The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
153
|
sequence length |
469
|
structure length |
418
|
Chain Sequence |
MILKLYNTRTKDFSELTNFENVKVYACGPTVYNYAHIGNFRTYIFGDLLIKTLRFLGYKVNYAMNITDIGHLLTVYEISEFFTEAFFNDCRKLNIVYPDKVLVASKHIPIMIEVVKILEEKKITYFSNGNVYFDTSCFKSYGEMAGFKRNKTDFVLWFTNSKMKWDSPWGFGYPSWHLECAAMNLEYFKDALDIHLGGVDHIGVHHINEIAIAECFLNKKWCDVFVHGEFLIMDFITVKDLEDQNFSPLDFRYLCLTSHYRNQLKFSLDNLQASKIARENLINKLSYFYESLDPVDLNTLNKDLKNFGFSVEKEYYDSFVEKISFDLNVAQGLALLWEIIKSDNLSFVSKLRLAFIFDEIMSLNLREEILKNLQNHDVVIDENMKALIEERRIAKCEKNFKRADEIRDFFAKKGFVLV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Ligand co-crystallization of aminoacyl-tRNA synthetases from infectious disease organisms.
pubmed doi rcsb |
molecule tags |
Ligase
|
source organism |
Borrelia burgdorferi
|
molecule keywords |
Cysteinyl-tRNA synthetase
|
total genus |
153
|
structure length |
418
|
sequence length |
469
|
chains with identical sequence |
B
|
ec nomenclature |
ec
6.1.1.16: Cysteine--tRNA ligase. |
pdb deposition date | 2011-06-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01406 | tRNA-synt_1e | tRNA synthetases class I (C) catalytic domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Four Helix Bundle (Hemerythrin (Met), subunit A) | Four Helix Bundle (Hemerythrin (Met), subunit A) | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | HUPs |