NJP C;  3CEN L;  3LI3 A;  1UZK A;  4BTT A;  5CKQ A;  2F9B L;  1C9U A;  3EGF A;  3V65 B;  2RHP A;  2FZZ L;  3LTG D;  4X8T L;  4YZU B;  1RWI A;  5IKQ A;  1XKB A;  4Z6A L;  4ISI L;  2I9B A;  2BOX A;  4A0P A;  2UWO B;  1IQI L;  1DIY A;  4M10 A;  1JL9 A;  3TH3 L;  1NPE A;  3N8V A;  1BF9 A;  2W8B A;  1TOZ A;  3FW0 A;  4RRX A;  1O5D L;  4OTJ A;  4TGF A;  4X8V L;  4AQT A;  1APO A;  1U8C B;  1PGE A;  4YT7 L;  4XBM A;  3NTB A;  1EPG A;  1B9W A;  3I1C A;  5KIR A;  1EQG A;  3ZYI B;  1IQL L;  4Y79 B;  3LI4 A;  4CUD A;  2YGQ A;  3A9H A;  4Z0K B;  3WW9 A;  3CS7 L;  3TGF A;  1MQ5 L;  2JKH L;  3HO4 A;  5GTQ A;  2WPJ E;  4E1G A;  4XLW A;  3AMS A;  2VVV L;  2IAV A;  3N8Y A;  4YT6 L;  3P5B L;  2FP8 A;  1M1X B;  4GN7 A;  1CCV A;  1NFY B;  4ISH L;  4MMY B;  2RA0 L;  2OJH A;  3N8X A;  3KQD L;  2FD6 A;  1YUK B;  2DDU A;  2BQW A;  2J38 B;  2YGO A;  5IKT A;  1FSB A;  5E8D A;  1CVU A;  1YUG A;  4CUF A;  5GX2 A;  5JVY A;  2GVV A;  3A9G A;  2MHP A;  4JZD L;  2G8S A;  4XL1 A;  2VWM K;  3FFG L;  1H6L A;  2P3U A;  2EI6 B;  4LMF A;  2J4I B;  2GVX A;  4JZF L;  1YO8 A;  2ISM A;  1ADX A;  1NPE B;  1K36 A;  3LC3 B;  2VJ3 A;  3BT2 A;  1LMJ A;  2V91 A;  1Z6C A;  1CRU A;  2VVU L;  4G1M B;  3V64 C;  5K0H B;  1N1I A;  1LPK A;  1CEJ A;  3C9A C;  1HRE A;  4PH9 A;  2BZ6 L;  2VWN L;  3OLU A;  3DEM A;  1IQE L;  1U67 A;  2WPI E;  1QBI A;  4HW6 A;  2BO2 A;  2YGP A;  3KQE L;  2KNI A;  4ZH8 B;  2IAP A;  1PRH A;  3LAQ A;  2Y80 B;  4HHQ A;  2VVC K;  2BMG A;  2WG4 B;  1IVO C;  2WFT A;  2VAQ A;  3WWA A;  2BOU A;  3G4H A;  3H5C B;  2XBY L;  2UWL B;  3N8Z A;  2IAT A;  5GX5 A;  2D1J B;  2P93 L;  3GCW E;  4ZLR A;  2Y7Z B;  1FAX L;  3TK6 B;  3M36 L;  5I46 L;  1G2L B;  1URK A;  3LIW B;  5D9B A;  5GX4 A;  1IOX A;  1UZP A;  4Y71 B;  3AMR A;  3HRP A;  5FWW A;  2W2N E;  3FBY A;  1NQL B;  2J94 B;  2GHS A;  2W2P E;  3BT1 A;  2DG0 A;  5EX7 A;  2BOK L;  3KRK A;  1Q7F A;  4GN8 A;  1ATB A;  1A3P A;  4CSY A;  1LQD A;  1POO A;  3SOQ A;  2W2M E;  1QFK L;  2H9E L;  3HO3 A;  5CKM A;  1IGX A;  2WPL E;  4D0F A;  1E1A A;  5L2Y L;  2FLR L;  1COU A;  4Y7B B;  1F0R B;  1W8B L;  5JB9 E;  2WFX B;  3ASI A;  3MQE A;  4BTU A;  5D9C A;  1FE2 A;  3E5Z A;  2EI8 B;  3Q6T A;  2GD4 A;  2Y81 B;  2P3F N;  2FLG A;  4GN9 A;  1YUF A;  1ATA A;  4IYG A;  2ADX A;  3DR2 A;  1PXX A;  3HPT A;  4ZAE B;  2P4O A;  1KIG L;  2XBW L;  1NFW B;  2WPM E;  4A94 C;  2BOH A;  1EMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...