3SP1A

Crystal structure of cysteinyl-trna synthetase (cyss) from borrelia burgdorferi
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
469
structure length
418
Chain Sequence
MILKLYNTRTKDFSELTNFENVKVYACGPTVYNYAHIGNFRTYIFGDLLIKTLRFLGYKVNYAMNITDIGHLLTVYEISEFFTEAFFNDCRKLNIVYPDKVLVASKHIPIMIEVVKILEEKKITYFSNGNVYFDTSCFKSYGEMAGFKRNKTDFVLWFTNSKMKWDSPWGFGYPSWHLECAAMNLEYFKDALDIHLGGVDHIGVHHINEIAIAECFLNKKWCDVFVHGEFLIMDFITVKDLEDQNFSPLDFRYLCLTSHYRNQLKFSLDNLQASKIARENLINKLSYFYESLDPVDLNTLNKDLKNFGFSVEKEYYDSFVEKISFDLNVAQGLALLWEIIKSDNLSFVSKLRLAFIFDEIMSLNLREEILKNLQNHDVVIDENMKALIEERRIAKCEKNFKRADEIRDFFAKKGFVLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand co-crystallization of aminoacyl-tRNA synthetases from infectious disease organisms.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Ligase
molecule keywords Cysteinyl-tRNA synthetase
total genus 153
structure length 418
sequence length 469
chains with identical sequence B
ec nomenclature ec 6.1.1.16: Cysteine--tRNA ligase.
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01406 tRNA-synt_1e tRNA synthetases class I (C) catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1910 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3sp1A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3sp1A01
5FO0A 2X1MA 2V0CA 4HJXA 3SDBA 2A88A 2QUIA 1WJGA 1QRUA 2WSIA 3A2KA 3CLSC 1FYDA 1NUUA 4DLPA 4OJMX 5KCMA 1QQTA 3AFHA 5J58A 1X8XA 4EG7A 1Q11A 3RHSA 4S1OA 2H29A 4DE5A 2O5RA 1NUPA 1KP3A 1SURA 4DDHA 1EFPA 3L92A 4ZCQA 3IOEA 5TS2A 1M8JA 2HGZA 2CV0A 4ARCA 3RK0A 1BS2A 1G8GA 4OUDB 1I6KA 3SZ3A 4MVWA 1WKBA 3A05A 3SYTA 1KKUA 2GOYA 3COZA 3K9WA 3ISJA 2DXIA 3MMXA 2Z09A 2EL7A 1G59A 1LI5A 3IVXA 4KPUB 1KH2A 3G5AA 2AG6A 1VL2A 1KAMA 3LE8A 3ZJVA 1N2OA 4K03A 4ZCRA 1N2GA 1S4MA 2WQ7A 1NUQA 4GRIA 1WOYA 1OWPA 3GMIA 1XNJA 3PRHA 4MW4A 4Q16A 4XSVA 4RUKA 4GU5A 1YI8A 1TYDE 1J09A 4ZT4A 3FDXA 1NURA 5LLTA 1TQ8A 3KT3A 5FO1A 1IFXA 3U1VA 2Z3VA 3CLSD 3CR8A 2IJGX 1QU3A 2PXHA 1K97A 1OWLA 3ND6A 5HUJA 2YY5A 3KT0A 1NP7A 1U3DA 1J70A 2IELA 3A04A 3ILVA 1O0CA 1TYAE 3ZIUA 3MUEA 3NBKA 1EE1A 2PZBA 1JHDA 1NSYA 2DUMA 4CDMA 1J1ZA 1MOPA 1JEEA 4KKVA 3RJZA 4ARIA 2A1UB 2JANA 2E0IA 2X1LA 4MULA 3BL5A 1JMVA 2NZ2A 5AHWA 1O6BA 4HJRA 1WZ2A 5DEOA 4R0NA 3D6VA 3HMQA 4EG8A 1Q19A 3P0JA 4JXXA 1G8FA 2CT8A 1X6VA 3K32A 4MW5A 3IMCA 1WXIA 3COYA 1YUNA 2JAXA 2D54A 5JBNA 3IOCA 3QTBA 1ILEA 1RQGA 4DJAA 3H9BA 2X0KA 4J76A 2E18A 4AQ7A 4MWCA 2PG3A 2QUHA 3Q4GA 1N77A 4EFKA 1O96A 3PXUA 3Q10A 1OWNA 3QE4A 1T6ZA 5LM3A 2J07A 4MUEA 1F7VA 3JXEA 1N2BA 3N05A 1U0BB 1QU2A 3UMVA 1GPMA 4HK4A 3CLTC 1R6XA 3UK2A 3HL4A 1M83A 1XJQA 1MJHA 4G5FA 3HV0A 1U3CA 2QTMA 3N9IA 4MAFA 3CVVA 2EJCA 1JZQA 5BNZA 4TS1A 1MRZA 3SP1A 3IVGA 4G5YA 3FI0A 1U7DA 3IODA 4QREA 1MB2A 1EXDA 3TNJA 4F4HA 1N2HA 3COWA 4MUHA 1ZUNA 4AS1A 1I2DA 4NDAA 4EG4A 4R2LA 4ZT3A 1V8FA 1QTQA 1ZH6A 1G8HA 1NZJA 4BWVA 4FZJA 1KH1A 2C5SA 1QRSA 1IH8A 4JYZA 2ZUFA 2YXNA 4YP7A 1D2RA 4JFAA 3KT8A 4MW0A 4F3RA 3GLVA 3ZJTA 1DNPA 2GKSA 3FHJA 2QUJA 2QJTA 1JIIA 2QJOA 3N2YA 4ZCPA 4UZFA 2QTRA 1NUSA 1CT9A 1IVSA 1VBKA 4WNYA 3G6KA 1MBZA 2E89A 3SEZA 1GZUA 4G6ZA 1JGTA 3L93A 3CLRD 1JIKA 1T6XA 4P2BA 1KP2A 4MUGA 4MUJA 3FH0A 3CVYA 1H1TA 1WQ4A 3FOCA 4YP6A 2CFOA 1IHOA 1T6YA 3VU8A 4NX2A 1PFYA 1ZJWA 2IP1A 2WQ6A 4L2IA 1ZH0A 2A1TS 2OQ2A 3IDFA 4E1AA 1M8GA 2TS1A 4QBTA 1M8PA 2I1LA 2YWBA 3KT6A 3OTWA 4ZCTA 1Y42X 5TGTA 4WSOA 2CV2A 1OWOA 3ZGZA 4ZT7A 2B7LA 3LCJA 5IHXA 1EFPB 3OP1A 2HMAA 2QJFA 3H9CA 2CYBA 4ZCSA 3E27A 2J09A 5TEWA 1XNGA 4XFJA 1KR2A 2VTBB 3QTTA 1N2IA 2RE8A 4L2IB 3HZRA 4MWDA 1H3EA 3AKZA 4MQ6A 1JECA 4CDNA 4XFDA 2QUKA 1N3LA 3VRHA 1TYCA 1EJ2A 3INNA 1IRXA 4KPUA 3ND7A 3IVCA 2PIDA 5HG0A 3FNRA 1COZA 1V47A 1N75A 2J5BA 1R6UA 2CUZA 1IQ0A 3TQOA 1TEZA 1MAUA 3GUZA 4EG1A 4DDMA 2A1UA 2X3FA 3CLUC 3I05A 1K92A 2H2AA 3ELBA 3KFLA 1O97C 1EUYA 1EUQA 2QTNA 1OBHA 2YWCA 4DNXA 5HUHA 1O97D 3IUBA 1NUTA 4J75A 1T9GR 4QRDA 4ZT2A 1K4KA 2ZUEA 1OBCA 5DASA 1OWMA 1QRTA 1EFVB 2PZAA 3RBAA 2CSXA 2A84A 1QJCA 3H05A 2CYCA 2PZ8A 2XRZA 4MW9A 1A8HA 2DEUA 1T9GS 3AL0C 1F7UA 2OV4A 3FETA 3DV2A 2D13A 3ZUGA 4MLPA 3COVA 3TS1A 2A7XA 1O95D 5K0SA 3AG6A 1O94D 1M8FA 5K0TA 4MWBA 2A4MA 1PG0A 1PFVA 1O95C 4I6JA 2BYTA 1GN8A 2JA2A 1TYBE 1Q15A 4R2MA 1I6MA 2CYAA 1P7PA 1F9AA 1XNHA 4MW7A 4MW2A 1YIAA 3VGJA 1WXFA 3N8HA 4MUFA 3UOWA 4NAHA 2V0GA 1ULHA 4NAUA 1JZSA 1GLNA 2CV1A 2BTEA 3IMEA 1LI7A 1UFVA 4KR9A 3H99A 1HYBA 3FG9A 4MUNA 3C8ZA 5LFAA 4U63A 3DLAA 4Q93A 2D5BA 4ZT5A 1OD6A 1N78A 1KH3A 4ND6A 3Q12A 1WY5A 3ZJUA 1M1ZA 4HPWA 1GAXA 4ND7A 3CVXA 1QNFA 4EG3A 4OUDA 5IJXA 3TQIA 4U7JA 2WB2A 4PBRA 3X1KA 2DPLA 3F3MA 1NI5A 3P52A 4X0EA 3TZLA 5DK4A 2J4DA 1TFUA 3ZXSA 4MVCA 4RPIA 1WXGA 4YMIA 5FNZA 3IOBA 3CLRC 1JEDA 4A91A 2GM3A 1MB9A 2R5WA 3NV7A 1J1UA 3UC5A 1H3NA 1M8KA 2RD2A 1IQRA 4EGAA 4MUIA 1KQNA 1PFWA 1WXHA 1I6LA 3M5WA 3DO8A 4YP5A 3IMGA 4DDKA 1N2JA 3LOQA 3TZEA 4PY2A 1KAQA 5H16A 3SZGA 2PFSA 4U8HA 1J20A 4MW1A 1U7XA 1IQUA 4I6GA 2VTBA 1B6TA 3AIIA 4YBRA 3X1JA 3IH5A 3MLBA 1WQ3A 4EG6A 3AG5A 3NBAA 4PBTA 2AZXA 4MW6A 1O94C 3CLTD 1KQOA 2NSYA 3PNVA 5J5AA 4NATA 5KWVA 2A86A 1PG2A 3G59A 1VBMA 4EG5A 3HFJA 3IUEA 3MXTA 2DLCX 4NZPA 4I6EA 2ZP1A 5EKDA 1VBNA 3PNBA 3ZXIA 3SEQA 5DB4A 4UZEA 3ND5A 2DR2A 1N1DA 1KORA 1N2EA 1YUMA 1NYLA 1GTSA 2DERA 3PNYA 3CVWA 1FFYA 1MC1A 4CQNA 3CVUA 5KHAA 4H3SA 4KR6A 4K0RA 3FWKA 4PBSA 4CT0A 1KQPA 2A1TR 2O8VA 1JILA 1YULA 3D6UA 4MVYA 1LW7A 3S3TA 4ZT6A 3RK1A 1H3FA 2G36A 1EFVA 1VLHA 2VXOA 4MWEA 1Q77A 2AKEA 4JXZA 3A4IA 1O96B 3H97A 1MAWA 3HGMA 3DPIA 1O5TA 1PFUA 3CA8A 4MUKA 3MLAA 1YIDA 3FIUA 3P0HA 4KR7A 2J08A 2XRYA 1JIJA 3P0IA 1R6TA 2E21A 2DETA 4EF6A 3X1MA 3CLUD 3UY4A 1O0BA 4MVXA 3FY4A 1K4MA 4JZYA 5H7XA 1WXEA 5J59A 1GTRA 1F4LA 3RFFA 2HZ7A 1J21A 5TEVA 2Z08A 5F23A
chains in the Genus database with same CATH superfamily
3HNLA 5ELMA 3O8QA 3OCYA 4BIMA 4CMKA 2OVBA 1PF7E 2N46A 2ODTX 2P3OA 2Y92A 1A9RA 4KSCA 4A6XA 4D4GA 1V5IA 3VDQA 1VK5A 1AC5A 3GB9A 2XQFA 1YAUO 5E2IA 1JFVA 4DRXB 3A2KA 1NUUA 4BVGA 4TYWA 3M81A 3TECE 3JU3A 3DYVA 1X8XA 2CXHA 1NBAA 4GW3A 4ER7A 5ICMA 4B8YA 3X2EA 5TSDA 1PGNA 1ZNWA 2D74A 2WMOB 2PX2A 4Q7EA 4P53A 2HA2A 4JUIA 5K0LA 2D8AA 4DUGA 3SDSA 5JY6A 1OLSA 1JLMA 1P73A 4ARBA 4YI5A 3T3GA 5EJ8A 1ATIA 2DSTA 1G0OA 1VPEA 1IDN1 2V7QA 4MA0A 5F1YA 1L8LA 5DI9A 4KE7A 3KZCA 4PQEA 2D2VA 2VF7A 2Y3DA 1G21B 2BKUA 1M8JA 1MMAA 1QZZA 3EAQA 2VJQA 3TTTA 1B8PA 1LC3A 1WSDA 2BFCA 4ZI3A 1T1SA 2FEKA 2GXUA 2I4OA 2O2IA 2AMFA 1YA7O 1AKYA 1Q0MA 4PR3A 3MWYW 4G0XA 1A9YA 3NHRA 2B3DA 5HOQA 1PJCA 1C0PA 1PJ8A 4CM8B 2PNOA 4HQOA 3V55A 4TV9B 2NUPB 1RLIA 1M3SA 4RLHA 4CKYA 4V1CA 4EBFA 4X94A 3THXA 1SNYA 1V0JA 1YDMA 4X8LA 2BBOA 1L7RA 5DTRA 3KQMA 4CR6A 3ADKA 1QGED 1KEUA 4H1TA 3VDMA 3HXPA 2YHIB 3SIPA 3ABQB 5CM8B 1VHQA 1A9XB 4I81A 4UVGA 1D7AA 1KYQA 1U4OA 2R8OA 2IZ0A 4GYKA 4RWEA 5ALKA 3V7OA 2ZRKA 1J9GA 3MPOA 4BVBA 2BAGA 4P7GA 4IDPA 2ZPUA 1WOLA 3AERB 4LBWA 1OI4A 4F2DA 1MCZA 3G6WA 4KR3A 1L8AA 3SC3A 3L7MA 2O7VA 4B45A 4JP1A 4PINA 2X0DA 4K1XA 3UANA 1VLZA 4LNAA 3WLRA 2AOUB 3LUKA 5AI6A 2B83A 2VOJA 1I7LA 4Z8XA 4L7QA 3TIVA 3ZZNA 4AL4A 1K0FA 3DDWA 1FJ2A 1TM1E 1Z74A 3EMDA 2VAMA 3OZEA 5E1OA 1AS0A 5KYGA 1YC5A 2HQBA 4MO2A 4UMEA 1BZYA 4WKBA 5HM8A 2IELA 4AJ9A 4EFLA 4D9BA 4RADA 3ZH2A 4O25A 4WERA 4CEJB 1TYAE 1XN4A 4HGNA 3THWB 2F59A 3E05A 6NULA 1Y7IA 5BO5A 1IJKA 5CI8A 2XUJA 1PJSA 4R1TA 1C3VA 2VKTA 3BD7A 3I04A 3OEEA 5FR1A 1TWHA 4G67A 3A4LA 2YW9A 4A8TA 1OTYA 2I3GA 3OO0A 4X6XA 1IM8A 2MYNA 5EKXA 4P3PA 1PS9A 3P4UA 3GLIA 4OX9Y 2YDXA 1OI3A 4WJZA 4TWBA 4ZVTA 3UKDA 5EUMA 4A26A 4C88A 2JLYA 1WN0A 4MULA 4OXYA 3TOMA 3COSA 4JYCA 1JKMA 4WK4B 4PM4A 1KZ4A 4WUVA 4IIXA 4IVRA 4UEWA 4R41A 4UMFA 4EABA 3ZHQA 1YR1A 1G2OA 5JDIA 3VC1A 3HYNA 1E1CB 4GBED 4MW5A 4HATA 1SUWA 2AWOA 3WZLA 5FFMA 1TT5B 2AN9A 1FPMA 2B3TA 3FGOA 5H82A 1WAMA 1C7JA 4NZYA 2JASA 1FMTA 4G4SO 5DJ5A 2XL4A 4G7HF 1NXWA 1YR2A 4J76A 4KG7A 3IBCA 3RSHA 3T5PA 2DHDA 1WCV1 3H42B 3WR5A 1GGHA 1WIWA 2HADA 4ZYVA 3A4YA 3FPAA 1P5JA 1K3FA 3MYRA 1JLSA 4EIYA 3ESXA 4PTZA 4NFHA 5EWMB 3IRUA 5EG5A 3SX0A 2B8WA 2ZBEA 4U3JB 4HX9A 3FGPA 1U0BB 3ONWA 3ROKA 4NYIR 5AKZA 4D8XA 3CLTC 4CCAA 1G19A 5G3ZA 2FMHA 3F7MA 2VUTA 4DRZA 1YLMA 4JL8A 1OXBA 1SZIA 2XQVA 4ATNA 4TVOA 2J5QA 4G5FA 5HIMA 3V6LA 2H00A 3FDZB 3VC2A 1J2YA 3B51X 2QTMA 3LJBA 3GD5A 3L2OB 4FT2A 3IO5A 4JEUA 4W6QA 4W9NA 2OYRA 4G07A 2PKXA 3SZMA 4PPQA 4B85A 3U4CA 4IKOA 3RRZA 4OH7A 3UBTA 5HHTA 5JSZB 1U2RA 2WSSA 2PA3A 1PV1A 1NT4A 1AB6A 1UF9A 4DNPA 3JPWA 1FTGA 1GPJA 4KPEC 4LFAB 3FTDA 1U6JA 2QR2A 4Z9HA 1CZHA 4BFCA 4KO2S 3ZHOA 2A78A 5BWOA 1RJFA 3CO5A 3WRYA 5BSFA 3PDUA 1YRYE 4BWVA 3ICQB 5FLXA 2V8OA 5I4KA 3O1JC 1C7ZA 1T8SA 5HKLA 5JWRA 1Z7YA 3I6IA 3BGOS 4JYZA 4I99A 3K94A 3QEJA 1FFXB 1IMJA 2JLCA 1U11A 3RKOF 5T6BA 1E1RA 4J29A 5EHHA 1BG6A 2W83A 2D0OB 3MWLA 5FJJA 2J6CA 2NX2A 3PQ6A 1V1RB 2X8LA 3R20A 1M7HA 2Z1NA 2QTLA 5DYYA 4J2HA 5BW6B 1ZJJA 1VG9B 4M1EA 1Y3CE 3CWZA 2HK7A 4A0GA 2DQKA 2QZ9A 4B6OA 2P27A 4H0FA 5B3JC 1NUAA 3SHQA 4F97A 5C7OO 1X8JA 3O94A 3WK9A 4YJGA 4UCFA 4Q24A 3EVZA 4LMBA 4RS3A 1PDWA 3ZE8A 4YP6A 4YACA 4UE2A 3HRKA 1U8TA 3P26A 1I14A 3CEMA 3QELB 4JXKA 2PX8A 4YRCA 4I1YA 3TDKA 4MGKR 3W4JA 2X5XA 1JT9A 3X1XA 5AW7A 2UYYA 1BKSB 1R0SA 2WTNA 3PUKA 2AUMA 1VLTA 1IL0A 1IATA 2X9GA 3KEGA 4FJ1A 3ROQA 1U5AA 1JPJA 4MR9B 4NJEB 4IIVA 3F6EX 3CH4B 3DBRA 4PG7A 4Y0AA 5J2UB 2ZUCA 5A4IS 2VHTA 1KPGA 1PR5A 4QQKA 1B0ZA 4R7ZA 3M4CA 3TTUA 4COOA 5IAJA 1C1DB 1JSLA 1QF9A 1ZA2A 4C7BA 2GN4A 4GLOA 3EPHA 1BU8A 1EFPB 1W4LA 4TT3D 5B1SA 2WSYB 2CYBA 5TEWA 1SZPA 1KZGB 3I62A 4DCCA 5BYKA 4C4AA 2QYHA 3DYBA 4QWMA 4LCBA 1PIWA 4OQXA 1FDUA 3PDHA 1RZVA 2IUSA 3I8SA 4HB4A 5CDSA 1QQ6A 2L6FA 2VYVA 3W8RA 4CV3A 4XYLA 4MVJD 2ONJA 5E9JA 4DJFC 2IGBA 3PU6A 1LRLA 3RQEA 5GOZA 3PIRA 5BUQA 3H2IA 5CYGA 5EQFA 1Q12A 2DOKA 2X9QA 1GCIA 5DTQA 3TD9A 3JS5A 1T2FA 3VX3A 4EYKA 1KJZA 3EZLA 1KEEA 2AW3A 2OVFA 1ORTA 4KWHA 5DRTA 4RKQA 4E7OA 4DCTA 3SC6A 2OUKA 5LZ7A 3W8FA 1NE2A 1ZEJA 3DBLB 4GPZA 3I09A 4JUAA 3VHXB 4DLKA 3KVOA 4K8RB 4BE9A 2I78A 4JU9A 4MARA 4K1LA 4PYRA 1N3YA 3DZGA 3C4VA 4IGIA 1SHLA 1YVRA 2C5FA 4Z0NA 2NV0A 5HS6A 3E23A 3DUFA 3AHGA 3IOMA 1JQAA 1ST3A 2TMDA 1VZ3A 1P1FA 4LY9A 3R9IA 1E96A 1J06A 1WUHS 2FRVA 3R75A 4D81A 1KBQA 1Z17A 5GGYA 1GZ7A 3PL1A 1FNSA 2LNDA 4PZLA 4XIJA 1C80A 1MMFB 2DBYA 1SOVA 2GPTA 4GBMA 1T8WA 1EFLA 3D64A 2AN3A 3KUCA 4R1MA 3ROGA 4YRDA 5A0VA 3GJTA 3FE2A 3R6WA 2RGRA 5JMWA 3JYHA 3KFVA 3VAAA 3VSCA 5GONB 3VKFA 2WFAA 3DF9A 3NHFA 4E6EA 5I9NA 2FHSA 2HIMA 1YBFA 2PDAA 3JD4A 1GEEA 2DCUA 3F8WA 3OP4A 1N1MA 4OHMA 1ZOSA 2G9VA 3RSZA 2PX5A 1ZM3A 4BWYA 2QORA 3DV2A 4I2VA 4KEAA 3ZI4A 3ZUGA 4EPTA 1T6QA 1NJ6A 2IM8A 1WV1A 1BDJB 3LF2A 3RC7A 1QIFA 1HNZB 1K9SA 2I3BA 4J16C 1AS3A 4RXUA 2GNAA 1XZBA 3MVEA 1S2LA 1XTRA 1UBNA 2C9MA 2A3RA 1ZH8A 3SNKA 1N1CA 3FGZA 2H7VC 1PUJA 2CXPA 3BDAA 3NKEA 3K32A 4M8NE 4L74A 4MXDA 4QOGA 4RK6A 5CPFA 4HX5A 1Q1GA 1XMJA 1AF4A 2JFGA 3TLMA 3CZRA 4FFSA 4BNYA 5FPQA 1DAMA 4MUFA 5JATA 1ECPA 4B8ZA 4BZQA 1DUVG 4AMBA 3OTIA 5LQCA 2BH9A 2GARA 2X8WA 2AYXA 1HMDA 2CDQA 3N75A 4GDMA 1WSAA 2P5TB 5LOVF 13PKA 4G7OF 1OLOA 3HRIA 3HU3A 3QMVA 1E2NA 4RTLA 5LQMA 5CU7A 2X4LA 2EIKC 1CQZA 2ODAA 2O2CA 1JI0A 3Q3VA 4NE7A 2NU6A 1SVWA 1G5QA 3QPCA 4G5SA 3AXSA 3W77A 3U3MA 3WOVA 4LJ5A 1GGKA 1KJYA 3UJDA 4C87A 1XMQB 3RVYA 1OAOA 1N78A 1EMDA 2P9HA 4HFKB 1ZY2A 3BVPA 3MQ4A 1U0GA 2DU8A 4DLVA 4EJSB 10MHA 1ND6A 4XAQA 4PFOA 2VS1A 3Q2OA 4AYWA 2GD0A 4KFUA 4LISA 1PNRA 1Q1NA 2BFCB 4ZKDA 1YZHA 4E32A 2YX1A 2Q3DA 2OFXA 3HU1A 3OQ1A 4E5PA 4RH3A 5B6PA 4KWEA 5CCBA 2HO5A 4RSMA 3ZXSA 1DT5A 5FAKA 2PQ2A 5K3BA 4FUTA 4QICA 1CULC 5FWAA 3RF7A 5CFRA 5GVSA 4RHFA 1FW6A 2NUPA 4WHMA 1NFQA 2ODPA 2IXFA 4AK9A 3GEPA 4HB2A 5FPKA 3L18A 5K4GA 1J1UA 2BKVA 2YHBA 3KLMX 1WXWA 3KL2A 4HFNA 3UC5A 1II9A 3RUDA 3EWNA 4L6AA 3OMLA 4UXIA 4MVQA 5FOUA 2J33A 4S1VA 2CC2A 2VYND 4H3KB 1PVVA 1ZGJA 2Z57A 3UENA 1WCWA 4XOIA 5I3ZA 4DIFA 5K3EA 3MW8A 5CA1A 2PMWB 3GLFB 4W5TA 2YJGA 3LPCA 1BMDA 5HBRA 3UXHA 5H9WA 4TXNA 5LMNB 3K6SA 3GUVA 1IHPA 2FMXA 3B1VA 4XSHA 4EA9A 4OQNA 4EIWA 5JEDA 1DOAA 3RH0A 2CGEA 3R0JA 2R7KA 5DU2A 4MDYA 4HN9A 5FWDA 2VXBA 1EPUA 2WU0A 2QIPA 2R00A 3EVFA 5DBIA 4M6WB 2ZSDA 2G09A 4J7CA 4YBRA 1T0IA 2VYCA 3G9QA 3QMWA 1O89A 1AQ6A 1FNMA 2IYUA 2GASA 2W43A 4GYYA 4AL1A 4M36A 3W5JA 2CL7X 2FDCA 2WJIA 3TG2A 1UFRA 1W76A 2W9XA 5KNCA 4OGKA 1Y3DE 2WIFA 2M6SA 4FQ7A 2JIOA 2B0CA 2NTNA 3D6TB 2ZCUA 3RJMA 2NSYA 3EK2A 2ZXUA 3WGKA 4BLTA 2A86A 3SK0A 3S28A 1XRJA 5I9TA 3TCXB 5FHRA 1NVVQ 2AZMA 2GJKA 1WWPA 2V98A 5LUBA 4LJ4A 3ZU2A 5FTLA 5LDHA 5TXGA 3ABSB 1XVUA 3R3XA 5B64A 1R5ID 2GB4A 3FZGA 2BSAA 3IVAA 1SKUA 3HZHA 4WKCA 3PNBA 2Z9BA 1G1AA 1C29B 4XIGS 4RK7A 1MMDA 3AR8A 3SEQA 5KUTA 4MJ7A 1TU0A 2ETSA 3A6HA 3BWCA 3BBLA 1E0SA 4NHOA 4OXXA 3MELA 4DLZA 4MQMA 4MEAA 1ARZA 2XUPA 4P38A 1CQWA 2DPGA 4HUTA 4OQQA 3DBOB 2HR1A 2CNDA 2CSUA 3EVAA 4KE9A 3X3HA 3U5ZB 5FUBA 2XGJA 1E3TA 3JD0A 1ENOA 2CB9A 2ZBGA 1N9KA 5HCUA 2VCEA 1W2WA 2OMEA 2A9OA 5A4AA 4DXWA 1WUJS 3WMRA 2OYSA 4WXHA 3ZXXA 2WF5A 1GL7A 3PVZA 3KFXA 2HMTA 4KK4A 2VCBA 5B7GA 4JBIA 2GYWA 2ZXEA 4YJDA 1EP9A 1QGDA 2GF0A 2NYAA 4K9NA 3LHKA 4KMSA 2BRUA 3IAEA 1AZLA 2BGLA 2VXOA 4ON9A 2ZLBA 1DDOA 4QOHA 2GT1A 2O8EA 2C3YA 3O93A 1KHTA 1O96B 1E9RA 2OB2A 4OBWA 1E77A 4IDDA 4XWKA 4YBZA 1Y7TA 2NSGA 5EZYA 3U7RA 3P0HA 1XTVA 2H65A 2EDCA 2H4XA 1GNLA 3BXOA 3G0IA 3GEGA 1ZVMA 3LVFO 4IUCS 3N1UA 3QBEA 4YLEA 2DGDA 3QG5A 4DBZA 4CRWB 2RSEB 2ADOA 3PT5A 3RWOA 5CEJA 2BEUB 2FTKE 3PPIA 2WU4A 1TMGE 3FY4A 4JOQA 4UXHA 4HVAA 5CLGA 2Q7OE 3USCS 3EVNA 1SN7A 2C9YA 2VHEA 3BRCA 5CH5A 1QGYA 5SV2A 2R44A 3TTXA 3KTDA 4OLFA 1VCNA 1GZDA 3MD0A 1EP1B 2JJ2D 4G85A 5L6MB 2Z2KA 4JJ4A 4KIGA 4NMLA 3AFIA 5IY5C 3BMCA 3GGPA 4FI3C 1NC1A 1N9GB 3F90A 4K9SA 4D4JA 1XVIA 1IPHA 1WJGA 2HXGA 2LUOA 1RMYA 2HN9A 3C3AA 4EI7A 2Q29A 3ZHUA 1FYDA 1OX6A 4AJOA 4P84A 3DDCA 5T3UA 3RYCA 2JIQA 3WGUA 2NZYA 3BSSA 3B0UX 2QSYA 2FJPA 3OLYA 3VR4D 2WHRA 1NVDA 3TL6A 4JQYA 1Q11A 3K96A 1W4BA 2HU7A 3ORSA 3FMGA 2P2YA 3TO5A 3K5HA 2FW7A 2NZVG 1P7VA 2Y1DA 4S1OA 4CKCA 2ZXRA 1KMQA 2VUHB 4A03A 5I7RA 4MW8A 3TFOA 3GJ4A 2IVFA 2GVNA 5BW5A 4C0AC 1VG0B 2PXAA 3DOOA 4HDKA 4P92A 1IEQA 1P17A 4CFZA 3DDHA 1ZW1A 4NCAA 2XT0A 2H1RA 2ZVJA 4A5OA 4CM1A 3A6KA 1P77A 3TOCA 2AB0A 5E2AA 1VHDA 1U1EA 3VFDA 2EWVA 1XCBA 1C03A 1JKXA 2Q9AA 3PLRA 4WXYB 1NTOA 3RCBA 3UW3A 5J9FA 5EHZA 4DCUA 2CV0A 4PWZA 1XZJA 4W1SA 3W3AH 1IXKA 3HCRA 3IT3A 5LNK1 2UYHA 1TPYA 2VQSA 3ITKA 1Y1KE 2ZYIA 2O7QA 2IXAA 2VXYA 4NOMA 4CLRA 1MOQA 1ZHYA 4U5EE 1Z2AA 2R25B 1HO3A 3G8YA 3ISJA 3K9WA 1L4GA 2F64A 2VC9A 4UPDA 1DCTA 3UGJA 3BEHA 3RC3A 3G5AA 4BZXA 3U3FA 4E4TA 3NDIA 4GZ5A 1EVZA 1U8AA 5F7XA 2MSKA 5J43A 4ZCRA 4D79A 1DV1A 3BTVA 3PB3A 4URVR 1JFFB 2IK8A 2WD7A 3N7TA 3QK7A 3WGZA 1T0BA 3DE6X 1WEKA 2YV3A 1GQFA 3I9FA 4XQCA 2JFXA 5SYAA 3UB3A 4URWR 4BX0A 2HPVA 5GJWC 5C5DA 3I3OA 3IVMA 5KSZA 5L6LB 4RPGA 3PX7A 4JCHA 3EVEA 3RGGA 3MIZA 4ZXPA 4EWCA 1UCFA 2BKXA 2DT8A 2FW9A 2FSSA 5KQGA 5EKUA 3TL3A 3K71B 3EGOA 2ZIAA 3JD2A 1GPLA 4I4TF 2IZZA 1S9HA 2QE6A 3W8IA 3X1OA 1UWLA 3LECA 2CLHB 3IEXA 1J90A 1EWVA 3LS2A 1O03A 4P5DA 2AP3A 1CJUC 1YQGA 2REOA 3RARA 4OD4A 3VVBA 3GUUA 3PGMA 3DT6A 3KPYA 2R96A 3RODA 1S1CA 4WCFC 5J40A 1W0JA 2WV7A 3DXXA 5ERGB 1RPTA 1SB9A 1J33A 2CXNA 1K7YA 3FLBA 2BEVB 4MVJE 4OHFA 3TLXA 2O59A 3RVZA 1KZYC 1IC6A 1CIPA 3ASNC 1AMNA 4FCTA 4QECA 3N0TA 1UPCA 1B8OA 4XPYA 1MHPA 4ARAA 3FFWA 4Z3KA 2BHLA 1P0CA 1X94A 3H2YA 3ZDQA 4E0BA 2G04A 4LDKA 3I32A 4RK5A 3HXTA 4V0NA 1LKZA 1PFQA 1TFOB 1F8GA 1RAAA 4K9QA 3RS7A 4ENSA 5LDDC 2QQFA 1ZX1A 3BK7A 5ALWA 3ZIUA 2HJ3A 1L5WA 3ZWAA 2QKYA 5JAUA 5AJTA 2ZBPA 2HA7A 3RBXA 1W4ZA 1YSCA 4PLHA 1JHDA 4M0UA 1TCUA 1F6DA 4ESHA 7REQA 2J7PA 4O59O 3WRYC 4E5NA 4L8YA 5LP6C 4KX3A 5G4KB 1N2CB 4YEDA 2AJTA 1Y82A 1AO0A 1DCFA 2PMBA 5AI4A 3GRVA 3HJAA 1C7RA 2PYZA 2C8KA 3HYRA 1EDBA 4N7BA 5JJCA 2X5JO 4AY5A 4YRMA 2EX0A 2VHWA 1JMVA 5F73A 3BL8A 3TZCA 2I99A 4JVNA 4JI2B 1Y9JA 3UEOA 2AYYA 4RD9A 4DVGA 5EIHA 1AUEA 1JVSA 1P0PA 1UBGA 3EXG1 4A1FA 2V3CC 3KYCA 1XALA 1ZLXA 3D43A 3L0OA 4EBKA 3S2YA 3S2GA 3TLGA 4U5CE 1O08A 2FQ1A 4HS4A 3UHJA 2R9RB 1YJQA 5COGA 4KQKA 3NCHA 5BUOA 2EPLX 2FPIB 3WKCA 2Q7RA 3H9BA 1TCVA 3KR1A 1KJWA 4DOMA 1E59A 2XYHA 5ER6A 3BB3A 2OCGA 2AL7A 2X9VA 4MMZB 3UT5A 2WP8J 3P1JA 3T41A 2Q0SA 2Q1TA 1OYOA 2TECE 4BATA 5IJ0B 2XBUA 2Y0EA 2QX9A 2EZTA 3H75A 1MV5A 2UVPB 4RVFA 1TM5E 1QZXA 3U3BA 3SLKA 1GAJA 1Y1SA 3DEZA 2AW5A 4K6HA 4ITUA 4N8EA 1AQLA 5CNMA 4D1YA 4KXNA 2NN3C 4EY6A 1RD4A 3MLEA 4HK4A 5DHUA 3WL7A 2BHRA 2W37A 4C03A 4MQLA 1KI9A 3C8DA 4ZHQA 5D6OA 2B8NA 3D2AA 4LY0A 3MS2A 4XD2A 5DEIA 1NU6A 1VA5A 5EZYF 5COMA 2FZWA 5TJ9A 2J85A 2IPMA 2HPZA 4AMYA 2ZYVX 3VYSB 1YHYA 4BMPB 2P30A 4OQEA 3ZU4A 1RRCA 3Q8WA 4UULA 5K8LA 2D5CA 3A6PC 5EEHA 3HDGA 3DE1X 4G5YA 2BFPA 4MEBA 5AJVB 3GT7A 3RVSA 2R48A 5GZ3A 4DWWA 4N01A 1ZCFA 4CLOA 1GQRA 2WY2D 1FXUA 1TLTA 2PQ6A 1N2HA 4I4LA 1ZD4A 2I33A 1I2DA 2XYQA 3D3WB 4HBGA 2WD8A 3E82A 3IR6A 4NYJQ 3W7AA 4B6EA 4I8XA 3ZGNA 4CL3A 3DLBA 4HQRA 1SUCA 4LOLA 5HKAA 3AF6A 1D1AA 1RKCA 1UK9A 3DD5A 4YRGA 4NCKA 5F2EA 1ZMRA 3QRWA 3H5WA 4JQOA 2FF5A 5G0TA 4OI0A 1TF2A 3HYLA 2ZWAA 4B3XA 2NVOA 2YXNA 4RSGA 3WYCA 1DFHA 5BSVA 1PKEA 3KT8A 3KAPA 3ZJTA 3TLYA 2IP2A 4B6SA 4MS2A 3C45A 2KS6A 2QJTA 2QJOA 5T8KC 4AJNA 5CDUA 3DEJA 5E4JA 1OH6A 2OO3A 1UWVA 5HQ3B 3V7WA 4B82A 5A2GA 4PIVA 3F3KA 3EIXA 4B2YA 1JGTA 5BV7A 4M2LA 3IE0A 1KSHA 4UU1A 4KN9S 1W5BA 1ZK4A 3DBRB 4ZTUB 2KBEA 3L1HA 3A14A 4F9GA 3FH0A 4CMJA 1PNTA 3M4XA 1U04A 4RXTA 3AUYA 3O03A 3A9UA 5GV7A 3SPXA 2R7QA 1P2UA 1IUKA 2GRUA 1IOVA 2DHCA 1ZH0A 4K9RA 4PSVA 5CDFA 4TTRA 1X7GA 1K98A 3KUXA 4FYWA 2DH5A 1E3QA 2PM8A 3MB5A 4R3WA 2LCQA 1M8PA 4OK3A 4D9FA 5B4UA 1GSHA 3TOSA 3C8MA 3K5PA 4RIGA 3MSXA 4Y1FA 1JAFA 4F6RA 4ML3A 4HVCA 1JEYA 1B0PA 3E4CA 3ZE6A 2CJPA 2G4CA 3HHPA 4YMUA 4CT5A 1EDZA 2VQ3A 2IPOA 3AJRA 3PQ5A 4XWAA 1EA8A 1ISIA 1NUHA 1VIYA 1YFJA 1O6CA 3HBMA 4Z7QB 2ZAYA 3OEOA 1Y6QA 2ZBVA 5H02A 2PUTA 3IKVA 2IXEA 4ZEOA 3ECCA 3GT0A 5AH0A 2OCPA 5JLAA 2XITA 3TLEA 1ND5A 2R47A 4YMSA 2QTBA 3AEKA 2XVYA 3L0YA 4XM1A 1GG2A 1R64A 2A30A 3I45A 4L4YA 4NEHB 3HO6A 4ZQEA 2GBLA 4H1HA 2XECA 3IPAA 4JMPA 3ZHRA 1ORSC 2GN6A 3HPRA 1RKEA 2Z2XA 2QUAA 3ZDEA 4XEHA 3GN1A 1OA1A 3TAXA 3U40A 2QM8A 5AC4A 2GTPA 3G2HA 5SYMA 4OQPA 4Y30A 2EQBA 2OGUA 3KCQA 5L40A 3J80A 3ED1A 4Z9YA 5DV9A 5K9ZA 1JH8A 1U28C 3OUTA 5ICFA 5LJIA 5AVRA 3B70A 3HY4A 2IY9A 3AVTA 1W1UA 3KEMA 4LYHA 3ES9A 5FBRB 3ECAA 3P9RA 3EDCA 3QKRA 2YL3A 5IBQA 4MCHA 4Q1BA 3I05A 4AZ0A 4DDMA 2PBRA 4BASA 1AJEA 4PIMA 2IHKA 1WZIA 4KOAA 5IZCC 2EJWA 1TTTA 1FP2A 1E3LA 4JUCA 1CUFA 4WD3A 2IWHA 1JDBC 1G8YA 4FHCA 1DBVO 1OXVA 3WXMA 4JJZA 4WLEA 1OLXA 4D0GA 4J75A 1RR6A 5HZMA 4HBZA 3UMFA 2OESA 3VSDA 1AKRA 3OKPA 3R3YA 7GPBA 4WK6A 1QLHA 2JPUA 2TMVP 5ANRB 3D0OA 3U7EB 5E9WA 3SYLA 5BXYA 3LNCA 4PVDA 5LBTA 4Z4QA 5FUXA 1KHHA 1MJGM 3GFGA 5EUQB 1HM5A 2ZSFA 2O23A 1IBRA 3HEBA 3WODF 3ZCRA 5MN6A 1H5UA 4R69A 3CZ6A 3I5QA 3MUOA 2DEUA 2HK6A 2ZPAA 2QRZA 4JGBA 4LGVA 4UUMA 3PNKA 3D31A 1E2PA 3AIOA 2QD2A 3ZV7A 2HCTA 2D06A 3S1AA 4UTPA 1L7BA 2QM0A 4DL9A 3RRMA 5LQRA 2F17A 3FOFC 3OOSA 2Q3LA 1E6LA 2FLKA 3MBIA 1HE9A 1CUAA 4LWOA 5GGXA 4WZAE 2BL4A 3TQTA 2AZDA 2F1HA 4GPTA 3GRPA 2FGJA 4JJFA 4MWBA 4ZVKA 2BYTA 1P1RA 4RHCA 4Y2YA 3VGPA 1AMUA 1AZWA 4DA8A 4E18A 1D2AA 4R8VA 4RS4A 2BZ0A 3L9WA 4RTRA 3QMKA 3T5BA 4J0QA 2R8PA 1ZAYA 4HNQA 3GF4A 1BX1A 1KGSA 3KYIA 3OEYA 1H22A 2P11A 4E5MA 3G2QA 4OI4A 5C4MA 2G7MC 1VSBA 3Q7QA 3RC2A 3KHUA 2FCAA 3FZEA 3IIEA 1H2FA 1S2GA 1ULHA 1NI4B 3I5MA 3LBNA 3P7MA 3RHTA 4IYRA 2BH2A 5IAGA 1PAUA 2I7XA 4L85A 4YVFA 3WLPA 1WVIA 3NHBA 3NIWA 4Y2GA 2H7XA 4B4UA 3UMCA 3OOYA 1PZXA 2Z9DA 4IG4A 3G8CA 4WGGA 8LDHA 3ZHCA 1QQBA 3UR3C 4AYXA 3B52X 3G8BA 4HDKB 1FXSA 3V7FA 3CAXA 2W4BA 1X1AA 2VHXA 3I39X 4M7WA 4R51A 1P0QA 4YMHA 3K0FA 4EGJA 4XJVA 3CCCA 1R74A 4RDAA 1U8CB 1ZJYA 4R3UC 3W5CA 3C41J 5DMXA 4F12A 1LDNA 2E55A 1Y5LA 2J3QA 4MVZA 5HMMA 3E8MA 2VAPA 2R1UA 4TYPA 4FFWA 3ZVRA 2QPAA 2V5VA 1IQPA 1NV8A 3QWIA 1OVGA 4QUIA 4OA8A 1XI2A 1Z4QA 3VMMA 4D6XA 2BHSA 1KTIA 2VZLA 1K40A 1LS4A 1LQ2A 4RPIA 1SKAA 5HM6A 1P3Y1 3K6SB 5IRCD 3JRMO 3JYNA 2FYTA 2OCKA 4TSKA 4ZODA 3ESQA 5AQEA 4BJ6C 1NXQA 3W5HA 1XN1A 4UTVA 1I01A 1IQRA 2OBFA 2CZQA 2XWPA 4TXHA 3DF7A 1ZGZA 5JS8A 4WLUA 4I3MA 2PBZA 3F7TA 1P5ZB 4CNBA 3H0CA 1T8UA 2J9FB 2ZE8A 2BFOA 3EMVA 4LE2A 4WKPA 4E70A 5AVSA 1ABBA 3BWEA 4RTOA 5GQSA 1O58A 4R0MA 5B1BC 2J4FA 3ZTWA 4MUAA 3N2ZB 1TJPB 3BMNB 4JHLA 4DAOA 2P9FA 4NSNA 3ZGLA 4I4TB 1C3XA 5LB2A 1L6IA 3R44A 1K8ZB 4UHEA 5DLYA 8AT1A 2HEGA 1EB9A 1Z6YA 1BS9A 4HYQA 5CX1B 2GSDA 5ELLA 4H7FA 3RUPA 3GLHA 1QGOA 3R41A 4R16A 5FOVA 5HFNA 2VTBA 1B3BA 3AVUA 1FTQA 1DC3A 1KY4A 2Q2OA 3GY0A 5DQZA 5DLJA 5K3FA 3UJCA 5B36A 2JGLA 1JSRA 5AHXA 1P4GA 5IN5A 3MT9A 3ZZ0A 4YDQA 1JYSA 1M33A 4B6GA 2OQIA 1EVEA 1Z23A 2QDKA 3IDQA 3NWPA 3PCVA 1KI6B 1PG2A 1JXOA 2YFKA 1FW8A 1MD9A 4TS3A 2ZTSA 5AHOA 4L28A 2VLBA 4MA4A 4OAPA 4TYYA 1DJLA 4KAXA 4L4XA 3DHEA 5EWMA 2G08A 1NIPA 1GFSA 3AIMA 3HEMA 2E82A 1HMPA 2EXXA 2FZKA 3L8ZA 3LW7A 5EKDA 1T6NA 4M0CA 3TIFA 1N2XA 2F90A 2OXTA 3E6AA 1G55A 1WWKA 1N2CA 1Y3IA 4IFIA 4LYDA 5AOAA 1N1DA 3QBTA 3DWEX 3L6BA 3H18A 1IWOA 4JE9A 3JQ7A 2IGTA 3KQOA 1UIRA 3LNTA 3MUNA 2HUPA 2VQ6A 2ZS9A 2P67A 3DR3A 3LBIA 3CH7A 1IULA 2F1OA 2FOLA 5KHAA 2ZTHA 4MS4A 1E9FA 2JZNA 4OHCA 1ZBQA 2V1UA 4Y8VA 1W0CA 2UUOA 1BQ3A 5EL0A 3VYVA 4BNFA 2VT6A 3FOZA 3A6LA 1N6KA 4L8GA 2PL9A 4L5BA 2QSZA 1JE0A 3IMFA 3AG2C 3TQSA 4M89A 3I9KA 2EAUA 5DNAA 5TNXA 3SHWA 2WILA 4KJZA 1T6UA 4HAZA 5K3AA 3T5AA 1YJAA 2WJGA 3CH5A 3NKFA 5TIIA 4M9RA 4BKRA 1FZTA 3H2ZA 4NMMA 3T5TA 2ZYAA 3ORHA 3T54A 3GO4A 4P4SA 1G6HA 3NHZA 2H1VA 4KACA 2UVPA 3DPIA 4NE9A 1CRWG 1QGUA 3QVLA 1PFUA 4QAQA 1EFAA 4MR8B 4PO1A 1W85A 4KR7A 1JIJA 2GGSA 3VPBA 3ZHSA 5IC4A 3U19A 1SOUA 2C4MA 3O5AA 1XLTA 4DCMA 1QPBA 4HDSA 1SKQA 3G8AA 3IUJA 2NSDA 4PO3X 1HNNA 4RA6B 2OV2A 3Q5DA 1CLUA 2CLOB 3HHEA 1V96A 3II6X 3GAFA 5H81A 1KPIA 1LNQA 1SBHA 1OH5A 1XQYA 3LY7A 2F8LA 2P4EA 4PLFA 4J49A 4Z86A 5E6UB 2PANA 4HJXA 1J0DA 3ER9A 3JQFC 1X9HA 3MCAA 1N8NA 4EZBA 5I45A 1Q7EA 4G9GA 3FOAA 3KAQA 4WCVA 1QRUA 2OHVA 2RHDA 3LT4A 1DBIA 2IH2A 4A16A 1X9IA 1O3UA 3DMRA 4I1OA 5DIFA 5AXAA 1BGVA 2RBKA 5TGZA 2FR1A 1QSGA 2KM1A 3PQFA 4L6CA 4TS9A 5KTYA 1I0IA 4H54A 4C78A 2A9PA 3DXFA 1Z45A 1OU0A 3UA4A 1J23A 1UP6A 1XCOA 2CVQA 1DJQA 4DE5A 3B0VC 1U7ZA 3KPVA 4GECA 4HDRA 4D9CA 4YUWA 4I9GA 4YH1A 2Q1SA 4KITB 5EP3A 1WB9A 1EFPA 1Z0IA 3JQQA 3EA4A 4PAMA 2X2FA 1FVFA 3TEMA 4Y6OA 5IH7A 1ZNQO 1KI3A 3QLVA 4JEHA 4GMXA 3E7DA 4ZI5A 1NVWQ 1WBJB 3M2TA 3JQPA 5TS2A 1RPNA 5AVJA 3DMYA 4L0DA 4KXYA 1FDIA 1F5SA 3UMIA 4KAJA 1JALA 2HV8A 5CHYA 5C31A 2GA0A 3TLZA 3VPHA 1WKBA 1G7CA 1J8YF 2ZK7A 1J0EA 4R9RA 2P2ZA 1KC1A 3P0RA 3ROEA 1VKNA 1XZDA 4U5HA 2WHXA 3OQVA 3QU9A 1BMQA 1VJ0A 1PL7A 4KPUB 4QEDA 3DZDA 3K30A 2NIPA 5JS5A 4A36A 1NRJB 2DYRC 2F3QA 1MNQA 2WQ7A 1S4MA 4X97A 2VA9A 1R8JA 3WQBA 4Q7CA 2KYRA 4Q4JB 3DVQX 5JFTA 1OWPA 4KPFC 4RHUA 1RC0A 2G40A 3I30X 2PEYA 2MMGA 4GC9A 1QAQA 4P98A 2A14A 1SVMA 1HETA 4GU5A 5A9SA 2A2ZA 1BWQA 3ROMA 4D41A 1KZ9A 1M10A 5I4IA 1Q91A 3A1VA 2WWFA 1YZNA 4FNMA 4M0KA 4BEMJ 1OFUA 1EQ2A 2OLKA 3O6VA 5EAIA 1ES9A 3PKJA 3R09A 3UOAB 2ZBQA 1UQUA 1E1QD 2OBYA 1IFXA 2ZIVB 3KDPA 2CXQA 4FCVA 3RVLA 2Q5OA 1T10A 4YAWA 2IJGX 1VL0A 5U4XA 1K97A 3AUFA 3JASA 2IYNA 3NC1C 3ETHA 4N12A 2W6QA 3I42A 3QA3E 3ZHTA 4F1JA 2F22A 4HTFA 4QD3A 4U4AA 2AJ8A 2BZSA 4PLYA 4S3MA 5A4MS 5IF9A 4EUKA 3KSDO 2YXEA 3OM0A 3M70A 4FDLA 4K2HA 1PR1A 1NVAA 4N6GA 3BH0A 2IHNA 2V6IA 4MKXA 1AQNA 2WZLA 2QD3A 2EZUA 3W6OA 3I9NA 2BUCA 4TKMA 1EH5A 2QNLA 2W2LD 1GARA 3OE1A 2IEDA 5T3YA 1YDIA 5K3DA 1IM5A 2IHUA 2YFQA 3CBGA 3QKRB 2PY6A 4N7JA 1ZZGA 4KBGA 3EW7A 2C7QA 4AECA 2VBFA 4CPDA 4PCLA 4PYJA 5LKAA 2O7RA 1YRWA 4EAQA 1W36B 2NZ2A 3ABRB 1W36D 4IDAA 3P9XA 5AP9A 5IJ0A 1S6YA 3FNEA 4ZO6A 1TZBA 3RW0A 2HZBA 4QGGA 4N0QA 1RWBA 5BW4A 3ID6C 2HEIA 3GQBB 4DXDA 5DF1A 3F6PA 1WXIA 1GRNA 4GHWA 2I6SA 5F2NA 5CA1F 5F3DA 3IOCA 1D1QA 1K7SN 3GROA 4NU0A 1Z07A 2GHIA 5JQWA 1UMBB 4YJKA 4PHFA 2WNSA 3E5NA 2E18A 2R7LA 3CKYA 1NYQA 3W06A 2C9ZA 2FX3A 3MTGA 3ZH9B 3Q4GA 1CFJA 4F86A 5JASA 1DQPA 4ZPJA 5FFNA 3PXUA 2P6OA 1OWNA 2IYEA 4M9UA 2PL1A 3VX4A 5L0DA 2JKZA 3D7LA 5C51B 4G0UA 2O9JA 3ZV6A 2OSBA 1BS1A 3JZ0A 4RO0A 4NKRA 2BEWB 2XXAB 3JZDA 1RXIA 3ZVLA 3NRCA 1HI9A 3SZRA 2XXBA 1FSZA 1M83A 1GKKA 2QAJA 3EIQA 4LXHA 3NHLA 1PJ4A 3UWKA 4EW3A 5CFZA 1U3CA 2QG6A 5HJ7A 3RNLA 1RLJA 2Y3HA 1WRBA 4HGRA 4BFTA 5IKXA 3BXZA 1N6PA 1VL1A 4DV4B 2XEDA 1O54A 2AUNA 3STHA 4FWVA 2GBIA 3F8TA 4O2RA 3OT1B 1PSZA 5EIOA 3U6KA 1RYZA 1C8BA 3M7IA 1I24A 3TOXA 4YYZA 4QREA 1CZKA 4QI2A 4C01A 2WMYA 4Z4HA 3OTHA 1Y6GA 1BDMA 2CLIB 2HPHA 2BFAA 4NK4A 5CXSA 2I6QA 1EJ6A 2GA9A 2XNHA 3LXRA 5FPYA 4AS1A 1FQWA 1W87A 3LQ2A 5LOVA 2A0WA 4PO9A 7ABPA 1R18A 4BMOB 1XZHA 3MMSA 1GR0A 5JZBA 2O8FA 4BNKA 2JBHA 3H7AA 3PGVA 2G5GX 1E6UA 1F3LA 1IAVA 1NSTA 2VR1A 2VP2A 4QPJC 1EEHA 4TLEA 4FN4A 3DM5A 2POQX 2QRPA 3GJYA 3T8YA 4FLEA 2OB1A 4D42A 3H5IA 4OMFG 5ECGC 3ZZMA 4L57A 1YQEA 2AK2A 2CDBA 2JGIA 4M46A 4AD8A 1V8DA 3D7SA 2X51A 3DQPA 4WXEA 4UNRA 1EFCA 3KQHA 5B3AA 5DXAA 3ZU6A 5G2OA 2QY9A 4QNMA 3ESRA 2JCSA 2IEAA 1Z75A 3E70C 1KO7A 1PJTA 2B25A 1HYEA 1QLJA 4JLJA 4GI2A 1VPTA 4I55B 2LKCA 2VF5X 2C29D 2G82A 2XODA 3DQQA 1RJ9A 5BQXA 4KV7A 1SU6A 3TBFA 5H4GA 1H1TA 1DQRA 1OE0A 1JX6A 3VO1A 5KNBA 4KMMA 1U2GC 2H7BA 5KOIA 2PBLA 2XQKA 1R0XA 1F3OA 3M4ZA 4U5GA 1O4WA 3DWGA 5AM2A 4ACBA 4DV1B 3ZE0B 4D4XA 4BO3A 1RNLA 2C77A 3IDFA 2Q2QA 2WAXA 3HKEB 3O9ZA 2VTEA 3IEIA 2OORA 2B61A 2WQZA 3F97A 3LRXA 3R8XA 2PRKA 4AT1A 3ZCVA 1IBSA 2WB4A 3N3BC 5HKKA 3L8JA 2YRWA 2XM0A 1RMTA 3FZQA 1THMA 4PC6A 1KDVA 2QMUA 4RZHA 2A4KA 3TR0A 2CV2A 4OX9B 2PX4A 3ITEA 1BIFA 5JCJA 1KQFA 3F9CA 5IVKA 4M9SA 4XGNA 2CKMA 3HM2A 1PTJC 4KRGA 3STVA 2QJFA 3RS8A 4WVLA 5JEEA 2JCBA 4ZCSA 1VJ5A 4Z0TA 1USVA 1E2XA 1LLUA 3GFQA 2BELA 4GM0A 2XNDD 2V97A 5TV2A 1P1IA 3PLNA 4LGMA 5J23A 3QVYA 1RPJA 1KJ8A 1QNLA 4QOSA 5FOWA 3STTA 1UEIA 2P8SA 3WRVA 4B5KA 2WWTA 3DA8A 3DLHA 1E63A 3K09A 1KNQA 1UBMS 4N47A 4FAPB 1CP2A 3FNFA 4P9NA 1FB5A 2PNFA 5CP8A 3LTEA 4DMKA 2QSJA 2PA0A 2R2GA 2Z3ZA 2QUKA 1J25A 3CUKA 2NU8A 5MFPA 1DOWA 2QPTA 4RY0A 3RF3A 1CRQA 4W6ZA 2IDJA 5LU8A 1AO3A 4BNNA 4ZTBA 3MBOA 4MGHA 4LA4A 3TD7A 2HSZA 4X6UA 3CLKA 4RFSA 1PE0A 2OK8A 1HQCA 2VHYA 3CRZA 3W5UA 5BRJA 3A36A 4LF7B 2G3VA 5EMNA 4RELA 3TTYA 4P4TA 5EMLA 1N57A 4Q34A 5BXQC 3HO1A 2WJ3A 2ONZA 2ACWA 3M4NA 3TQOA 2AEFA 2ZJFA 4LSZA 3UZUA 1LBHA 3KK0A 4A3SA 2A6HF 3GUZA 4OJNA 5SICE 3KWMA 2QV7A 1SBQA 4OAQA 4OMUA 2IEZA 1MO5A 1XEFA 2HMYB 3FCCA 1XJWA 1M34B 1RM5A 3K72B 4AKEA 1J97A 1V6CA 4GYJA 3RRYA 1Q0RA 4ID9A 1IK4A 4NU5A 4ETWA 1G8XA 4NICA 2IE0A 2XMQA 2YWCA 3A3NA 4GR4A 4AWAA 3QZCA 2R6ZA 1J7KA 3K31A 5FUWA 3PQ7A 1T9GR 2GETA 4IFTA 1LPNA 2WRZA 3JALA 3KRTA 4GWKA 5EUCA 5BSGA 3CS3A 4KGZA 2ZUEA 2PMCA 4H0NA 2K6GA 1NNUA 3S68A 1AUOA 2AKAB 1H1LA 3KE9A 2CLDX 3I4UA 4JEAA 4OYRA 4ABTA 3EIEA 1LVKA 2PZAA 1S7GA 2C5BA 3OJCA 2FE4A 3RBAA 2QX7A 3REGA 4PK4A 2XF8A 4G0OA 5CBPA 3H2JA 1JDNA 2ZJ3A 2I5PO 2X23A 2ES4A 1RCPA 2I7DA 1BE8A 3L0CA 3ZGYA 5IF3A 4WOJA 1G4WR 1BTOA 4JT2A 3ZD6A 4BJ6A 4IEIA 4UHKA 5F1KA 2IYFA 3A06A 5DH9A 4Z2AA 5CTJA 3A9WA 1SBIA 2X2OA 2D13A 3MCWA 5IT4A 3E9MA 3OFNA 5FUQA 1E98A 1UBOS 2CEKA 4MLPA 5TRTA 3CQZA 3TS1A 2HKIA 4HDSB 4KXFB 4QOJA 1ZSNA 4CHTA 2R7RA 4KW7A 4QDTA 1RSZA 3IQHX 5I9BA 4YPOA 2YNMA 1WUTA 1GNTA 6LDHA 3H8SA 2PGDA 3FYTA 4IJVA 3SQDA 5GPBA 3MD9A 1Q15A 1I6MA 3V42A 3NKDA 2R25A 1HRKA 2DKOA 3ZCUA 2WNHA 4WJLA 2C7OA 1PYOA 2HLNA 2NXNA 4X95A 2FVYA 2VBCA 4ZAZA 5CIWA 4ADSG 2XB8A 3E3OA 2IPNA 1DJOA 2ZYGA 3HABA 4AL0A 4Q0MA 2NXWA 2G3KA 5CG1A 4RYLA 3VPFA 3RC9A 5IG2A 4KH1A 1T36A 1Q3HA 1UL1X 4I1IA 4X61A 4MKIA 2VSYA 4AKSA 1H0HA 1MLDA 2DWCA 2H2HA 3CX6A 2LZ0A 3CZMA 4CLXA 2VPYA 2QDXA 4LJYA 4Y1GA 5K0JA 1K5HA 5CM9C 4TMZA 3EG9A 4HVLA 3HU5A 2Y99A 1YRBA 1PX0A 3K9NA 3QVTA 4A7PA 3OU7A 2AZTA 4XQ9A 1YOVB 3O8RA 1AGNA 2HMSA 1P33A 4IOLA 5LFAA 4X0RA 1O2DA 1OLSB 1RI3A 2D62A 2W6ZA 3A25A 4OQDA 1Z7EA 5TB5A 1UAAA 3QMPA 2O20A 4LRSB 3AVVA 3FCOA 5ICSA 3U7JA 4N8SA 3LDHA 4LZZA 4MQUA 2P0NA 4UBKA 2X40A 2FP4A 1LVUA 2HM7A 2YYAA 3RAGA 3BSFA 4L5IA 1U0NA 4RF3A 1FRNA 3AUJB 1LF5A 3ESZA 1DL5A 3B12A 1HT0A 1DTWB 1OAKA 5THKA 3TB4A 2DPLA 1Q1QA 3WIEA 2A57A 2NP7A 5DK4A 1KZ6A 5AT1A 3T7IA 4CM6A 1UT6A 4EECA 1K7EB 1MIOB 1YMUA 3UCEA 3CLRC 5F78A 1A5ZA 4KHPB 3DE4X 3F7OA 4RZXA 3CISA 5DGCA 3NV7A 3NVDA 3IFSA 2Y71A 4CM4A 5A4JA 5FBWB 2Q1XA 4B46A 4JC7A 1E7MA 3IOYA 4GI3A 4FMDF 4WN9A 3GUCA 4NTAA 1AA6A 1WXHA 1I6LA 4LF8B 3KM0A 1Z7GA 3RQSA 4MVOA 4OKSA 4CJOA 3KG2A 3ELDA 3GFSA 4CG2A 1QIDA 2HSGA 3QVKA 4ERNA 3NWOA 4O6MA 2WWIA 3HO8A 1A98A 4J16A 4MVJM 4JOBA 4OUKX 5TVGA 3UNXA 3ZDLA 1BKDR 3R5HA 1X7YA 4PC3A 1JSCA 3HWSA 5EZ5A 1QBKC 4GSLA 3IJRA 4XWWA 1NBWB 1YVEI 3K15A 3NTRA 4OQFA 1G9SA 4NI5A 4MV9A 3LFHA 4HXFB 3TBHA 1GIAA 3B53X 1FRVA 3AIIA 3JW8A 1R15A 4GX2A 2P3LA 1AIPA 1ZYUA 2BP7A 1SCIA 2R68A 3JATB 3IH5A 2ZAGA 5TC4A 5MHTA 4I5FA 5BVGB 2GXAA 3AG5A 1YACA 4MWTA 3C6MA 5IM5A 1UBCA 2AZXA 2GN9A 1CIJA 3OKAA 4GMHA 4CIXA 4RSHA 5AESA 4G97A 3PNVA 2KJQA 4OQ4A 4ZGWA 4YDSA 1WG8A 4X3OA 1KDRA 3WNCA 4PVCA 4WDRA 1VBMA 3N2IA 5CHEA 2IBFA 1D3AA 2P1ZA 3H04A 2CF5A 3OIDA 5HKKD 4OG2A 3I2IA 1N3BA 256BA 3H6KA 4I4IA 3BREA 2FZCA 1DFIA 4WLVA 1YHNA 3WKBA 1TJNA 1FQKA 2FZ5A 3QEMB 4TV8A 2H2DA 4D43A 3GLHE 1X0VA 1VLLA 4GF5A 4WAUA 1NYLA 4NECA 4Z1MD 3GLIB 5KNCD 4TYMA 2E4UA 1UFBA 3CVUA 1AQIA 2OHOA 3AX6A 3ZLVA 5BT8A 3K70B 3HYTA 1QVZA 2VHVA 1QVRA 4BEBA 1M76A 2VNKA 1KVTA 5A5GA 2J8WA 1REQA 2REBA 3C1TA 3D6UA 4RZUA 1BEEA 3VV3A 3DMNA 4HSGA 4Y9UA 1T4CB 3K4PA 3GAMA 3COJA 5FI3A 4BJHB 2HIHA 3CBQA 3DPUA 1FFDA 1E5TA 1VE7A 1I3LA 1K5PA 2Q49A 1J0CA 2VJCA 2DT5A 1P2FA 5IMBA 3BH6A 1SUDA 1QGZA 2WVGA 1W88A 1I10A 2WSMA 3KPUA 3ODGA 4EPWA 1TFKB 2MU1A 3QVJA 2WVHA 2DHQA 2VPZA 3K6RA 2AZ4A 1O5TA 1FLNA 3VJMA 4U7PB 3TSCA 1YDWA 4CMHA 4MDEA 2PSSA 3U80A 2HB6A 1LBSA 3P0IA 1U2DA 4B7AA 4DLTA 3N70A 1RT9A 3WGVA 4IH4A 1HFWA 4Q47A 4Q9NA 5DFAA 1RQLA 2I2BA 3ETLA 3HKCA 1XZEA 3HDYA 4L0MA 1R5BA 3H5AA 4ZJZA 4NMWA 3OQ6A 4BKOA 3F2VA 4YMGA 4CKCB 1GTRA 1VJCA 2WM9B 4FWIB 3U39A 2QRKA 2X15A 3DTVB 2YIVX 3W5AA 1Z39A 2K7ZA 4ZOBA 5FO0A 2IS1A 5CA0F 3DLPX 3UJNA 1XAIA 2PX3A 5KNDA 5E3CA 4JCOA 3ZN2A 3DE7X 3FLMA 2PMEA 4ESEA 1AMOA 3UFBA 4B3GA 4LJKA 2CLLB 4MHOA 4MCAA 1L4EA 2J3HA 2WJHA 1JSXA 2RAFA 3OFJA 2B0HA 1OV6A 3I1FA 3MTEA 5FBZA 4W8KA 3ZVMA 1MTOA 2DYKA 1XDWA 2WOJA 2Y1XA 3KOXA 5J58A 3MHTA 4QXAA 4TMVA 5J4VA 3V6MA 1SXQA 4Y7CA 2WIAA 3HCFA 3MMZA 2F2TA 1Y48E 2WM8A 2ZIXB 2YIMA 1MT3A 3QFTA 4PC2A 3AQCA 3SLRA 2JJ2A 1TWAA 3L4EA 5F3RA 4BCDA 1J5XA 3IPXA 4QXOA 1GPYA 2LGJA 1HE3A 2AR9A 4Y2SA 3IT1A 4YXWA 5HZKA 4G84A 1AU9A 5CD1A 3QMMA 4KVZA 3FR8A 4ND2A 4CX9A 5LQNA 5SZJA 3RFTA 1TC2A 1BC5A 3IT0A 1EJ0A 4XJXA 3O8OA 3EEFA 4NBVA 4AZVA 4JW1A 3FLAA 1G8GA 1OA0A 2V3VA 1PYDA 3HCNA 1FFEA 1OFTA 1IZ8A 2GM5A 2VP5A 3LQFA 3MEQA 3EIHA 3H9QA 4IINA 2A1IA 4ZI7F 1W7AA 1F9EA 1DV2A 3QVGB 3FPGA 5EA2A 5GOTA 1KIFA 4W4TA 4OI2A 5E9QA 1SHJA 2I7CA 3AF0A 5F52A 1Y4AE 4EB0A 1IB0A 1I5RA 2O7NA 2XADA 3LE8A 1EX7A 3INTA 4U5DE 1ENPA 2PAFA 1K86A 3LG2A 3UMBA 1XZKA 2EJBA 2VSQA 1L5FA 3OJ0A 3X44A 4CM9D 1SUAA 2ILTA 3K0CC 4AO8A 2WF8A 5B2EA 4YGXB 1KSGA 1UEXC 2IYZA 1QG0A 1UC4B 2GK4A 4N3GA 3C8GA 1KNYA 3G79A 3H6GA 4UAGA 3I6BA 2FPXA 1GA1A 4LDRA 2AFIE 3CHYA 1CG6A 5ICGA 4LLEA 3TJ6A 4HRVA 5D3KA 4B84A 3GM1A 4ZT4A 4WOPA 8ADHA 1LQTA 1VJRA 2B78A 1B15A 1R4NB 3JSZA 1VIMA 1AQYA 2DI3A 1PEKE 2F3TA 2QT9A 2HNBA 2SKCA 2PT7A 2IDZA 3DS8A 4FC7A 4LECA 1NVKA 1QS0A 4GMKA 4OREX 1XIVA 2VDLB 4QDXA 4QTTB 5G4KA 5FUVA 1GGQA 2CZCA 3PI6A 2ODQA 1GG5A 3T3MB 3HV2A 5LLSA 4EI9A 1BFUA 4CG1A 2ICAA 1XELA 4KMRA 3FAPB 1BVRA 2IS2A 3E35A 1F1MA 2BTQB 4HQFA 1H2BA 2H1OA 4KN6A 1A04A 2EZ4A 5ES4B 1TK2A 4EUHA 3AR5A 4UUBA 5K0EA 2JD2A 4JR0A 1XV5A 1UK7A 2X8AA 1AUQA 2GLXA 2ZWVA 4IY1A 4C6TB 3SKXA 5BSEA 2D4AA 3WVNA 4NBKA 3AI3A 1Q0FA 5TDHA 2VYQA 1QDLB 1MEEA 4D9NA 1CK4A 4P08A 2XKJE 3O7WA 4H59A 5H83A 1Q92A 1OFHA 5KJ6A 1N7HA 1GKYA 3JRWA 4RETA 5F4BA 1TAUA 2A1UB 2VDKB 3T52A 1JQ3A 2RK3A 3MRVA 4WEQA 2E9SA 1KTMA 2Y1EA 2KK1A 3MYFA 4HJRA 4P5PA 4PSKA 2YS7A 5EJ6A 2R02A 3BA6A 3TZ6A 1IUPA 5CYPA 1X8KA 4J4BA 5SY4A 5LMCA 3LX5A 1XTTA 1WHTB 3CRMA 3UFXA 5G40A 1QRRA 1VQ1A 2H9AA 1P4JA 2VP3A 4IXWA 2CT8A 1RYFA 4B9AA 3NMKA 4BFLA 2JAHA 3ND9A 1NI4A 3CLHA 2GN0A 4UDOA 1YUNA 2D54A 1Z2EA 3HWRA 1U81A 2QMOA 2PF4E 2XWJI 4B81A 5KREA 3KKEA 2XWSA 4M49A 3SYRA 5JV5A 3DXYA 3GRUA 1DGQA 4N9QA 2FJ0A 4RD2A 2B92A 3GEMA 3ZWYA 1Z88A 4OIPF 3I1JA 1O7JA 4GPIB 5EXPA 3OLCX 1T3TA 1V7CA 3EXFB 3AUTA 1X7WA 1Z5NA 4G8CA 2EFEB 4IGFA 4KIJA 4KCGA 4QLBA 5LR6A 1UKZA 5TPWB 5AUPB 4NV1A 2JI9A 1X14A 3SFTA 1J39A 1N2BA 5K2OA 3S27A 2NZ8A 3LT5A 3ADDA 3LOPA 4H3VA 2WAOA 3Q15C 1XR3A 2XYRA 5BT9A 4NQZA 4I4CA 3I52A 3BXGA 3FMSA 1TYEB 4M8KA 1L3IA 1EXMA 2R8BA 3D6NB 1GVNB 3NS7A 2X58A 4Q05A 4LDNA 3PNQA 1M0EA 5A03A 5IVHA 4PJJA 2PUFA 3K2EA 4TZ0A 2PGJA 3IB6A 1MRZA 1Z0AA 5D2CA 3VSBA 3EDQA 1LFAA 3L7KA 4RTPA 2YJ5A 4XXHA 4CF4A 4PZCA 2R60A 1MB2A 5LB4A 1ZA1A 1V25A 1PJLA 1D2EA 4ZU6X 1KAOA 3SU8A 3VPAA 2XD9A 2CKDA 4QYTA 2NQ8A 4KO4S 1SCDA 4GL2A 3GIWA 3NTVA 3IBSA 2DLDA 3JYLA 1BXGB 3QKSB 5CT8A 4LXGA 3F8SA 4EKGA 1HNXB 4Z3OA 2X4GA 1HG0A 1QFMA 1R4TA 3I2HA 1XJCA 3IKLA 3LCRA 3LV8A 4L3WA 4N0EA 1HL7A 3HNIA 3T1OA 4F3NA 1GD1O 2OKGA 4J2OA 3GFFA 1DAGA 3OMXA 3REQB 2ZUFA 2WVOA 5E4YA 3N8IA 2BI4A 4RGYA 5L0FA 1G5RA 1Y9DA 5KBYA 3GLVA 4MV6A 3QXJA 2NTEA 3KSZO 2IYVA 1Y4UA 3N2YA 4BQQA 3ME5A 2QTRA 4TN5A 4PW0A 2ZULA 1N8SA 2DQ4A 5EZQA 1DFGA 2AOVA 1CS0B 4XYBA 4ALLA 2C3PA 4TLMB 2Q9BA 3L93A 3ET4A 3RQGA 2NGRA 3IA2A 3V48A 1NVEA 4OAOA 2W6JD 4PYOA 4J9VA 2J5XA 2PK3A 1DTWA 4GEGA 2W6OA 2BFEA 4NBWA 1ZS9A 5CW2A 1NPDA 3VNAA 4MUGA 5AVYA 4LWPA 3SFVA 3ZQUA 3LUBA 4LK3A 2Y8EA 1NQXA 3QPWA 1JDPA 1LX7A 1Y7HA 2OXCA 2VEDA 1V1RA 2Z5LA 2HOQA 2I76A 3I28A 3QZUA 1A9PA 4QU5A 3WWPA 1FRQA 4F8YA 2R8YA 1U8YA 3AJ8A 3PNSA 4YP0A 1D8TA 3Q6NA 2ZQZA 9LDBA 2IEGA 3G2LA 3ZD8A 1T5OA 1D1SA 2L42A 2PSHA 2VPIA 3Q8MA 2B36A 1A41A 3EEIA 4EKDA 2VASA 2N42A 4OBBA 2HFIA 3OCJA 2FPGB 4MO9A 1GA4A 4PRLA 4FCWA 1X0XA 1K1EA 3OP1A 4YCMA 3SR4A 5FA8A 4M21A 1CLEA 3QLTA 2NNWB 2OC9A 3UHAA 5CB4F 3DTNA 5BYAA 3Q11A 1UZNA 3PZBA 4YGYA 3T1QA 9LDTA 1G1MA 3T0IA 4NZMA 4R1LA 1DRWA 1TTQB 1ADGA 4E0IA 4Y2QA 5CLHA 2O6HA 1Z06A 4LHEA 4NZOA 1F8UA 5C9ZA 1FSGA 2Q6OA 4OA5A 4YUXA 4DPMA 3LDGA 5CB4B 4CBEA 2I15A 4LXXA 3MINB 4HNTA 3F73A 4D8WA 4B3RB 1BW9A 1EJ2A 3H17A 3O1HB 1L5LA 4WLOA 4DQXA 1F5NA 2V6MA 1JLLB 1W8DA 1XCLA 1MXFA 3L5KA 3QXHA 4XR9A 5EGNA 5BNWA 3AKYA 1Z4JA 2HMWA 3H86A 5I7EA 1BGXT 4BMZA 3LQQA 5A04A 4R2JA 4UHJA 1YZ3A 4HWPA 2WABA 2R6CA 1V5EA 3KOUA 2C07A 1F2TA 1JLKA 4QGFA 4R32A 2HH9A 4QFMA 4MVJI 1UJ5A 4ZO4A 1AQJA 4AJJA 2H52A 4RANA 1CUBA 1R6AA 4X54A 4YY3B 3SQNA 4BFZA 1H66A 4BP3A 3GLRA 1TPZA 1QCCA 1H93A 2VP6A 2WF6A 3I83A 3JQ9A 1H69A 3LEOA 3QHQA 5JXIA 4XR4A 3BWVA 4YAUA 3WNDA 4HLDA 4JTCB 1NUTA 3R5TA 3BXHA 2XA2A 3EQ9A 5B5SA 3LLIA 2FNAA 4WOCA 2KSFA 1NXSA 2GD1O 2OWEA 5H59A 4WBXC 4XLLA 5T57A 1YL6A 2I4IA 4INOA 3RU3A 4I1OB 1EBFA 4WDQA 4A2NB 1XDDA 2G9ZA 1JJIA 4TWAA 3LRPA 3LC7O 1BR2A 1V9LA 3C5HA 2IT1A 4GNKA 4LLCA 4C4SA 2NVUB 3K70C 4QDJA 1OB5A 2JH9A 2BDTA 2P0EA 2XUFA 2ZRJA 3GDWA 4DSOA 3AHIA 1BOFA 5KSOA 1FAPB 3ICWA 3B1WA 5HW0A 1ZM4A 3BEDA 4KWCA 2JATA 4N40A 4ZRNA 2C20A 3QP9A 1X3SA 3LKZA 1XZQA 3L07A 3COVA 3ZQJA 2I65A 1JHYA 4Q82A 1NN5A 1Z8FA 1PG5A 3TFWA 1XNRB 3T9EA 3V9PA 4MQFA 2HRCA 4X20A 3PBKA 4J3NA 2KPOA 5LWQA 1KOJA 3WA7A 2JA2A 1D1BA 1ZISA 4E3ZA 1B00A 1QQ5A 3SQXA 4E7PA 2WICA 2Y9PB 4O6YA 2Q3MA 3BMCB 3O73A 1J8MF 4O5AA 2B4YA 3EODA 3AGUA 1JHVA 2ZRLA 2PFDA 2YWDA 4HMQA 5LXTA 2FEXA 3AUUA 3IC5A 4M9ZA 1YBHA 2WFLB 1QFXA 3EHEA 2HWUA 1NBEA 3EZGA 3WLSA 4AE4A 1SA0A 1I1NA 3TLJA 5L0HA 1GLNA 1L5HB 4UU8A 4X9XA 1Z4OA 2XGGA 4UNSA 4CG3A 4LCJA 1Z26A 1OCCC 1NFOA 1I6WA 4KR9A 3ZU3A 5IDVA 4QOFA 1I2CA 4H6VA 3VR5A 2ZM6B 1ST2A 5J4HA 4DVZA 4EAAA 1XEAA 3JZFA 3UTCA 4QTYA 2O2EA 3JVEA 3L7IA 1DZ3A 3C5CA 1FNTc 4G5HA 5E6RA 3TZQA 2AK3A 3VVMA 3WSTA 5AVKA 1B76A 1YHZA 4ND6A 3V4RA 4XM0A 1XPOA 2FK7A 2JGEA 3DKIA 2PBEA 2VUIB 2W0SA 3HN6A 3R5SA 4Q19A 4UFNA 1Y9ZA 3O8OB 5D5PA 1XTZA 1ZVZA 1QNFA 2VWQA 4LVOA 1CYEA 1W35A 4MVRA 2CYDA 4H1UA 3BMNA 3IURA 4TLDA 1DWOA 3W5DA 4GYWA 2OBMA 2Q0QA 3VO8A 1BMFA 3PUXA 4CF3A 1V4BA 3B7PA 4UEOA 4EHDA 2J4DA 2RHBA 3VBEA 2D1QA 1HW1A 3LQRA 1I4ZA 2H4JA 3WYAA 2H1CA 1JJAA 1WD7A 3R9XA 2IU6A 2JHAA 3ZNPA 5BSKA 4MUIA 1T0HB 4YCBA 1UC9A 5JFGA 4NU6A 3RFVA 2WK1A 2W6ID 3EWAA 1C1XB 2Y1OA 2M64A 3ZNQA 3N3AC 3HKDB 5J2UF 1GLGA 1XYVA 2R8ZA 3O2NA 5BVGA 1K3TA 1Y8RB 2GFHA 3J81k 1DAPA 2ZRMA 4FYMA 4TX1A 4E2ZA 2PZKA 1A5BB 4PY2A 1AGRA 5EIEA 3AFOA 2AD5A 3CIOA 2WZBA 2PS0A 2GF2A 1ACLA 2GHQA 3ICCA 2L19A 2PYDA 5IUKC 2COEA 3D4BA 5K0ZA 1JL3A 5TF0A 2FN7A 3T5MA 2HTEA 2OCYC 4MYUA 1P45A 4XX0B 2C4VA 3PIDA 1T5BA 3PWZA 3Q5GA 1V41E 1BN6A 4O7GA 2BEVA 2WPDD 3LK6A 3R0ZA 3W4YA 2VXCA 2XAUA 3OOEA 3NBAA 4FEGA 4G4IA 1MHTA 2ILVA 3P2KA 3UUWA 1AKEA 1E5XA 3NRHA 5C18A 1NONA 5EK0A 2UZAA 3FOBA 1WDMA 3PR3A 4EDFA 1M75A 2EG5A 5LYJF 5FORA 3UJ7A 1JQKA 2XB9A 4NYJR 4PRYA 3DFIA 4EYQA 1RAIA 3D9QX 4G0PA 4B4WA 3RYFA 1NJGA 2K2WA 3T3HA 2OAGA 2OFFA 1WF3A 1X19A 4CKEB 4JNKA 6Q21A 1KDYA 4LHYA 4ZOAA 1L3CA 2B5OA 5IM4A 1FCJA 3MOSA 4DCGA 2P3QA 4DJTA 1MJFA 1U5CA 3KQQA 2Z9CA 5KYYA 4YCJA 4A2CA 4IL5A 1HE5A 3WLFA 4YCAA 3GCWA 2FG5A 2CL6X 2ZDGA 4GQAA 5JWHA 2LSEA 4ULVA 1KYYA 3MRTA 4R8KA 4TL8A 4CQNA 2QLJA 2KBFA 3N2GA 1Q0UA 2WYIA 2DHRA 3DMGA 3IQIX 4GI1A 5L0JA 1XLUA 3LZ6A 1W85B 3AJDA 3PV0A 3UFXB 1WE2A 2R1TA 1N0UA 4I1UA 3AT1A 1RHMA 3EF0A 1G4AE 5FL3A 1S2NA 2RHLA 3ITDA 1M2VB 3O3MB 4FD2A 3RV3A 3T94A 4RSRA 4F0JA 4HXGA 4ZT6A 3VJRA 1PJ2A 1NXXA 4NCIA 3JSAA 1SCBA 1ULBA 1TT7A 3QVZA 2BE7A 4FWBA 4L9AA 2BMAA 4Q4AB 3VPCA 2GTHA 1RP7A 3IHLA 1CRLA 3KV1A 4O1HA 5U1PA 2R8XA 4U39A 2Y68A 5FJIA 3UT5B 4JXZA 2WHPA 5HFJA 3MHPA 4L22A 3NHAA 3RTBA 3KO8A 1P0MA 4LJRA 3N2KB 1HZZC 4FZ3A 1VKJA 1YV9A 5TPWA 4XYMA 3VOBA 1QIMA 1YIDA 2AVKA 4KQ6A 3P96A 4N5MA 3T9DA 2PGXA 1HT1E 4B7XA 1PLJA 1U2EA 4NY3A 3L4JA 1U3TA 5CVVA 4XSGA 1BDJA 1L7XA 2NPUA 4JURI 1Y7PA 4MVXA 1YKSA 1G5FA 1K4MA 1T9BA 3AHEA 3EEYA 3INGA 4XB6B 4AF6A 3AB3A 3PXAA 1VMDA 4KLRA 4IS3A 4X44A 3RFFA 2HZ7A 2O8NA 1O94A 4QTXA 3EY9A 1OZ0A 4DLXA 2CUKA 2IHBA 6CHYA 2O8CB 2O2XA 1JRAA 2MWMA 5EIBC 4D4HA 3OZRA 1XRMA 3M33A 1ESNA 4FR0A 5AM5A 1I33A 4O2AA 2GQ0A 4JI5B 4H17A 4ZLDA 2Y66A 4P35A 3D5QA 5ESWA 5L3QB 4R68A 2KI5A 1LH0A 2XT9A 1IN5A 2VN8A 4CIHA 1SYQA 2C4WA 4JODA 1Z13A 2VB6A 2X14A 4GICA 3OTOB 2YVAA 5L51A 4CM3A 2OZLA 1TQGA 2YIJA 2XCOA 3BGWA 2O6LA 2O5RA 4HDCA 2YINC 3TQFA 4CQLA 5K03A 2GK7A 1OHHA 3L1VA 2WR8A 1X9GA 4ISBA 3K35A 4IIJF 3FPCA 4C2UA 4F8JA 1KR5A 5C5IA 4C4TA 1KSFX 4KSBA 3K1IC 3EZYA 1ZH4A 4OCZA 1R9NA 3CRW1 4Q7KA 4FPXA 3DFFA 1X42A 4OYYA 6ADHA 4XX1A 3ZGOA 3KPJA 2JG3A 4LYEA 3CUSA 3QUBA 2RGDA 2VF4X 4X45A 3UHOA 1GFWA 1L4BA 2JEYA 3GBSA 2Z8XA 3A7DA 2ZUDA 3AETB 4M98A 3DNPA 3SZ3A 1M5UA 5J3JA 3HP4A 3GHYA 4W7HA 2G4VA 4ANJA 3D6FA 5D51S 1DARA 3GVHA 2RHRA 2QZZA 1NN1A 4F71A 1U4NA 3GFBA 1J8QA 3VOAA 4C7VA 2J3MA 3N24A 3F9RA 4IP0A 4G86A 4D3DA 1MDFA 3AQBA 2YYYA 2HIGA 2JLZA 3V1KA 3JASB 4OHXA 1E60A 1NF3A 3B0PA 1NW4A 2B37A 3ZGXA 4TKVA 4TMTA 2FEOA 4EEZA 5HKBA 2X41A 3DDSA 3UGQA 1PJBA 5I7VA 2GBCA 1C17M 2IHTA 2LIPA 1M34A 2XV1A 3T1NA 2NO1A 2P77A 4NDZA 4DYDA 1CEQA 4I44A 1SKYB 5DOVA 4H16A 3EN0A 3GJSA 4FU0A 1CGME 3KT3A 3SBEA 4FILA 2NTVA 4JBYA 5DCUA 5C34B 2J3DA 5A4DA 4UPEA 2TMYA 1KU0A 1NKVA 2ZRFA 4NC3A 1LWOA 1QVAA 1TTPB 3H5RA 1YQWA 2XS1A 2CDNA 3F1KA 3M6WA 3H4MA 4FBGA 4RL4A 3TTSA 5C4IA 4DR7B 1XKXA 2R7WA 2YY5A 4LXUA 3IB3A 2LW7A 4UW9A 3S99A 3UG7A 4H7JA 1OLUB 1BH2A 4EF4A 2DBVO 4FYKA 3IEVA 2XVXA 3BA1A 1MQSA 2HNAA 2DWQA 1P80A 1XZPA 1QE3A 2XWBF 1STOA 1IXZA 4RENA 1EE1A 3L1JA 4LI0A 2CEAA 3HSSA 1ZXBA 4LC9A 2GZSA 3N8KA 3NKVA 4BBAA 7MDHA 3VU1A 5DS4A 2K2QB 5TY0A 3QLVC 5A0TA 1CUSA 4P34A 1G3QA 3SOZA 3R5KA 5HTKA 4IIFA 5JBQA 4OFWA 5ALJA 1D09A 5HDQA 4TTIA 1U0JA 4ZRMA 1QB8A 2IEBA 1EQ1A 3IIMA 4TRMA 4E4RA 1V5GA 4Q1DA 3GPIA 1BH6A 2XQGA 3ESDA 1ECFA 2FPLA 3VR6D 1T5TA 4NZNA 2EGUA 4GX0A 1OLXB 3FPLA 5ERXA 3AM1A 2OCBA 3L0IA 2QEQA 2JIBA 1XMOB 3OTGA 2YNMC 5H8WA 2L2QA 1SIOA 2HMUA 4U2BA 3FVRA 5JYBA 3U7HB 3TW8A 3CFYA 3FDZA 1JT2A 2CF6A 3P2MA 1RQGA 3S81A 3HNPA 2LDBA 2Z5GA 3HVJA 3TI9A 4UNNA 4BV9A 4BNVA 2KW3C 4IZHA 3KSRA 5HGXA 3M6MD 4M1SA 4FYYA 4R40A 5HJ5A 1TWCA 1E6CA 1ICIA 3E9DA 3Q10A 4QFDA 4TPKA 2DJIA 4II2A 4MIKA 5AIAA 4BU0A 4XVCA 4PPFA 3F5QA 1I9GA 3UQYS 1T8YA 1FUIA 1IY9A 1T9AA 3TLGB 2Z6QA 3DW1X 5IKPA 4UM8B 1QJ4A 3B3JA 3T4PA 4G7ZF 4H2DA 3WAGA 3GQBA 3N0WA 4EP1A 5JJKA 5KS2A 2OV8A 2V7GA 2ZW9A 4FOTA 4DMCA 4J4HA 1K7XB 1IM2A 2I67A 2W6MA 4FJ0A 4Y9RA 1SK8A 3LCVB 4QPPA 4U2EA 2B21A 4G5OA 3UT0A 5EGSA 4D0SA 1TUBA 1EJBA 4MP8A 3AILA 5EINA 3DCYA 4H1VA 5EJ4A 3UKJA 5DNVA 3FI0A 3OZSA 1YR7A 1J5EB 4C4ZA 4GEHA 2QMYA 4UCWA 5CGQB 2A1DD 1P31A 5JZVA 3QQPA 2ZUBA 4MUHA 4C08A 2ZJAA 1XD2A 2KSQA 2HI0A 2OR3A 2H8KA 2RG1A 2EJUA 2YWJA 3LYUA 1SQGA 2Y6UA 3KR2A 4ZT3A 4B80A 5HQ3A 3HDQA 3K1IA 1HSOA 1AKUA 1NIJA 2R86A 4PGMA 2C99A 2J9XB 4B3JA 5AVTA 4P6IC 3Q8LA 4HYEA 4RPHA 4S0XA 2IF0A 4IIHA 1UT5A 5H4HA 3N6VA 3TMAA 2PQMA 3KSBC 4FHFA 3C18A 4HE8D 5AJYA 3U3JA 5ALFA 1ZGAA 5CFNA 2ZI9A 4BLSA 1EWYA 2ZJ4A 1LA2A 3H19A 4BB6A 4A0FA 4B87A 4ZK2A 5A1JA 3MTBA 2GKSA 3KQKA 1WDWB 2RC5A 3VHRA 3U7GA 2CNLA 4QU0A 1OT3A 3ZTMA 1I32A 4TMKA 1SR8A 3MCTA 4C0WA 2AV6A 2EPMX 2VT7A 1CF9A 1AXGA 5CM2Z 2G3YA 4FX5A 1DEHA 2J0UB 3EQLF 3CF4G 1N92A 4U9UA 5A02A 4IDFA 4C5CA 2WT9A 3G23A 5IS2A 3BAZA 1FUUA 3CLVA 4HFMA 2QM7A 1BOOA 3O8QB 4GOLD 3HP1A 1ML4A 3R23A 5PNTA 3VKUA 4Z51A 2EEZA 1YB1A 3JSXA 4R01A 3E8SA 4M1MA 4ZD6A 3UC9A 2A68F 2DTDA 3VTZA 1Z83A 3EXEB 2SECE 4I08A 4KZPA 4LAFA 3W2TA 4YL3A 2A1TS 2RKWA 3DMTC 3OEHD 5E38A 3FAZA 3WE7A 4O3MA 1DXYA 2HA5A 1VTKA 3O1IC 4Z0PA 2PSJA 1R00A 2NU8B 1QOPB 1N7JA 3WAJA 3QW4B 1ODFA 5FPPA 1ZI9A 2PSEA 3RS9A 1B74A 1MX3A 1WD5A 4EKIA 3A6EA 4CS9C 1E58A 3LCJA 3PEEA 5FV7A 2ASRA 5BV1A 4LSWA 3H9CA 1NY6A 5JAQA 2OGTA 5LZ9A 2UZ4A 4XH9B 1KR2A 2ISQA 5JWOA 1MV8A 3LS0A