3SOVA

The structure of a beta propeller domain in complex with peptide s
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
306
structure length
306
Chain Sequence
b'APLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low-density lipoprotein receptor-related protein 6
publication title Wnt antagonists bind through a short peptide to the first beta-propeller domain of LRP5/6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/antagonist
total genus 80
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00058 Ldl_recept_b Low-density lipoprotein receptor repeat class B
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3sovA02
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3sovA01
1G1TA 1P9JA 2IARA 1LPGA 1G2MB 2W26B 4TGFA 4XL1A 2WG4B 5JVZA 4JZFL 4MMZB 2W8BA 2VWMK 4LMFA 2VH0B 3LTGD 3AMSA 1KLOA 3IAXA 2NPRA 4ZAEB 2P3FL 1YUGA 2DDUA 4Y7AB 3A9HA 1C9UA 3ZYJB 3POYA 3N8WA 1DVAL 3BT2A 3ELAL 4D0FA 1G1QA 1PXXA 1HJ7A 2FLRL 4X8SL 3KQDL 3ZYGA 2VWOL 3KRKA 1CQEA 1TOZA 3SOQA 1BF9A 3TK6B 3QCWA 4COXA 2IVZA 3R05A 2WPIE 2J4IB 2PHBB 2BOUA 4NGAL 2VVCK 3KCGL 4LORA 2GVXA 2KL7A 1COUA 5L2ZL 2GVWA 1A3PA 3SW2A 2J2UB 3ASIA 1NZIA 1ATAA 2YGOA 1K36A 1UZQA 1PFXL 1H6LA 4O5TA 2Y38A 2KB9A 3BPSE 3N8XA 2IATA 2W2ME 2KV4A 2P95L 1FF7A 2AYLA 1E1AA 2EI8B 3TC9A 1EQHA 3OLUA 2Q1JB 1NPEA 3G4HA 2W3IB 3KYAA 2XBVL 1FE2A 1EMOA 1IQFL 4Y7BB 2FP9A 1EPHA 1SZBA 2FLBL 2BO2A 3NT1A 2WYGB 2V91A 3CA7A 3V65B 3WWAA 4O5SA 1HX2A 3O4PA 2WG3C 3KQCL 4OTYA 2ISMA 4CUFA 1TPGA 3S8VA 1HAEA 2J95B 3CENL 1JV2B 2EI6B 1M1XB 1OB1C 4E1GA 1HREA 5D9CA 4BXSA 2B7DL 3HO3A 2W2OE 3KGGA 2K2SB 1K37A 1KLJL 4JZEL 3H5CB 2GHSA 2WPME 1PGEA 2P93L 1IQLL 2Y80B 4ZXYL 4YT7L 4GN8A 1HT5A 1IQIL 4X8VL 4GNBA 2MGPA 1WHEA 2WPJE 1GK5A 1PTHA 1MOXC 2GVUA 4CSYA 1CCFA 1V3XB 5JW1A 3LI5A 5IKVA 1B9WA 1I0UA 1CVWL 4NA9L 2YGPA 2W2NE 5KIRA 1HRFA 3N8ZA 1Q7FA 2IAXA 1ZAQA 2P3TA 4RS0A 1NFUB 1IQNL 4JYUL 2XBXL 1YGCL 4Y76B 3ZYIB 2FLGA 1EAIC 1RWLA 1WHFA 1NFYB 4Q1UA 3P5BL 1G2LB 4BTTA 5KN5C 5GX1A 5CKNA 1C5MF 1CCVA 3NTBA 5CKMA 3U7UG 2PUQL 2BZ6L 1HZ8A 5L30L 1C5KA 2Y5FL 2Y82B 4XLWA 1RFNB 5IKTA 3ENSA 2MHPA 3DEMA 2P94L 4JZDL 2OJHA 2IAWA 1O5DL 3LAQA 4R40A 4ZLRA 1YUKB 4GNAA 4BXWA 3I1CA 3KK6A 3HLHA 3KL6B 2P3FN 3TBDA 1EGFA 2XBWL 4Y79B 5JBBE 2UWLB 1LPZA 5JBAE 3RR3A 2P26A 2Y81B 4ISHL 1U67A 2FPCA 1YO8A 5GTQA 1P0SL 2IAPA 4HHOA 5D9DA 2JKHL 4JYVL 2XBYL 5JVYA 1CX2A 1EBVA 5COXA 3LIWB 3DR2A 4Z0LA 3S2KA 2WPLE 4YT6L 4Z0KB 3FVZA 1IQJL 3IJEB 4X8TL 1G1SA 4RUTA 1NQLB 5EX7A 2UWPB 4OTJA 5FDQA 2DG0A 2W8BB 1IQEL 3GCWE 3IITB 2BOHA 3BT1A 1JBUL 3M36L 3SREA 1IOXA 5E8DA 4D90A 2P4OA 1X7AL 4BTIA 3U73A 4GNCA 2GD4A 4MMYB 1XDTR 3N8WB 2FPBA 1ATBA 3CFWA 4AQTA 1V04A 2QE8A 3DASA 1CVUA 3V1SA 4ZH8B 3GISX 3FBYA 1F0SB 5F19A 2F9BL 4D0EA 1IQML 2P28B 1U8CB 4IYGA 2IASA 1EQGA 2Y5GL 1KLIL 3PGHA 1L5GB 1NT0A 4PH9A 2POOA 4JMLA 1ADXA 1APOA 3NTGA 1KIGL 2RHPA 4BDWA 2W2PE 4MMXB 4M10A 1QLGA 1EPJA 2K2TA 5JBCE 2BOKL 4FM5A 1LQDA 3HRPA 1TLEA 1APQA 3S8ZA 3CS7L 2IAOA 1DQBA 5GX4A 1HCGB 3HS7A 5EGMB 2XC0L 1UZJA 4RRXA 1IQKL 2Y5HL 2IAUA 1YUFA 2TGFA 2BOXA 3E5ZA 1Z6EL 1FFMA 2OYUP 5IKRA 2OYEP 5CISA 4HW6A 2Y7ZB 5CKQA 4HHQA 5GX3A 3V64C 4BDXA 1MQ6L 2I9AA 2G00L 4Y71B 6COXA 3LN1A 3S94A 3LC3B 3QH0A 1XFEA 2H9EL 5L2YL 1IGXA 3FFGL 2FZZL 1UZKA 3HLIA 4GN7A 3WW9A 2DSOA 1NFXB 2G8SA 2RNLA 5JB9E 1IQGL 3N8VA 1W7XL 3Q7DA 1PJXA 3K9XA 3Q3KB 2VH6B 3M37L 2FP8A 3HS5A 1XKBA 3TK5B 1J9CL 1UZPA 2I9BA 3N8YB 4DG6A 1LMJA 1L3YA 2P16L 3MQEA 3FW0A 5K0HB 2W3KB 4GN9A 3HO4A 2J38B 1IGZA 4BTUA 1PRHA 1CEJA 2Y7XB 3LI4A 2WPHE 2RA0L 2J34B 1HAFA 3Q6PA 4X8UL 4CUEA 2P3UA 4RRYA 3AMRA 5D9BA 1EPIA 1IJQA 1FJSL 4XBMA 2GVVA 3BYCA 1WU1B 4O02B 2PR3B 1IVOC 4NG9L 3Q6KA 3SOVA 4G1MB 2D1JB 3Q6TA 3F6UL 1DX5I 1F7MA 1FAXL 2BQWA 1EMNA 3C9AC 1MQ5L 2MGRA 5GX2A 3GCXE 4ISIL 1CQ1A 3HS6A 5JB8E 1ATEA 2WYJB 1LPKA 2XC4L 3LC5B 2W2QE 1CRZA 2HQSA 1NFWB 4A7IA 1W8BL 4A0PA 3LN0A 4ZXXL 4M11A 3LTFB 1N1IA 3TZIA 4C16A 3EGFA 2ADXA 3HPTA 4Z6AL 2WPKE 2DG1A 2BMGA 4RRWA 2UWOB 1FAKL 2EI7B 2VVVL 4YZUB 2WFXB 1F0RB 3LI3A 2XC5L 5FWWA 1XKAL 2FD6A 2IAQA 2VJ3A 2W86A 1RWIA 1N7DA 1ATDA 1CRUA 1IOEL 4O1ZA 5I46L 4ZHAB 1EZQB 1QBIA 2IAVA 1FSBA 2CJIB 1DDXA 2VWLL 1QFKL 3FCSB 2VWNL 3G4EA 3TGFA 3OLTA 1AUTL 3TH3L 3HO5A 1URKA 3KQEL 1F7EA 3N8YA 2VAQA 4Y6DB 3MDLA 2M74A 1IQHL 3SRGA 3QMOA 4CUDA 3A9GA 2J94B 4PWZA 4RRZA 2WFTA 1KSNB 3SOBB 4IMBA 1EPGA 1CVMA 1G1RA 3U0SA 2BQ7A 1DIYA 1Z6CA 2BQ6A 1Q4GA 2VVUL 3F1SB 5IKQA 5F1AA 1IP0A 1POOA 1HT8A 1JL9A 3NJPC 3KQBL 5GX5A 1NPEB
chains in the Genus database with same CATH superfamily
1G1TA 1P9JA 2IARA 4MZAA 1NMCA 1LPGA 1G2MB 2W26B 2F26A 2FHRA 4QN3A 2HTQA 4FPJA 1INFA 4TGFA 4XL1A 2WG4B 4FJ6A 5JVZA 4GDJA 2HORA 4JZFL 4MMZB 1NSCA 4GJTA 5FZJA 2W8BA 5NN9A 2VWMK 4LMFA 2VH0B 3LTGD 2RKCA 3AMSA 4XIKA 3W09A 1KLOA 3IAXA 2NPRA 4ZAEB 2P3FL 1YUGA 3WN7A 2DDUA 4Y7AB 2WOZA 3A9HA 2VRSA 4L7DA 1EUSA 1C9UA 4YW5A 2C4LA 1IVFA 4CHBA 3ZYJB 2ZW9A 1Z4VA 4H52A 3POYA 3B7EA 1VCUA 3N8WA 1DVAL 2W20A 3BT2A 3ELAL 4D0FA 1G1QA 1PXXA 1HJ7A 1W8OA 2FLRL 4K1HA 4X8SL 2ZZKA 3KQDL 3ZYGA 4CPOA 2ZWAA 2VWOL 3KRKA 1CQEA 1TOZA 2YA8A 3SOQA 3CL2A 1BF9A 1XOEA 1NSBA 3TK6B 1E8UA 4FP2A 4B7JA 2HU4A 3QCWA 3ADEA 4MWLA 3TIAA 1MZ6A 4D52A 5CGJA 4COXA 4FPLA 2XN4A 2IVZA 3R05A 2WPIE 2J4IB 1W0OA 2PHBB 2HT8A 2BOUA 4NGAL 4FVKA 1V3BA 1W1XA 4HIZA 3TIBA 2VVCK 3KCGL 4K1IA 1E8VA 3D12A 3OPZA 4LORA 2GVXA 4KS5A 2KL7A 1COUA 4WA3A 5L2ZL 2GVWA 4MWRA 1A3PA 1N6FA 4MWUA 1INGA 3SW2A 2J2UB 2HTVA 3TI3A 3ASIA 1NZIA 1ATAA 4GZQA 2YGOA 2HOXA 1K36A 1MS0A 1UZQA 1PFXL 1H6LA 2VW0A 4O5TA 2Y38A 1INHA 3JU4A 4XJWA 2KB9A 3K3AA 3BPSE 3N8XA 1K32A 2IATA 2W2ME 2QWKA 3CYEA 5EO8A 2KV4A 2P95L 1FF7A 2AYLA 1E1AA 2EI8B 3TC9A 2HT5A 4GDIA 1EQHA 3OLUA 2Q1JB 1NPEA 2B8HA 3G4HA 2W3IB 3H71A 3KYAA 1N1YA 2XBVL 1N1TA 1FE2A 1V0ZA 1EMOA 1IQFL 4Y7BB 2C4AA 2FP9A 1EPHA 4K1JA 1SZBA 2FLBL 4XYXA 2BO2A 3NT1A 2WYGB 2V91A 2SIMA 1NN2A 3ZGCA 3CA7A 3NO0A 4FP3A 1MS3A 3V65B 1DILA 1INWA 3WWAA 4O5SA 3H73A 1HX2A 3O4PA 2WG3C 3KQCL 4OTYA 4CSDA 3K38A 2ISMA 4CUFA 1TPGA 3S8VA 1Z4ZA 2W38A 1HAEA 4IN4A 4IQKA 4ZGCA 2J95B 1L7HA 3CENL 1JV2B 2EI6B 4G3NA 2VW1A 1M1XB 1OB1C 4E1GA 2F27A 4NCSA 1HREA 1V3DA 5D9CA 2XCYA 4BXSA 2B7DL 3HO3A 2W2OE 3KGGA 5HX0A 2K2SB 1K37A 1KLJL 4JZEL 3H5CB 4FPKA 2GHSA 1SNTA 2WPME 1PGEA 2P93L 1IQLL 4MWWA 2Y80B 4ZXYL 4YT7L 4GN8A 1X2RA 1NNCA 2AEPA 1HT5A 1IQIL 4X8VL 4GNBA 5B2DA 1EURA 2QWIA 2MGPA 1KKEA 3GVKA 1WHEA 2WPJE 1GK5A 5B2CA 1PTHA 4FPGA 1MOXC 2GVUA 4MJVA 4CSYA 1CCFA 1MS5A 1V3XB 5JW1A 4IFJA 4MWJA 3LI5A 3WDZA 1E8TA 5IKVA 1B9WA 1I0UA 4M3MA 1CVWL 1MWEA 1V0EA 4YY8A 4NA9L 2YGPA 4QN4A 2W2NE 4YW4A 5KIRA 1IUCA 2VSMA 1W0PA 2BZDA 1HRFA 2YA7A 3N8ZA 1Q7FA 2IAXA 1ZAQA 2P3TA 4RS0A 4XMBA 1NFUB 1IQNL 2H2NA 4XHBA 4XJ8A 4JYUL 1IVEA 4QN6A 2XBXL 1YGCL 2F0ZA 4Y76B 3ZYIB 1NCAN 2FLGA 1EAIC 1S0JA 1RWLA 1WHFA 1NFYB 4Q1UA 4HZVA 3P5BL 1G2LB 4BTTA 2VVZA 5KN5C 4UOUA 5GX1A 5CKNA 1C5MF 4GEZA 1V2IA 1CCVA 4XJQA 4HZYA 3PJQA 3NTBA 5CKMA 3U7UG 2PUQL 1Z50A 4MX0A 2BZ6L 4I00A 1HZ8A 5L30L 1C5KA 2Y5FL 2Y82B 4YZ3A 4XLWA 4KS1A 1RFNB 5IKTA 1NCDN 4YZ2A 1IVBA 3ENSA 2MHPA 1OFZA 3DEMA 2P94L 4JZDL 2OJHA 2IAWA 3NSSA 4GZOA 4MWVA 1W21A 4WEGA 1O5DL 3LAQA 4R40A 4MC7A 4ZLRA 1YUKB 4GNAA 4YZ4A 4BXWA 3I1CA 3KK6A 3HLHA 3KL6B 3SANA 2P3FN 3TBDA 4YW1A 1SLIA 1INVA 4B7QA 4C1YA 2HTWA 1EGFA 1B9SA 2XBWL 1Z4YA 4Y79B 1L7GA 2VK5A 2Z32A 4FOQA 4GZWA 5JBBE 4H53A 2UWLB 5FNQA 1LPZA 5JBAE 3RR3A 2P26A 2Y81B 4ISHL 1U67A 2VW2A 2FPCA 3K37A 1SUUA 1YO8A 5GTQA 1P0SL 2KNIA 2IAPA 4HHOA 5D9DA 2JKHL 4JYVL 2XBYL 5JVYA 1CX2A 4AH4A 1EBVA 4D8SA 5COXA 4FPYA 4IFNX 4CPMA 3LIWB 3DR2A 1V1HA 2W5OA 1INYA 4Z0LA 4FQ4A 3S2KA 2WPLE 4GZTA 4HZXA 4YT6L 4Z0KB 1NCBN 3FVZA 1IQJL 3IJEB 2AEQA 1V3CA 4X8TL 1G1SA 2QWEA 4RUTA 1W8NA 1NQLB 1U6DX 3VNHA 5EX7A 2AGSA 2UWPB 4OTJA 4MWYA 5FDQA 2HT7A 2DG0A 2W8BB 1IQEL 2F13A 3GCWE 3TICA 4WEFA 4CPYA 2JKBA 3IITB 3K39A 2BOHA 1DIMA 4NC5A 3O9JA 3BT1A 1JBUL 3M36L 4Q6KA 3SREA 4GU4A 3SLIA 1IOXA 2QWCA 5E8DA 3CL0A 4D90A 2P4OA 1X7AL 4MWQA 7NN9A 4BTIA 2QWJA 3U73A 1F8BA 2GD4A 4MMYB 1XDTR 4GNCA 3N8WB 2FPBA 4XJZA 2H9EC 1ATBA 3CFWA 4AQTA 1V04A 2QE8A 3DASA 1V3EA 4D52C 1CVUA 3V1SA 4ZH8B 2F12A 3GISX 1NCCN 2VPJA 3FBYA 1F0SB 4NN9A 5FNTA 4XOGA 1QIUA 1F8CA 5F19A 2JJLA 1EUTA 2XZIA 4FOVA 5F9TA 2F9BL 4D0EA 2H2UA 1IQML 2P28B 3II7A 1U8CB 4IYGA 2IASA 3VNGA 4ASCA 1EQGA 2Y5GL 1KLIL 3PGHA 1L5GB 1NT0A 4FPHA 4D4UA 4PH9A 2POOA 4D52B 4JMLA 4UF7A 1ADXA 1APOA 4CH9A 3NTGA 3ALXA 1KIGL 2RHPA 1KITA 1IVGA 3SALA 5HUNA 4BDWA 2W2PE 1N6EA 4FPFA 4MMXB 4M10A 1QLGA 1EPJA 2K2TA 2WZPP 5JBCE 4XJUA 2BOKL 4FM5A 3NN9A 1LQDA 5FNRA 4XJ9A 5HUGA 3HRPA 1S0IA 1TLEA 1APQA 3L6VA 3CS7L 4GZSA 2IAOA 3S8ZA 3TI8A 1B9VA 3O9KA 1DQBA 3TI4A 5GX4A 5HUKA 1HCGB 3HS7A 4KS3A 2HU0A 1V1IA 2XC0L 5EGMB 1UZJA 4RRXA 1S18A 1IQKL 2Y5HL 2IAUA 3GVLA 3TI6A 1YUFA 2TGFA 2BOXA 3E5ZA 1Z6EL 1FFMA 2OYUP 2HTUA 5IKRA 2OYEP 5CISA 4HW6A 2Y7ZB 5CKQA 2YGQA 4FPCA 4HHQA 5GX3A 3V64C 4QNPA 4BDXA 1MQ6L 5JYYA 3INBA 1V0FA 3A71A 2I9AA 2G00L 4Y71B 3A72A 1SLLA 1IUBA 5M1ZA 6COXA 4WA4A 2FLUX 3LN1A 3S94A 3LC3B 3QH0A 1XFEA 2H9EL 2BERA 5L2YL 1IGXA 3FFGL 2XZJA 2XZKA 2FZZL 1UZKA 1USRA 1N1VA 3HLIA 4GN7A 4X49A 3WW9A 2HTYA 2YA4A 2DSOA 2BF6A 2SLIA 1NFXB 2QWHA 2G8SA 2RNLA 5JB9E 1WCSA 1IQGL 3N8VA 1W7XL 3H6JA 4K1KA 1Z4WA 2F29A 3Q7DA 1PJXA 1LK9A 2F24A 1LMMA 5FZNA 3K9XA 3Q3KB 4FPOB 4JF7A 2VH6B 4FOYA 1ZI0A 4AGTA 3M37L 2FP8A 3HS5A 1XKBA 3TK5B 1NNBA 1J9CL 1UZPA 1INXA 2I9BA 4YZ1A 1F8DA 3N8YB 1B9TA 1WCQA 4KS2A 4MWXA 4B7MA 1LMJA 1L3YA 4DG6A 2P16L 4X47A 4HZWA 3MQEA 3FW0A 5K0HB 2W3KB 3GVJA 4GN9A 3HO4A 2J38B 1IGZA 4BTUA 1F8EA 1NSDA 2QWDA 1PRHA 1CEJA 1S1DA 2Y7XB 3LI4A 2WPHE 4XIOA 2RA0L 2J34B 1HAFA 1IVDA 2BATA 2HTRA 4KS4A 3Q6PA 5H47A 4X8UL 4CUEA 2P3UA 4RRYA 3AMRA 5D9BA 1EPIA 1IJQA 1FJSL 4XBMA 2GVVA 3BYCA 2DYHA 1WU1B 4O02B 2W5NA 4YZ5A 2PR3B 1IVOC 4NG9L 1Z4XA 3SOVA 2CMLA 3H72A 3Q6KA 4G1MB 1ZGKA 4XILA 2D1JB 3Q6TA 3F6UL 4L7BA 3T1EA 1DX5I 2BSFA 1F7MA 1FAXL 2BQWA 2QWFA 1EMNA 3C9AC 1MQ5L 2MGRA 1NMBN 4ZY3A 3GCXE 5GX2A 4QN7A 3UC1A 2YDTA 4MJUA 4ISIL 1CQ1A 3HS6A 4SLIA 5JB8E 1ATEA 2WYJB 1LPKA 1MS9A 2XC4L 3LC5B 2W2QE 4YW2A 1L7FA 1CRZA 1SO7A 2HQSA 1NFWB 4CPLA 4A7IA 1W8BL 2VK6A 4J9TA 4XMIA 1MS4A 4A0PA 3LN0A 1A4QA 4ZXXL 4WA5A 1NNAA 4XMAA 5FNUA 4M11A 3LTFB 4A94C 1A4GA 4GB1A 4GZXA 2VSKA 4HZZA 2X9MA 1N1IA 3S6XA 3TZIA 4C16A 3BEQA 2QWAA 3EGFA 2ADXA 3HPTA 4Z6AL 2WPKE 4YW3A 1WP5A 2DG1A 3D11A 4XHXA 2YA6A 1W20A 2BMGA 4RRWA 2UWOB 4X4AA 5F72C 1FAKL 3B69A 2EI7B 1USXA 3CKZA 2VVVL 1IVCA 1BJIA 4M4NA 4X6KA 1A14N 4CPNA 4YZUB 2WFXB 1MS1A 4FOWA 1F0RB 2VWDA 3LI3A 4XE9A 4B7NA 2XC5L 1EUUA 5FWWA 1XKAL 4IFLX 3ZGDA 2FD6A 2QWGA 2YDPA 1MS8A 2F28A 2IAQA 2VJ3A 2W86A 1RWIA 4FZHA 4AHAA 1N1SA 2A75A 1XOGA 1N7DA 1ATDA 1MZ5A 1NMAN 1CRUA 4B7RA 1IOEL 4O1ZA 5I46L 4ZHAB 1EZQB 1QBIA 2IAVA 2VK7A 4C1YB 1FSBA 2CJIB 2AH2A 1DDXA 2ZB6A 2VWLL 1QFKL 3FCSB 2F11A 2VWNL 4GZPA 3K36A 4QN5A 4DGRA 3G4EA 3TGFA 3OLTA 4AGIA 1AUTL 3TH3L 3HO5A 1URKA 3KQEL 1X2JA 1F7EA 3N8YA 2VAQA 4XJRA 4Y6DB 5FNSA 3MDLA 2M74A 2QWBA 4L7CA 3TI5A 1IQHL 4MZEA 4FPEA 2SILA 2YA5A 3QMOA 2ZB5A 3SILA 3SRGA 2BT7A 4CUDA 3A9GA 2J94B 4PWZA 1N6DA 4RRZA 1VCJA 2WFTA 1KSNB 2BT8A 4CPZA 4M4VA 3SOBB 4IMBA 2F10A 1EPGA 1CVMA 4N1BA 2F25A 1G1RA 4BBWA 3U0SA 2BQ7A 1DIYA 1Z6CA 2BQ6A 1Q4GA 2VVUL 3F1SB 5IKQA 4K3YA 4M4UA 5F1AA 1IP0A 1MR5A 5HUMA 1POOA 5EO7A 1HT8A 1JL9A 3NJPC 3KQBL 3ALWA 6NN9A 5GX5A 4GU3A 1NPEB 4XJAA
chains in the Genus database with same CATH topology
1G1TA 1P9JA 2IARA 1LPGA 1G2MB 2W26B 4TGFA 4XL1A 2WG4B 5JVZA 4JZFL 4MMZB 2W8BA 2VWMK 4LMFA 2VH0B 3LTGD 3AMSA 1KLOA 3IAXA 2NPRA 4ZAEB 2P3FL 1YUGA 2DDUA 4Y7AB 3A9HA 1C9UA 3ZYJB 3POYA 3N8WA 1DVAL 3BT2A 3ELAL 4D0FA 1G1QA 1PXXA 1HJ7A 2FLRL 4X8SL 3KQDL 3ZYGA 2VWOL 3KRKA 1CQEA 1TOZA 3SOQA 1BF9A 3TK6B 3QCWA 4COXA 2IVZA 3R05A 2WPIE 2J4IB 2PHBB 2BOUA 4NGAL 2VVCK 3KCGL 4LORA 2GVXA 2KL7A 1COUA 5L2ZL 2GVWA 1A3PA 3SW2A 2J2UB 3ASIA 1NZIA 1ATAA 2YGOA 1K36A 1UZQA 1PFXL 1H6LA 4O5TA 2Y38A 2KB9A 3BPSE 3N8XA 2IATA 2W2ME 2KV4A 2P95L 1FF7A 2AYLA 1E1AA 2EI8B 3TC9A 1EQHA 3OLUA 2Q1JB 1NPEA 3G4HA 2W3IB 3KYAA 2XBVL 1FE2A 1EMOA 1IQFL 4Y7BB 2FP9A 1EPHA 1SZBA 2FLBL 2BO2A 3NT1A 2WYGB 2V91A 3CA7A 3V65B 3WWAA 4O5SA 1HX2A 3O4PA 2WG3C 3KQCL 4OTYA 2ISMA 4CUFA 1TPGA 3S8VA 1HAEA 2J95B 3CENL 1JV2B 2EI6B 1M1XB 1OB1C 4E1GA 1HREA 5D9CA 4BXSA 2B7DL 3HO3A 2W2OE 3KGGA 2K2SB 1K37A 1KLJL 4JZEL 3H5CB 2GHSA 2WPME 1PGEA 2P93L 1IQLL 2Y80B 4ZXYL 4YT7L 4GN8A 1HT5A 1IQIL 4X8VL 4GNBA 2MGPA 1WHEA 2WPJE 1GK5A 1PTHA 1MOXC 2GVUA 4CSYA 1CCFA 1V3XB 5JW1A 3LI5A 5IKVA 1B9WA 1I0UA 1CVWL 4NA9L 2YGPA 2W2NE 5KIRA 1HRFA 3N8ZA 1Q7FA 2IAXA 1ZAQA 2P3TA 4RS0A 1NFUB 1IQNL 4JYUL 2XBXL 1YGCL 4Y76B 3ZYIB 2FLGA 1EAIC 1RWLA 1WHFA 1NFYB 4Q1UA 3P5BL 1G2LB 4BTTA 5KN5C 5GX1A 5CKNA 1C5MF 1CCVA 3NTBA 5CKMA 3U7UG 2PUQL 2BZ6L 1HZ8A 5L30L 1C5KA 2Y5FL 2Y82B 4XLWA 1RFNB 5IKTA 3ENSA 2MHPA 3DEMA 2P94L 4JZDL 2OJHA 2IAWA 1O5DL 3LAQA 4R40A 4ZLRA 1YUKB 4GNAA 4BXWA 3I1CA 3KK6A 3HLHA 3KL6B 2P3FN 3TBDA 1EGFA 2XBWL 4Y79B 5JBBE 2UWLB 1LPZA 5JBAE 3RR3A 2P26A 2Y81B 4ISHL 1U67A 2FPCA 1YO8A 5GTQA 1P0SL 2KNIA 2IAPA 4HHOA 5D9DA 2JKHL 4JYVL 2XBYL 5JVYA 1CX2A 1EBVA 5COXA 3LIWB 3DR2A 4Z0LA 3S2KA 2WPLE 4YT6L 4Z0KB 3FVZA 1IQJL 3IJEB 4X8TL 1G1SA 4RUTA 1NQLB 5EX7A 2UWPB 4OTJA 5FDQA 2DG0A 2W8BB 1IQEL 3GCWE 3IITB 2BOHA 3BT1A 1JBUL 3M36L 3SREA 1IOXA 5E8DA 4D90A 2P4OA 1X7AL 4BTIA 3U73A 4GNCA 2GD4A 4MMYB 1XDTR 3N8WB 2FPBA 2H9EC 1ATBA 3CFWA 4AQTA 1V04A 2QE8A 3DASA 1CVUA 3V1SA 4ZH8B 3GISX 3FBYA 1F0SB 5F19A 2F9BL 4D0EA 1IQML 2P28B 1U8CB 4IYGA 2IASA 1EQGA 2Y5GL 1KLIL 3PGHA 1L5GB 1NT0A 4PH9A 2POOA 4JMLA 1ADXA 1APOA 3NTGA 1KIGL 2RHPA 4BDWA 2W2PE 4MMXB 4M10A 1QLGA 1EPJA 2K2TA 2WZPP 5JBCE 2BOKL 4FM5A 1LQDA 3HRPA 1TLEA 1APQA 3S8ZA 3CS7L 2IAOA 1DQBA 5GX4A 1HCGB 3HS7A 5EGMB 2XC0L 1UZJA 4RRXA 1IQKL 2Y5HL 2IAUA 1YUFA 2TGFA 2BOXA 3E5ZA 1Z6EL 1FFMA 2OYUP 5IKRA 2OYEP 5CISA 4HW6A 2Y7ZB 5CKQA 2YGQA 4HHQA 5GX3A 3V64C 4BDXA 1MQ6L 2I9AA 2G00L 4Y71B 6COXA 3LN1A 3S94A 3LC3B 3QH0A 1XFEA 2H9EL 5L2YL 1IGXA 3FFGL 2FZZL 1UZKA 3HLIA 4GN7A 3WW9A 2DSOA 1NFXB 2G8SA 2RNLA 5JB9E 1IQGL 3N8VA 1W7XL 3Q7DA 1PJXA 1LMMA 3K9XA 3Q3KB 2VH6B 3M37L 2FP8A 3HS5A 1XKBA 3TK5B 1J9CL 1UZPA 2I9BA 3N8YB 4DG6A 1LMJA 1L3YA 2P16L 3MQEA 3FW0A 5K0HB 2W3KB 4GN9A 3HO4A 2J38B 1IGZA 4BTUA 1PRHA 1CEJA 2Y7XB 3LI4A 2WPHE 2RA0L 2J34B 1HAFA 3Q6PA 4X8UL 4CUEA 2P3UA 4RRYA 3AMRA 5D9BA 1EPIA 1IJQA 1FJSL 4XBMA 2GVVA 3BYCA 1WU1B 4O02B 2PR3B 1IVOC 4NG9L 3Q6KA 3SOVA 4G1MB 2D1JB 3Q6TA 3F6UL 1DX5I 1F7MA 1FAXL 2BQWA 1EMNA 3C9AC 1MQ5L 2MGRA 5GX2A 3GCXE 4ISIL 1CQ1A 3HS6A 5JB8E 1ATEA 2WYJB 1LPKA 2XC4L 3LC5B 2W2QE 1CRZA 2HQSA 1NFWB 4A7IA 1W8BL 4A0PA 3LN0A 4ZXXL 4M11A 3LTFB 4A94C 1N1IA 3S6XA 3TZIA 4C16A 3EGFA 2ADXA 3HPTA 4Z6AL 2WPKE 2DG1A 2BMGA 4RRWA 2UWOB 1FAKL 2EI7B 2VVVL 4YZUB 2WFXB 1F0RB 3LI3A 2XC5L 5FWWA 1XKAL 2FD6A 2IAQA 2VJ3A 2W86A 1RWIA 1N7DA 1ATDA 1CRUA 1IOEL 4O1ZA 5I46L 4ZHAB 1EZQB 1QBIA 2IAVA 1FSBA 2CJIB 1DDXA 2VWLL 1QFKL 3FCSB 2VWNL 3G4EA 3TGFA 3OLTA 1AUTL 3TH3L 3HO5A 1URKA 3KQEL 1F7EA 3N8YA 2VAQA 4Y6DB 3MDLA 2M74A 1IQHL 3SRGA 3QMOA 4CUDA 3A9GA 2J94B 4PWZA 4RRZA 2WFTA 1KSNB 3SOBB 4IMBA 1EPGA 1CVMA 1G1RA 3U0SA 2BQ7A 1DIYA 1Z6CA 2BQ6A 1Q4GA 2VVUL 3F1SB 5IKQA 5F1AA 1IP0A 1POOA 1HT8A 1JL9A 3NJPC 3KQBL 5GX5A 1NPEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G1T A;  1P9J A;  2IAR A;  1LPG A;  1G2M B;  2W26 B;  4TGF A;  4XL1 A;  2WG4 B;  5JVZ A;  4JZF L;  4MMZ B;  2W8B A;  2VWM K;  4LMF A;  2VH0 B;  3LTG D;  3AMS A;  1KLO A;  3IAX A;  2NPR A;  4ZAE B;  2P3F L;  1YUG A;  2DDU A;  4Y7A B;  3A9H A;  1C9U A;  3ZYJ B;  3POY A;  3N8W A;  1DVA L;  3BT2 A;  3ELA L;  4D0F A;  1G1Q A;  1PXX A;  1HJ7 A;  2FLR L;  4X8S L;  3KQD L;  3ZYG A;  2VWO L;  3KRK A;  1CQE A;  1TOZ A;  3SOQ A;  1BF9 A;  3TK6 B;  3QCW A;  4COX A;  2IVZ A;  3R05 A;  2WPI E;  2J4I B;  2PHB B;  2BOU A;  4NGA L;  2VVC K;  3KCG L;  4LOR A;  2GVX A;  2KL7 A;  1COU A;  5L2Z L;  2GVW A;  1A3P A;  3SW2 A;  2J2U B;  3ASI A;  1NZI A;  1ATA A;  2YGO A;  1K36 A;  1UZQ A;  1PFX L;  1H6L A;  4O5T A;  2Y38 A;  2KB9 A;  3BPS E;  3N8X A;  2IAT A;  2W2M E;  2KV4 A;  2P95 L;  1FF7 A;  2AYL A;  1E1A A;  2EI8 B;  3TC9 A;  1EQH A;  3OLU A;  2Q1J B;  1NPE A;  3G4H A;  2W3I B;  3KYA A;  2XBV L;  1FE2 A;  1EMO A;  1IQF L;  4Y7B B;  2FP9 A;  1EPH A;  1SZB A;  2FLB L;  2BO2 A;  3NT1 A;  2WYG B;  2V91 A;  3CA7 A;  3V65 B;  3WWA A;  4O5S A;  1HX2 A;  3O4P A;  2WG3 C;  3KQC L;  4OTY A;  2ISM A;  4CUF A;  1TPG A;  3S8V A;  1HAE A;  2J95 B;  3CEN L;  1JV2 B;  2EI6 B;  1M1X B;  1OB1 C;  4E1G A;  1HRE A;  5D9C A;  4BXS A;  2B7D L;  3HO3 A;  2W2O E;  3KGG A;  2K2S B;  1K37 A;  1KLJ L;  4JZE L;  3H5C B;  2GHS A;  2WPM E;  1PGE A;  2P93 L;  1IQL L;  2Y80 B;  4ZXY L;  4YT7 L;  4GN8 A;  1HT5 A;  1IQI L;  4X8V L;  4GNB A;  2MGP A;  1WHE A;  2WPJ E;  1GK5 A;  1PTH A;  1MOX C;  2GVU A;  4CSY A;  1CCF A;  1V3X B;  5JW1 A;  3LI5 A;  5IKV A;  1B9W A;  1I0U A;  1CVW L;  4NA9 L;  2YGP A;  2W2N E;  5KIR A;  1HRF A;  3N8Z A;  1Q7F A;  2IAX A;  1ZAQ A;  2P3T A;  4RS0 A;  1NFU B;  1IQN L;  4JYU L;  2XBX L;  1YGC L;  4Y76 B;  3ZYI B;  2FLG A;  1EAI C;  1RWL A;  1WHF A;  1NFY B;  4Q1U A;  3P5B L;  1G2L B;  4BTT A;  5KN5 C;  5GX1 A;  5CKN A;  1C5M F;  1CCV A;  3NTB A;  5CKM A;  3U7U G;  2PUQ L;  2BZ6 L;  1HZ8 A;  5L30 L;  1C5K A;  2Y5F L;  2Y82 B;  4XLW A;  1RFN B;  5IKT A;  3ENS A;  2MHP A;  3DEM A;  2P94 L;  4JZD L;  2OJH A;  2IAW A;  1O5D L;  3LAQ A;  4R40 A;  4ZLR A;  1YUK B;  4GNA A;  4BXW A;  3I1C A;  3KK6 A;  3HLH A;  3KL6 B;  2P3F N;  3TBD A;  1EGF A;  2XBW L;  4Y79 B;  5JBB E;  2UWL B;  1LPZ A;  5JBA E;  3RR3 A;  2P26 A;  2Y81 B;  4ISH L;  1U67 A;  2FPC A;  1YO8 A;  5GTQ A;  1P0S L;  2IAP A;  4HHO A;  5D9D A;  2JKH L;  4JYV L;  2XBY L;  5JVY A;  1CX2 A;  1EBV A;  5COX A;  3LIW B;  3DR2 A;  4Z0L A;  3S2K A;  2WPL E;  4YT6 L;  4Z0K B;  3FVZ A;  1IQJ L;  3IJE B;  4X8T L;  1G1S A;  4RUT A;  1NQL B;  5EX7 A;  2UWP B;  4OTJ A;  5FDQ A;  2DG0 A;  2W8B B;  1IQE L;  3GCW E;  3IIT B;  2BOH A;  3BT1 A;  1JBU L;  3M36 L;  3SRE A;  1IOX A;  5E8D A;  4D90 A;  2P4O A;  1X7A L;  4BTI A;  3U73 A;  4GNC A;  2GD4 A;  4MMY B;  1XDT R;  3N8W B;  2FPB A;  1ATB A;  3CFW A;  4AQT A;  1V04 A;  2QE8 A;  3DAS A;  1CVU A;  3V1S A;  4ZH8 B;  3GIS X;  3FBY A;  1F0S B;  5F19 A;  2F9B L;  4D0E A;  1IQM L;  2P28 B;  1U8C B;  4IYG A;  2IAS A;  1EQG A;  2Y5G L;  1KLI L;  3PGH A;  1L5G B;  1NT0 A;  4PH9 A;  2POO A;  4JML A;  1ADX A;  1APO A;  3NTG A;  1KIG L;  2RHP A;  4BDW A;  2W2P E;  4MMX B;  4M10 A;  1QLG A;  1EPJ A;  2K2T A;  5JBC E;  2BOK L;  4FM5 A;  1LQD A;  3HRP A;  1TLE A;  1APQ A;  3S8Z A;  3CS7 L;  2IAO A;  1DQB A;  5GX4 A;  1HCG B;  3HS7 A;  5EGM B;  2XC0 L;  1UZJ A;  4RRX A;  1IQK L;  2Y5H L;  2IAU A;  1YUF A;  2TGF A;  2BOX A;  3E5Z A;  1Z6E L;  1FFM A;  2OYU P;  5IKR A;  2OYE P;  5CIS A;  4HW6 A;  2Y7Z B;  5CKQ A;  4HHQ A;  5GX3 A;  3V64 C;  4BDX A;  1MQ6 L;  2I9A A;  2G00 L;  4Y71 B;  6COX A;  3LN1 A;  3S94 A;  3LC3 B;  3QH0 A;  1XFE A;  2H9E L;  5L2Y L;  1IGX A;  3FFG L;  2FZZ L;  1UZK A;  3HLI A;  4GN7 A;  3WW9 A;  2DSO A;  1NFX B;  2G8S A;  2RNL A;  5JB9 E;  1IQG L;  3N8V A;  1W7X L;  3Q7D A;  1PJX A;  3K9X A;  3Q3K B;  2VH6 B;  3M37 L;  2FP8 A;  3HS5 A;  1XKB A;  3TK5 B;  1J9C L;  1UZP A;  2I9B A;  3N8Y B;  4DG6 A;  1LMJ A;  1L3Y A;  2P16 L;  3MQE A;  3FW0 A;  5K0H B;  2W3K B;  4GN9 A;  3HO4 A;  2J38 B;  1IGZ A;  4BTU A;  1PRH A;  1CEJ A;  2Y7X B;  3LI4 A;  2WPH E;  2RA0 L;  2J34 B;  1HAF A;  3Q6P A;  4X8U L;  4CUE A;  2P3U A;  4RRY A;  3AMR A;  5D9B A;  1EPI A;  1IJQ A;  1FJS L;  4XBM A;  2GVV A;  3BYC A;  1WU1 B;  4O02 B;  2PR3 B;  1IVO C;  4NG9 L;  3Q6K A;  3SOV A;  4G1M B;  2D1J B;  3Q6T A;  3F6U L;  1DX5 I;  1F7M A;  1FAX L;  2BQW A;  1EMN A;  3C9A C;  1MQ5 L;  2MGR A;  5GX2 A;  3GCX E;  4ISI L;  1CQ1 A;  3HS6 A;  5JB8 E;  1ATE A;  2WYJ B;  1LPK A;  2XC4 L;  3LC5 B;  2W2Q E;  1CRZ A;  2HQS A;  1NFW B;  4A7I A;  1W8B L;  4A0P A;  3LN0 A;  4ZXX L;  4M11 A;  3LTF B;  1N1I A;  3TZI A;  4C16 A;  3EGF A;  2ADX A;  3HPT A;  4Z6A L;  2WPK E;  2DG1 A;  2BMG A;  4RRW A;  2UWO B;  1FAK L;  2EI7 B;  2VVV L;  4YZU B;  2WFX B;  1F0R B;  3LI3 A;  2XC5 L;  5FWW A;  1XKA L;  2FD6 A;  2IAQ A;  2VJ3 A;  2W86 A;  1RWI A;  1N7D A;  1ATD A;  1CRU A;  1IOE L;  4O1Z A;  5I46 L;  4ZHA B;  1EZQ B;  1QBI A;  2IAV A;  1FSB A;  2CJI B;  1DDX A;  2VWL L;  1QFK L;  3FCS B;  2VWN L;  3G4E A;  3TGF A;  3OLT A;  1AUT L;  3TH3 L;  3HO5 A;  1URK A;  3KQE L;  1F7E A;  3N8Y A;  2VAQ A;  4Y6D B;  3MDL A;  2M74 A;  1IQH L;  3SRG A;  3QMO A;  4CUD A;  3A9G A;  2J94 B;  4PWZ A;  4RRZ A;  2WFT A;  1KSN B;  3SOB B;  4IMB A;  1EPG A;  1CVM A;  1G1R A;  3U0S A;  2BQ7 A;  1DIY A;  1Z6C A;  2BQ6 A;  1Q4G A;  2VVU L;  3F1S B;  5IKQ A;  5F1A A;  1IP0 A;  1POO A;  1HT8 A;  1JL9 A;  3NJP C;  3KQB L;  5GX5 A;  1NPE B; 
#chains in the Genus database with same CATH topology
 1G1T A;  1P9J A;  2IAR A;  4MZA A;  1NMC A;  1LPG A;  1G2M B;  2W26 B;  2F26 A;  2FHR A;  4QN3 A;  2HTQ A;  4FPJ A;  1INF A;  4TGF A;  4XL1 A;  2WG4 B;  4FJ6 A;  5JVZ A;  4GDJ A;  2HOR A;  4JZF L;  4MMZ B;  1NSC A;  4GJT A;  5FZJ A;  2W8B A;  5NN9 A;  2VWM K;  4LMF A;  2VH0 B;  3LTG D;  2RKC A;  3AMS A;  4XIK A;  3W09 A;  1KLO A;  3IAX A;  2NPR A;  4ZAE B;  2P3F L;  1YUG A;  3WN7 A;  2DDU A;  4Y7A B;  2WOZ A;  3A9H A;  2VRS A;  4L7D A;  1EUS A;  1C9U A;  4YW5 A;  2C4L A;  1IVF A;  4CHB A;  3ZYJ B;  2ZW9 A;  1Z4V A;  4H52 A;  3POY A;  3B7E A;  1VCU A;  3N8W A;  1DVA L;  2W20 A;  3BT2 A;  3ELA L;  4D0F A;  1G1Q A;  1PXX A;  1HJ7 A;  1W8O A;  2FLR L;  4K1H A;  4X8S L;  2ZZK A;  3KQD L;  3ZYG A;  4CPO A;  2ZWA A;  2VWO L;  3KRK A;  1CQE A;  1TOZ A;  2YA8 A;  3SOQ A;  3CL2 A;  1BF9 A;  1XOE A;  1NSB A;  3TK6 B;  1E8U A;  4FP2 A;  4B7J A;  2HU4 A;  3QCW A;  3ADE A;  4MWL A;  3TIA A;  1MZ6 A;  4D52 A;  5CGJ A;  4COX A;  4FPL A;  2XN4 A;  2IVZ A;  3R05 A;  2WPI E;  2J4I B;  1W0O A;  2PHB B;  2HT8 A;  2BOU A;  4NGA L;  4FVK A;  1V3B A;  1W1X A;  4HIZ A;  3TIB A;  2VVC K;  3KCG L;  4K1I A;  1E8V A;  3D12 A;  3OPZ A;  4LOR A;  2GVX A;  4KS5 A;  2KL7 A;  1COU A;  4WA3 A;  5L2Z L;  2GVW A;  4MWR A;  1A3P A;  1N6F A;  4MWU A;  1ING A;  3SW2 A;  2J2U B;  2HTV A;  3TI3 A;  3ASI A;  1NZI A;  1ATA A;  4GZQ A;  2YGO A;  2HOX A;  1K36 A;  1MS0 A;  1UZQ A;  1PFX L;  1H6L A;  2VW0 A;  4O5T A;  2Y38 A;  1INH A;  3JU4 A;  4XJW A;  2KB9 A;  3K3A A;  3BPS E;  3N8X A;  1K32 A;  2IAT A;  2W2M E;  2QWK A;  3CYE A;  5EO8 A;  2KV4 A;  2P95 L;  1FF7 A;  2AYL A;  1E1A A;  2EI8 B;  3TC9 A;  2HT5 A;  4GDI A;  1EQH A;  3OLU A;  2Q1J B;  1NPE A;  2B8H A;  3G4H A;  2W3I B;  3H71 A;  3KYA A;  1N1Y A;  2XBV L;  1N1T A;  1FE2 A;  1V0Z A;  1EMO A;  1IQF L;  4Y7B B;  2C4A A;  2FP9 A;  1EPH A;  4K1J A;  1SZB A;  2FLB L;  4XYX A;  2BO2 A;  3NT1 A;  2WYG B;  2V91 A;  2SIM A;  1NN2 A;  3ZGC A;  3CA7 A;  3NO0 A;  4FP3 A;  1MS3 A;  3V65 B;  1DIL A;  1INW A;  3WWA A;  4O5S A;  3H73 A;  1HX2 A;  3O4P A;  2WG3 C;  3KQC L;  4OTY A;  4CSD A;  3K38 A;  2ISM A;  4CUF A;  1TPG A;  3S8V A;  1Z4Z A;  2W38 A;  1HAE A;  4IN4 A;  4IQK A;  4ZGC A;  2J95 B;  1L7H A;  3CEN L;  1JV2 B;  2EI6 B;  4G3N A;  2VW1 A;  1M1X B;  1OB1 C;  4E1G A;  2F27 A;  4NCS A;  1HRE A;  1V3D A;  5D9C A;  2XCY A;  4BXS A;  2B7D L;  3HO3 A;  2W2O E;  3KGG A;  5HX0 A;  2K2S B;  1K37 A;  1KLJ L;  4JZE L;  3H5C B;  4FPK A;  2GHS A;  1SNT A;  2WPM E;  1PGE A;  2P93 L;  1IQL L;  4MWW A;  2Y80 B;  4ZXY L;  4YT7 L;  4GN8 A;  1X2R A;  1NNC A;  2AEP A;  1HT5 A;  1IQI L;  4X8V L;  4GNB A;  5B2D A;  1EUR A;  2QWI A;  2MGP A;  1KKE A;  3GVK A;  1WHE A;  2WPJ E;  1GK5 A;  5B2C A;  1PTH A;  4FPG A;  1MOX C;  2GVU A;  4MJV A;  4CSY A;  1CCF A;  1MS5 A;  1V3X B;  5JW1 A;  4IFJ A;  4MWJ A;  3LI5 A;  3WDZ A;  1E8T A;  5IKV A;  1B9W A;  1I0U A;  4M3M A;  1CVW L;  1MWE A;  1V0E A;  4YY8 A;  4NA9 L;  2YGP A;  4QN4 A;  2W2N E;  4YW4 A;  5KIR A;  1IUC A;  2VSM A;  1W0P A;  2BZD A;  1HRF A;  2YA7 A;  3N8Z A;  1Q7F A;  2IAX A;  1ZAQ A;  2P3T A;  4RS0 A;  4XMB A;  1NFU B;  1IQN L;  2H2N A;  4XHB A;  4XJ8 A;  4JYU L;  1IVE A;  4QN6 A;  2XBX L;  1YGC L;  2F0Z A;  4Y76 B;  3ZYI B;  1NCA N;  2FLG A;  1EAI C;  1S0J A;  1RWL A;  1WHF A;  1NFY B;  4Q1U A;  4HZV A;  3P5B L;  1G2L B;  4BTT A;  2VVZ A;  5KN5 C;  4UOU A;  5GX1 A;  5CKN A;  1C5M F;  4GEZ A;  1V2I A;  1CCV A;  4XJQ A;  4HZY A;  3PJQ A;  3NTB A;  5CKM A;  3U7U G;  2PUQ L;  1Z50 A;  4MX0 A;  2BZ6 L;  4I00 A;  1HZ8 A;  5L30 L;  1C5K A;  2Y5F L;  2Y82 B;  4YZ3 A;  4XLW A;  4KS1 A;  1RFN B;  5IKT A;  1NCD N;  4YZ2 A;  1IVB A;  3ENS A;  2MHP A;  1OFZ A;  3DEM A;  2P94 L;  4JZD L;  2OJH A;  2IAW A;  3NSS A;  4GZO A;  4MWV A;  1W21 A;  4WEG A;  1O5D L;  3LAQ A;  4R40 A;  4MC7 A;  4ZLR A;  1YUK B;  4GNA A;  4YZ4 A;  4BXW A;  3I1C A;  3KK6 A;  3HLH A;  3KL6 B;  3SAN A;  2P3F N;  3TBD A;  4YW1 A;  1SLI A;  1INV A;  4B7Q A;  4C1Y A;  2HTW A;  1EGF A;  1B9S A;  2XBW L;  1Z4Y A;  4Y79 B;  1L7G A;  2VK5 A;  2Z32 A;  4FOQ A;  4GZW A;  5JBB E;  4H53 A;  2UWL B;  5FNQ A;  1LPZ A;  5JBA E;  3RR3 A;  2P26 A;  2Y81 B;  4ISH L;  1U67 A;  2VW2 A;  2FPC A;  3K37 A;  1SUU A;  1YO8 A;  5GTQ A;  1P0S L;  2KNI A;  2IAP A;  4HHO A;  5D9D A;  2JKH L;  4JYV L;  2XBY L;  5JVY A;  1CX2 A;  4AH4 A;  1EBV A;  4D8S A;  5COX A;  4FPY A;  4IFN X;  4CPM A;  3LIW B;  3DR2 A;  1V1H A;  2W5O A;  1INY A;  4Z0L A;  4FQ4 A;  3S2K A;  2WPL E;  4GZT A;  4HZX A;  4YT6 L;  4Z0K B;  1NCB N;  3FVZ A;  1IQJ L;  3IJE B;  2AEQ A;  1V3C A;  4X8T L;  1G1S A;  2QWE A;  4RUT A;  1W8N A;  1NQL B;  1U6D X;  3VNH A;  5EX7 A;  2AGS A;  2UWP B;  4OTJ A;  4MWY A;  5FDQ A;  2HT7 A;  2DG0 A;  2W8B B;  1IQE L;  2F13 A;  3GCW E;  3TIC A;  4WEF A;  4CPY A;  2JKB A;  3IIT B;  3K39 A;  2BOH A;  1DIM A;  4NC5 A;  3O9J A;  3BT1 A;  1JBU L;  3M36 L;  4Q6K A;  3SRE A;  4GU4 A;  3SLI A;  1IOX A;  2QWC A;  5E8D A;  3CL0 A;  4D90 A;  2P4O A;  1X7A L;  4MWQ A;  7NN9 A;  4BTI A;  2QWJ A;  3U73 A;  1F8B A;  2GD4 A;  4MMY B;  1XDT R;  4GNC A;  3N8W B;  2FPB A;  4XJZ A;  2H9E C;  1ATB A;  3CFW A;  4AQT A;  1V04 A;  2QE8 A;  3DAS A;  1V3E A;  4D52 C;  1CVU A;  3V1S A;  4ZH8 B;  2F12 A;  3GIS X;  1NCC N;  2VPJ A;  3FBY A;  1F0S B;  4NN9 A;  5FNT A;  4XOG A;  1QIU A;  1F8C A;  5F19 A;  2JJL A;  1EUT A;  2XZI A;  4FOV A;  5F9T A;  2F9B L;  4D0E A;  2H2U A;  1IQM L;  2P28 B;  3II7 A;  1U8C B;  4IYG A;  2IAS A;  3VNG A;  4ASC A;  1EQG A;  2Y5G L;  1KLI L;  3PGH A;  1L5G B;  1NT0 A;  4FPH A;  4D4U A;  4PH9 A;  2POO A;  4D52 B;  4JML A;  4UF7 A;  1ADX A;  1APO A;  4CH9 A;  3NTG A;  3ALX A;  1KIG L;  2RHP A;  1KIT A;  1IVG A;  3SAL A;  5HUN A;  4BDW A;  2W2P E;  1N6E A;  4FPF A;  4MMX B;  4M10 A;  1QLG A;  1EPJ A;  2K2T A;  2WZP P;  5JBC E;  4XJU A;  2BOK L;  4FM5 A;  3NN9 A;  1LQD A;  5FNR A;  4XJ9 A;  5HUG A;  3HRP A;  1S0I A;  1TLE A;  1APQ A;  3L6V A;  3CS7 L;  4GZS A;  2IAO A;  3S8Z A;  3TI8 A;  1B9V A;  3O9K A;  1DQB A;  3TI4 A;  5GX4 A;  5HUK A;  1HCG B;  3HS7 A;  4KS3 A;  2HU0 A;  1V1I A;  2XC0 L;  5EGM B;  1UZJ A;  4RRX A;  1S18 A;  1IQK L;  2Y5H L;  2IAU A;  3GVL A;  3TI6 A;  1YUF A;  2TGF A;  2BOX A;  3E5Z A;  1Z6E L;  1FFM A;  2OYU P;  2HTU A;  5IKR A;  2OYE P;  5CIS A;  4HW6 A;  2Y7Z B;  5CKQ A;  2YGQ A;  4FPC A;  4HHQ A;  5GX3 A;  3V64 C;  4QNP A;  4BDX A;  1MQ6 L;  5JYY A;  3INB A;  1V0F A;  3A71 A;  2I9A A;  2G00 L;  4Y71 B;  3A72 A;  1SLL A;  1IUB A;  5M1Z A;  6COX A;  4WA4 A;  2FLU X;  3LN1 A;  3S94 A;  3LC3 B;  3QH0 A;  1XFE A;  2H9E L;  2BER A;  5L2Y L;  1IGX A;  3FFG L;  2XZJ A;  2XZK A;  2FZZ L;  1UZK A;  1USR A;  1N1V A;  3HLI A;  4GN7 A;  4X49 A;  3WW9 A;  2HTY A;  2YA4 A;  2DSO A;  2BF6 A;  2SLI A;  1NFX B;  2QWH A;  2G8S A;  2RNL A;  5JB9 E;  1WCS A;  1IQG L;  3N8V A;  1W7X L;  3H6J A;  4K1K A;  1Z4W A;  2F29 A;  3Q7D A;  1PJX A;  1LK9 A;  2F24 A;  1LMM A;  5FZN A;  3K9X A;  3Q3K B;  4FPO B;  4JF7 A;  2VH6 B;  4FOY A;  1ZI0 A;  4AGT A;  3M37 L;  2FP8 A;  3HS5 A;  1XKB A;  3TK5 B;  1NNB A;  1J9C L;  1UZP A;  1INX A;  2I9B A;  4YZ1 A;  1F8D A;  3N8Y B;  1B9T A;  1WCQ A;  4KS2 A;  4MWX A;  4B7M A;  1LMJ A;  1L3Y A;  4DG6 A;  2P16 L;  4X47 A;  4HZW A;  3MQE A;  3FW0 A;  5K0H B;  2W3K B;  3GVJ A;  4GN9 A;  3HO4 A;  2J38 B;  1IGZ A;  4BTU A;  1F8E A;  1NSD A;  2QWD A;  1PRH A;  1CEJ A;  1S1D A;  2Y7X B;  3LI4 A;  2WPH E;  4XIO A;  2RA0 L;  2J34 B;  1HAF A;  1IVD A;  2BAT A;  2HTR A;  4KS4 A;  3Q6P A;  5H47 A;  4X8U L;  4CUE A;  2P3U A;  4RRY A;  3AMR A;  5D9B A;  1EPI A;  1IJQ A;  1FJS L;  4XBM A;  2GVV A;  3BYC A;  2DYH A;  1WU1 B;  4O02 B;  2W5N A;  4YZ5 A;  2PR3 B;  1IVO C;  4NG9 L;  1Z4X A;  3SOV A;  2CML A;  3H72 A;  3Q6K A;  4G1M B;  1ZGK A;  4XIL A;  2D1J B;  3Q6T A;  3F6U L;  4L7B A;  3T1E A;  1DX5 I;  2BSF A;  1F7M A;  1FAX L;  2BQW A;  2QWF A;  1EMN A;  3C9A C;  1MQ5 L;  2MGR A;  1NMB N;  4ZY3 A;  3GCX E;  5GX2 A;  4QN7 A;  3UC1 A;  2YDT A;  4MJU A;  4ISI L;  1CQ1 A;  3HS6 A;  4SLI A;  5JB8 E;  1ATE A;  2WYJ B;  1LPK A;  1MS9 A;  2XC4 L;  3LC5 B;  2W2Q E;  4YW2 A;  1L7F A;  1CRZ A;  1SO7 A;  2HQS A;  1NFW B;  4CPL A;  4A7I A;  1W8B L;  2VK6 A;  4J9T A;  4XMI A;  1MS4 A;  4A0P A;  3LN0 A;  1A4Q A;  4ZXX L;  4WA5 A;  1NNA A;  4XMA A;  5FNU A;  4M11 A;  3LTF B;  4A94 C;  1A4G A;  4GB1 A;  4GZX A;  2VSK A;  4HZZ A;  2X9M A;  1N1I A;  3S6X A;  3TZI A;  4C16 A;  3BEQ A;  2QWA A;  3EGF A;  2ADX A;  3HPT A;  4Z6A L;  2WPK E;  4YW3 A;  1WP5 A;  2DG1 A;  3D11 A;  4XHX A;  2YA6 A;  1W20 A;  2BMG A;  4RRW A;  2UWO B;  4X4A A;  5F72 C;  1FAK L;  3B69 A;  2EI7 B;  1USX A;  3CKZ A;  2VVV L;  1IVC A;  1BJI A;  4M4N A;  4X6K A;  1A14 N;  4CPN A;  4YZU B;  2WFX B;  1MS1 A;  4FOW A;  1F0R B;  2VWD A;  3LI3 A;  4XE9 A;  4B7N A;  2XC5 L;  1EUU A;  5FWW A;  1XKA L;  4IFL X;  3ZGD A;  2FD6 A;  2QWG A;  2YDP A;  1MS8 A;  2F28 A;  2IAQ A;  2VJ3 A;  2W86 A;  1RWI A;  4FZH A;  4AHA A;  1N1S A;  2A75 A;  1XOG A;  1N7D A;  1ATD A;  1MZ5 A;  1NMA N;  1CRU A;  4B7R A;  1IOE L;  4O1Z A;  5I46 L;  4ZHA B;  1EZQ B;  1QBI A;  2IAV A;  2VK7 A;  4C1Y B;  1FSB A;  2CJI B;  2AH2 A;  1DDX A;  2ZB6 A;  2VWL L;  1QFK L;  3FCS B;  2F11 A;  2VWN L;  4GZP A;  3K36 A;  4QN5 A;  4DGR A;  3G4E A;  3TGF A;  3OLT A;  4AGI A;  1AUT L;  3TH3 L;  3HO5 A;  1URK A;  3KQE L;  1X2J A;  1F7E A;  3N8Y A;  2VAQ A;  4XJR A;  4Y6D B;  5FNS A;  3MDL A;  2M74 A;  2QWB A;  4L7C A;  3TI5 A;  1IQH L;  4MZE A;  4FPE A;  2SIL A;  2YA5 A;  3QMO A;  2ZB5 A;  3SIL A;  3SRG A;  2BT7 A;  4CUD A;  3A9G A;  2J94 B;  4PWZ A;  1N6D A;  4RRZ A;  1VCJ A;  2WFT A;  1KSN B;  2BT8 A;  4CPZ A;  4M4V A;  3SOB B;  4IMB A;  2F10 A;  1EPG A;  1CVM A;  4N1B A;  2F25 A;  1G1R A;  4BBW A;  3U0S A;  2BQ7 A;  1DIY A;  1Z6C A;  2BQ6 A;  1Q4G A;  2VVU L;  3F1S B;  5IKQ A;  4K3Y A;  4M4U A;  5F1A A;  1IP0 A;  1MR5 A;  5HUM A;  1POO A;  5EO7 A;  1HT8 A;  1JL9 A;  3NJP C;  3KQB L;  3ALW A;  6NN9 A;  5GX5 A;  4GU3 A;  1NPE B;  4XJA A; 
#chains in the Genus database with same CATH homology
 1G1T A;  1P9J A;  2IAR A;  1LPG A;  1G2M B;  2W26 B;  4TGF A;  4XL1 A;  2WG4 B;  5JVZ A;  4JZF L;  4MMZ B;  2W8B A;  2VWM K;  4LMF A;  2VH0 B;  3LTG D;  3AMS A;  1KLO A;  3IAX A;  2NPR A;  4ZAE B;  2P3F L;  1YUG A;  2DDU A;  4Y7A B;  3A9H A;  1C9U A;  3ZYJ B;  3POY A;  3N8W A;  1DVA L;  3BT2 A;  3ELA L;  4D0F A;  1G1Q A;  1PXX A;  1HJ7 A;  2FLR L;  4X8S L;  3KQD L;  3ZYG A;  2VWO L;  3KRK A;  1CQE A;  1TOZ A;  3SOQ A;  1BF9 A;  3TK6 B;  3QCW A;  4COX A;  2IVZ A;  3R05 A;  2WPI E;  2J4I B;  2PHB B;  2BOU A;  4NGA L;  2VVC K;  3KCG L;  4LOR A;  2GVX A;  2KL7 A;  1COU A;  5L2Z L;  2GVW A;  1A3P A;  3SW2 A;  2J2U B;  3ASI A;  1NZI A;  1ATA A;  2YGO A;  1K36 A;  1UZQ A;  1PFX L;  1H6L A;  4O5T A;  2Y38 A;  2KB9 A;  3BPS E;  3N8X A;  2IAT A;  2W2M E;  2KV4 A;  2P95 L;  1FF7 A;  2AYL A;  1E1A A;  2EI8 B;  3TC9 A;  1EQH A;  3OLU A;  2Q1J B;  1NPE A;  3G4H A;  2W3I B;  3KYA A;  2XBV L;  1FE2 A;  1EMO A;  1IQF L;  4Y7B B;  2FP9 A;  1EPH A;  1SZB A;  2FLB L;  2BO2 A;  3NT1 A;  2WYG B;  2V91 A;  3CA7 A;  3V65 B;  3WWA A;  4O5S A;  1HX2 A;  3O4P A;  2WG3 C;  3KQC L;  4OTY A;  2ISM A;  4CUF A;  1TPG A;  3S8V A;  1HAE A;  2J95 B;  3CEN L;  1JV2 B;  2EI6 B;  1M1X B;  1OB1 C;  4E1G A;  1HRE A;  5D9C A;  4BXS A;  2B7D L;  3HO3 A;  2W2O E;  3KGG A;  2K2S B;  1K37 A;  1KLJ L;  4JZE L;  3H5C B;  2GHS A;  2WPM E;  1PGE A;  2P93 L;  1IQL L;  2Y80 B;  4ZXY L;  4YT7 L;  4GN8 A;  1HT5 A;  1IQI L;  4X8V L;  4GNB A;  2MGP A;  1WHE A;  2WPJ E;  1GK5 A;  1PTH A;  1MOX C;  2GVU A;  4CSY A;  1CCF A;  1V3X B;  5JW1 A;  3LI5 A;  5IKV A;  1B9W A;  1I0U A;  1CVW L;  4NA9 L;  2YGP A;  2W2N E;  5KIR A;  1HRF A;  3N8Z A;  1Q7F A;  2IAX A;  1ZAQ A;  2P3T A;  4RS0 A;  1NFU B;  1IQN L;  4JYU L;  2XBX L;  1YGC L;  4Y76 B;  3ZYI B;  2FLG A;  1EAI C;  1RWL A;  1WHF A;  1NFY B;  4Q1U A;  3P5B L;  1G2L B;  4BTT A;  5KN5 C;  5GX1 A;  5CKN A;  1C5M F;  1CCV A;  3NTB A;  5CKM A;  3U7U G;  2PUQ L;  2BZ6 L;  1HZ8 A;  5L30 L;  1C5K A;  2Y5F L;  2Y82 B;  4XLW A;  1RFN B;  5IKT A;  3ENS A;  2MHP A;  3DEM A;  2P94 L;  4JZD L;  2OJH A;  2IAW A;  1O5D L;  3LAQ A;  4R40 A;  4ZLR A;  1YUK B;  4GNA A;  4BXW A;  3I1C A;  3KK6 A;  3HLH A;  3KL6 B;  2P3F N;  3TBD A;  1EGF A;  2XBW L;  4Y79 B;  5JBB E;  2UWL B;  1LPZ A;  5JBA E;  3RR3 A;  2P26 A;  2Y81 B;  4ISH L;  1U67 A;  2FPC A;  1YO8 A;  5GTQ A;  1P0S L;  2KNI A;  2IAP A;  4HHO A;  5D9D A;  2JKH L;  4JYV L;  2XBY L;  5JVY A;  1CX2 A;  1EBV A;  5COX A;  3LIW B;  3DR2 A;  4Z0L A;  3S2K A;  2WPL E;  4YT6 L;  4Z0K B;  3FVZ A;  1IQJ L;  3IJE B;  4X8T L;  1G1S A;  4RUT A;  1NQL B;  5EX7 A;  2UWP B;  4OTJ A;  5FDQ A;  2DG0 A;  2W8B B;  1IQE L;  3GCW E;  3IIT B;  2BOH A;  3BT1 A;  1JBU L;  3M36 L;  3SRE A;  1IOX A;  5E8D A;  4D90 A;  2P4O A;  1X7A L;  4BTI A;  3U73 A;  4GNC A;  2GD4 A;  4MMY B;  1XDT R;  3N8W B;  2FPB A;  2H9E C;  1ATB A;  3CFW A;  4AQT A;  1V04 A;  2QE8 A;  3DAS A;  1CVU A;  3V1S A;  4ZH8 B;  3GIS X;  3FBY A;  1F0S B;  5F19 A;  2F9B L;  4D0E A;  1IQM L;  2P28 B;  1U8C B;  4IYG A;  2IAS A;  1EQG A;  2Y5G L;  1KLI L;  3PGH A;  1L5G B;  1NT0 A;  4PH9 A;  2POO A;  4JML A;  1ADX A;  1APO A;  3NTG A;  1KIG L;  2RHP A;  4BDW A;  2W2P E;  4MMX B;  4M10 A;  1QLG A;  1EPJ A;  2K2T A;  2WZP P;  5JBC E;  2BOK L;  4FM5 A;  1LQD A;  3HRP A;  1TLE A;  1APQ A;  3S8Z A;  3CS7 L;  2IAO A;  1DQB A;  5GX4 A;  1HCG B;  3HS7 A;  5EGM B;  2XC0 L;  1UZJ A;  4RRX A;  1IQK L;  2Y5H L;  2IAU A;  1YUF A;  2TGF A;  2BOX A;  3E5Z A;  1Z6E L;  1FFM A;  2OYU P;  5IKR A;  2OYE P;  5CIS A;  4HW6 A;  2Y7Z B;  5CKQ A;  2YGQ A;  4HHQ A;  5GX3 A;  3V64 C;  4BDX A;  1MQ6 L;  2I9A A;  2G00 L;  4Y71 B;  6COX A;  3LN1 A;  3S94 A;  3LC3 B;  3QH0 A;  1XFE A;  2H9E L;  5L2Y L;  1IGX A;  3FFG L;  2FZZ L;  1UZK A;  3HLI A;  4GN7 A;  3WW9 A;  2DSO A;  1NFX B;  2G8S A;  2RNL A;  5JB9 E;  1IQG L;  3N8V A;  1W7X L;  3Q7D A;  1PJX A;  1LMM A;  3K9X A;  3Q3K B;  2VH6 B;  3M37 L;  2FP8 A;  3HS5 A;  1XKB A;  3TK5 B;  1J9C L;  1UZP A;  2I9B A;  3N8Y B;  4DG6 A;  1LMJ A;  1L3Y A;  2P16 L;  3MQE A;  3FW0 A;  5K0H B;  2W3K B;  4GN9 A;  3HO4 A;  2J38 B;  1IGZ A;  4BTU A;  1PRH A;  1CEJ A;  2Y7X B;  3LI4 A;  2WPH E;  2RA0 L;  2J34 B;  1HAF A;  3Q6P A;  4X8U L;  4CUE A;  2P3U A;  4RRY A;  3AMR A;  5D9B A;  1EPI A;  1IJQ A;  1FJS L;  4XBM A;  2GVV A;  3BYC A;  1WU1 B;  4O02 B;  2PR3 B;  1IVO C;  4NG9 L;  3Q6K A;  3SOV A;  4G1M B;  2D1J B;  3Q6T A;  3F6U L;  1DX5 I;  1F7M A;  1FAX L;  2BQW A;  1EMN A;  3C9A C;  1MQ5 L;  2MGR A;  5GX2 A;  3GCX E;  4ISI L;  1CQ1 A;  3HS6 A;  5JB8 E;  1ATE A;  2WYJ B;  1LPK A;  2XC4 L;  3LC5 B;  2W2Q E;  1CRZ A;  2HQS A;  1NFW B;  4A7I A;  1W8B L;  4A0P A;  3LN0 A;  4ZXX L;  4M11 A;  3LTF B;  4A94 C;  1N1I A;  3S6X A;  3TZI A;  4C16 A;  3EGF A;  2ADX A;  3HPT A;  4Z6A L;  2WPK E;  2DG1 A;  2BMG A;  4RRW A;  2UWO B;  1FAK L;  2EI7 B;  2VVV L;  4YZU B;  2WFX B;  1F0R B;  3LI3 A;  2XC5 L;  5FWW A;  1XKA L;  2FD6 A;  2IAQ A;  2VJ3 A;  2W86 A;  1RWI A;  1N7D A;  1ATD A;  1CRU A;  1IOE L;  4O1Z A;  5I46 L;  4ZHA B;  1EZQ B;  1QBI A;  2IAV A;  1FSB A;  2CJI B;  1DDX A;  2VWL L;  1QFK L;  3FCS B;  2VWN L;  3G4E A;  3TGF A;  3OLT A;  1AUT L;  3TH3 L;  3HO5 A;  1URK A;  3KQE L;  1F7E A;  3N8Y A;  2VAQ A;  4Y6D B;  3MDL A;  2M74 A;  1IQH L;  3SRG A;  3QMO A;  4CUD A;  3A9G A;  2J94 B;  4PWZ A;  4RRZ A;  2WFT A;  1KSN B;  3SOB B;  4IMB A;  1EPG A;  1CVM A;  1G1R A;  3U0S A;  2BQ7 A;  1DIY A;  1Z6C A;  2BQ6 A;  1Q4G A;  2VVU L;  3F1S B;  5IKQ A;  5F1A A;  1IP0 A;  1POO A;  1HT8 A;  1JL9 A;  3NJP C;  3KQB L;  5GX5 A;  1NPE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...