3SP1A

Crystal structure of cysteinyl-trna synthetase (cyss) from borrelia burgdorferi
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
469
structure length
418
Chain Sequence
MILKLYNTRTKDFSELTNFENVKVYACGPTVYNYAHIGNFRTYIFGDLLIKTLRFLGYKVNYAMNITDIGHLLTVYEISEFFTEAFFNDCRKLNIVYPDKVLVASKHIPIMIEVVKILEEKKITYFSNGNVYFDTSCFKSYGEMAGFKRNKTDFVLWFTNSKMKWDSPWGFGYPSWHLECAAMNLEYFKDALDIHLGGVDHIGVHHINEIAIAECFLNKKWCDVFVHGEFLIMDFITVKDLEDQNFSPLDFRYLCLTSHYRNQLKFSLDNLQASKIARENLINKLSYFYESLDPVDLNTLNKDLKNFGFSVEKEYYDSFVEKISFDLNVAQGLALLWEIIKSDNLSFVSKLRLAFIFDEIMSLNLREEILKNLQNHDVVIDENMKALIEERRIAKCEKNFKRADEIRDFFAKKGFVLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteinyl-tRNA synthetase
publication title Ligand co-crystallization of aminoacyl-tRNA synthetases from infectious disease organisms.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Ligase
total genus 153
structure length 418
sequence length 469
chains with identical sequence B
ec nomenclature ec 6.1.1.16: Cysteine--tRNA ligase.
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01406 tRNA-synt_1e tRNA synthetases class I (C) catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1910 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3sp1A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3sp1A01
1U7XA 1KQOA 3CLUD 4EG7A 3AFHA 1JEDA 3PXUA 2PZ8A 4TS1A 3ZJTA 1WXFA 4G5FA 1M8PA 4G6ZA 5LLTA 3AIIA 2CV0A 4OUDA 3MLAA 4NATA 3ZXIA 5K0TA 2E89A 3TS1A 1WOYA 1WY5A 4GU5A 3H99A 3M5WA 3CLTC 2E21A 1YUNA 3H97A 1TQ8A 3RHSA 3NV7A 4MLPA 4BWVA 3F3MA 3NBAA 4F4HA 4KR6A 1H3FA 1M83A 4EG8A 2JANA 4EF6A 1G8GA 2TS1A 1BS2A 4MUKA 1VLHA 4MW0A 2VTBB 1R6UA 2BYTA 3ZJVA 3COVA 4HPWA 1GLNA 1M1ZA 3LOQA 1T6ZA 2CYAA 3HFJA 3HL4A 1O95D 5IJXA 1OWOA 2A4MA 1TEZA 3NBKA 1O5TA 2CFOA 4YBRA 1V47A 1WXIA 1X6VA 3D6UA 3GUZA 4MW7A 1XNGA 1G59A 2WSIA 2DERA 4EG6A 3MMXA 2RE8A 1F4LA 1NUSA 1O94D 3ND6A 3HZRA 1Q15A 3FG9A 1H3EA 3G59A 4RUKA 2HZ7A 3TZLA 1QNFA 2DEUA 4EG1A 1Q77A 3COWA 3FY4A 4ZCQA 3RFFA 3ZGZA 3ZUGA 2C5SA 3CA8A 2DETA 4S1OA 4UZFA 1N2OA 1JIJA 1O96B 3FOCA 4MVYA 1Y42X 4DDMA 2DPLA 1NUQA 4J76A 4NAHA 4CQNA 2Z3VA 1H1TA 4PBRA 4ARIA 2YWCA 2J5BA 1JZQA 3Q10A 1IVSA 3RJZA 3CVYA 1GPMA 3Q12A 4MUEA 3FHJA 4MQ6A 4MVXA 4Q16A 1XJQA 1EUYA 1JIKA 4MWDA 4PY2A 1ZJWA 2G36A 2OQ2A 1OBCA 1TYBE 1NZJA 1ULHA 4KPUA 2QTRA 4HJXA 2EL7A 4QREA 3QTTA 5J5AA 4MWCA 3ZIUA 3CLUC 2PFSA 3FNRA 1QU2A 3D6VA 3TZEA 2H2AA 3FIUA 1QQTA 3AG5A 2O8VA 2CV2A 1MBZA 4J75A 4EFKA 4FZJA 4YP7A 3ZXSA 1JGTA 3N2YA 3C8ZA 1VBMA 1EFPB 4OJMX 3CVWA 1EFVB 3ISJA 1YIDA 2D5BA 3SZ3A 4DE5A 2GOYA 1U7DA 4AS1A 5DK4A 1JILA 1UFVA 3HGMA 1KH1A 3TQIA 5LFAA 1O0BA 1N2BA 4JZYA 1QJCA 4H3SA 4PBTA 5J58A 3PNBA 1NP7A 1I6MA 2YXNA 2H29A 3IUEA 3I05A 1KH2A 3VGJA 3SYTA 3INNA 1PFUA 1ZH0A 3DPIA 5TEWA 4RPIA 4ARCA 1N2JA 1N2HA 1O95C 4ND7A 3SDBA 3IUBA 4E1AA 1IQ0A 1N1DA 4MWBA 5HG0A 2Z09A 3K9WA 3FH0A 2J09A 3GLVA 4ZT3A 3COYA 3RK0A 3IOBA 1O94C 2XRYA 3ND7A 1IFXA 1CT9A 1KQPA 1O97D 1GZUA 2DLCX 5IHXA 1J1ZA 3DV2A 1QU3A 1F9AA 3CR8A 2JA2A 3IDFA 3Q4GA 2EJCA 3AKZA 1H3NA 2A7XA 1P7PA 2PZBA 1WQ4A 1MOPA 1U3CA 1XNJA 3CLRD 3JXEA 1GTRA 5FO0A 1KAMA 1VBKA 1S4MA 4DLPA 1J09A 5H16A 4UZEA 1PG0A 4WSOA 1ZH6A 4MAFA 3H05A 1QRSA 1PFYA 3UK2A 4L2IA 2QUHA 1I6LA 3IMGA 3P0IA 1WZ2A 4AQ7A 4OUDB 2A1UA 2PG3A 4R2MA 2WQ7A 1A8HA 3FDXA 4NZPA 3HV0A 4YP6A 5TEVA 1OWNA 2J08A 1YIAA 3FWKA 3LCJA 4QBTA 2AKEA 4MWEA 2A84A 5TS2A 2AG6A 2O5RA 1KP2A 1KAQA 2JAXA 3N05A 3N8HA 4MULA 3UMVA 3OP1A 1HYBA 1WJGA 1JZSA 4R0NA 2B7LA 3IOEA 3AL0C 4DDHA 3A05A 1Q11A 1LI5A 1QTQA 1JMVA 5KHAA 3TQOA 2NSYA 2X3FA 2CSXA 1SURA 4GRIA 4MUGA 2X0KA 1FYDA 4ND6A 4MW1A 4I6JA 4G5YA 2X1MA 2R5WA 1ILEA 1IHOA 1YUMA 4HK4A 1Q19A 1K97A 3LE8A 2QTMA 4KR9A 1RQGA 3U1VA 4U7JA 1B6TA 4HJRA 2V0CA 1NUPA 1IQRA 2E18A 3IOCA 3IH5A 1GAXA 1N2IA 2IELA 1VL2A 2Z08A 4ZT4A 4JYZA 1O97C 4PBSA 1K92A 3E27A 1T6YA 3VU8A 4MW2A 3CLSD 3A04A 1GTSA 1EJ2A 1T9GR 1X8XA 1MAUA 4K03A 5J59A 5TGTA 2X1LA 1OD6A 3CLRC 1JHDA 1O6BA 4MUNA 5JBNA 2NZ2A 4MW6A 3OTWA 3CVXA 4KPUB 1YI8A 3IVXA 5F23A 1MC1A 3K32A 5HUJA 5DB4A 4EG5A 5KWVA 5LM3A 2CT8A 1PG2A 4DNXA 2D13A 1OWPA 2QUKA 1T6XA 5BNZA 2QJFA 4Q93A 3IODA 3BL5A 4MUJA 3MUEA 4K0RA 1YULA 2QJOA 2J4DA 1KORA 4F3RA 1KP3A 1J20A 2OV4A 3DLAA 4XSVA 4MW5A 3ND5A 4ZCTA 4KR7A 2V0GA 2RD2A 4NX2A 1EUQA 3SEZA 1N2GA 3PRHA 4JXZA 1KKUA 1PFVA 1N75A 4DDKA 4KKVA 4WNYA 1MRZA 2DXIA 1WQ3A 4ZCPA 2VTBA 3COZA 3ELBA 3H9CA 1J21A 1TYDE 1MJHA 3SEQA 3P0JA 2ZP1A 4YMIA 1J70A 3UY4A 1U0BB 3RK1A 1NSYA 1LW7A 2CUZA 3UOWA 3ZJUA 1M8GA 4CDMA 4JFAA 3PNYA 4ZT2A 1IH8A 2QUJA 3QTBA 3G6KA 1QRTA 1QRUA 1M8JA 4MUIA 1R6TA 1OWMA 4JXXA 2A88A 2BTEA 3IMEA 4ZCSA 1N78A 1N77A 1O96A 2XRZA 3A4IA 3HMQA 1EE1A 2WB2A 3GMIA 1MAWA 5KCMA 1JIIA 1IRXA 2A1TR 4U8HA 1WKBA 1R6XA 5K0SA 3DO8A 1MB9A 2HMAA 5H7XA 5HUHA 2WQ6A 4QRDA 4I6GA 1KQNA 1K4MA 1EXDA 5EKDA 3CVUA 2CYCA 4EGAA 4MVWA 3CLSC 2CV1A 1T9GS 1U3DA 4L2IB 2PZAA 2PIDA 3MLBA 4CDNA 4MUHA 3L92A 5AHWA 2YY5A 1F7VA 4P2BA 1N2EA 2QTNA 1F7UA 4ZT5A 2A1UB 5DEOA 3CLTD 1WXGA 4MW4A 1VBNA 1J1UA 1OWLA 3UC5A 4NAUA 3KT8A 4XFDA 2ZUFA 3SP1A 1O0CA 4X0EA 1PFWA 1EFPA 3PNVA 1EFVA 3AG6A 1NUUA 2CYBA 5FO1A 3X1KA 4U63A 2YWBA 3MXTA 1NUTA 3RBAA 4ZT7A 3P0HA 3ILVA 4NDAA 4MVCA 4ZCRA 4MW9A 4XFJA 3A2KA 1XNHA 2D54A 3IMCA 3SZGA 1WXHA 3IVGA 3VRHA 3CVVA 3FI0A 3S3TA 2VXOA 2GKSA 4EG3A 1FFYA 1G8HA 1MB2A 3TNJA 3KT3A 3X1MA 1KR2A 1NI5A 1TYAE 1V8FA 1NURA 3L93A 1I2DA 1M8FA 1WXEA 4YP5A 1DNPA 3N9IA 1KH3A 3KT6A 3G5AA 3KT0A 3QE4A 4CT0A 2PXHA 1G8FA 1IQUA 2IP1A 2ZUEA 3P52A 1K4KA 1JEEA 2E0IA 1TFUA 2HGZA 2DUMA 1N3LA 1LI7A 4EG4A 2QJTA 2J07A 3FETA 1I6KA 2QUIA 2DR2A 1M8KA 1COZA 2A86A 3IVCA 5DASA 5FNZA 2IJGX 3X1JA 1NYLA 4R2LA 4MUFA 1OBHA 3KFLA 1JECA 1TYCA 4I6EA 4DJAA 3H9BA 1D2RA 2I1LA 4ZT6A 4A91A 1ZUNA 2GM3A 1GN8A 2AZXA 2A1TS
chains in the Genus database with same CATH superfamily
4OXXA 2WV9A 4Q01A 5JUWA 3U3BA 4MYTA 2I7XA 2BD0A 2XITA 4IOJA 2Y3GA 4BFYA 1T36A 1G63A 4GU5A 5KJFA 4G1MB 3K94A 5CD9A 1F2UA 1IM5A 1GHTA 1DX4A 3EIHA 4PLFA 3LCRA 3I6QA 1R9GA 3M89A 2QI9F 1OVMA 3EVTA 3CKLA 1OWOA 5FCDA 5EL0A 3GBSA 5TV2A 1IK6A 4HDMA 2WU1A 5MFZA 3TRFA 2JAPA 4HOYA 4GOMD 3GLSA 2EG9A 3ABLC 1X7HA 3EULA 3FY4A 2ZJ6A 2PBZA 3DW3X 1ECLA 1NW5A 1TUBB 1M6HA 4N0QA 4GHWA 3OZGA 5L4LA 1NZJA 2JKYA 4G26A 4BMYA 5C7IO 3M81A 3FMFA 3J81A 1NBWB 3M6LA 3EPPA 3H7AA 1XD2A 3HJFA 4BU0A 1NJSA 4LZLA 4GD3Q 3NTOA 2O2JA 5IWCA 1RP7A 3ET4A 2VPXA 3ZTZA 2G70A 1UK7A 1N57A 4L6CA 4N8EA 1O54A 1M6EX 4L0MA 4YV1A 2ZWMA 1WW2A 2JRCA 2E5LB 3ILSA 3B7WA 3AX6A 3REGA 1T3HA 3E0QA 1Y4ZA 4PQEA 3CF4A 1EK6A 1IONA 3H1TA 2D2EA 4BQIA 1XCJA 5DI3A 1CDOA 4NC3A 2R1ZA 5FO0A 5FOXA 1Z62A 1P80A 2ZUDA 4REQA 4FJ2A 4IRXA 4Z7NB 1JQ5A 2RHHA 3EIEA 1UKBA 4EBFA 4D3FA 4OHBA 2W2PA 2JK1A 2Q6IA 1UPBA 2DR3A 3SI7A 2V7PA 2O6HA 3C87A 4NCHA 4WEOA 3OC6A 2I15A 3KXDA 4WKGA 4US1R 4Q9HA 2HK8A 5DN9A 1SXJD 1TUIA 4B4VA 1P39A 1OGIA 4NE7A 1ZN9A 4CW7A 1ISPA 2BCGY 3GLFA 4AKHA 2OM6A 1OYVA 1PQ4A 2R0QC 1T15A 4HGQA 1ZCJA 3ROTA 2PSEA 3HLYA 5BWNA 5FLKA 5CEFA 4EO4A 3VU8A 4RTMA 2Q4DA 2BKUA 4ZVLA 1RWNA 3SIWA 1QHYA 3GGSA 4HC4A 5ISMA 4BMDA 3FSRA 3MFYA 2ROQA 4NZYA 1QQBA 2GBLC 2I65A 1CF2O 1Y1QA 3URKA 4Q3LA 2R8EA 1GZVA 3BFJA 1FYVA 3DBHA 1TZKA 4HX2A 2QIOA 5EJ9A 2IIQA 4UPEA 5DEIA 4JX8A 1G98A 4R40A 3WA6A 2TMVP 2J5XA 4RVHA 1ULSA 3PLRA 3W3AH 1QHFA 4BFLA 4RANA 3I2YX 4MVJH 4GPZA 3EGDB 1C5KA 2DULA 4UHCA 5KNBH 2GCOB 2QUJA 4CIXA 4DAOA 3MLGA 1LDMA 1OH5A 3NI2A 4X65B 5MGNA 5FRDA 3HVUA 2ILVA 1U3DA 1VL0A 3R3VA 5BNIA 5AHWA 3PPXA 2ZFUA 3VR4H 4QYSA 2PKYX 2QV7A 3RV3A 4Z4CA 4GYKA 4MCHA 3TLMA 5JJIA 3KQQA 3GLHE 4R3UC 3ZHCA 2OK8A 3RVQA 4V3BA 5KVCA 2VXOA 4I3GA 2QTWB 4ENUA 4UHHA 3E70C 1VHWA 2HWYA 2VPIA 4KTTE 2F62A 3C3XA 3S55A 3R2PA 2Q9UA 4LZZA 1X0VA 5DHUA 2SKDA 2ZR8A 5EK0A 2HCJB 2AZXA 4KI2A 5L0FA 3FUCA 3V5ZA 1RYHA 1OQCA 4CN9A 1WVIA 1M8PA 1U7TA 4U8GA 3IKVA 3CEMA 5KYTA 2MSLA 2O0JA 3K0BA 5D8DA 5IMSA 1SB8A 2ZSIA 4URHA 2J5KA 4JP1A 4BS9A 1MP0A 1ISFA 4GOJA 4C6RA 2GM4A 1ZG3A 3BULA 3BHIA 5EE9A 2ZTSA 3IALA 1X7GA 4HMOA 4C4ZA 2ID8A 1N4DA 4BP3A 3KALA 1EWRA 3LRXA 1VPEA 5KYGA 4HF7A 1OCZC 3EWAA 3KDAA 1YR9A 2GEDA 3C16C 3QZUA 3GZTB 1W1WA 2ACWA 1SCUA 1B14A 1ORVA 2YJTD 1YDWA 2A69F 2OQVA 4LNHA 3T35A 3HNRA 4XTCS 4GPIB 2NUAB 5ITSA 1X0XA 1YQUA 3ODGA 4D9IA 1QQTA 4ZQBA 2IOYA 3D0RA 4NENA 3W7BA 2HJ3A 3B12A 3WIDA 1NJ6A 3MAAC 3UWDA 4K2HA 4LKRA 4DRYA 5K4AA 3CVWA 3DLCA 5GZ6A 4BWYA 1I7SB 3WGQA 2I33A 1T4BA 2IS6A 3ANLA 5J5VA 1CUSA 1KWGA 3ZV7A 5EWMB 4M36A 1PQUA 2HBRA 3K53A 2I2DA 3AR6A 3K6JA 5CB8A 4I9FA 1K27A 1ZVQA 5ICSA 5I4KA 1D2NA 1J2TA 1D1AA 3M3HA 3NHJA 4XVUA 1BU8A 2GNAA 1FS4A 3R44A 3VDQA 5LUBA 3OZDA 4HXYA 1BAPA 1O6CA 4LYFA 3CH4B 3HRHA 1CXZA 3N39C 4HAUA 3EDMA 1YK0A 2WT4A 5F2NA 4L4RA 3MC1A 2ACKA 4GYYA 2AHRA 3C4QA 2QMQA 2W6IA 1N8NA 4JLJA 2Z4TA 3GNLA 4CUZA 4QDJA 3H11A 1F60A 1BTOA 4DXWA 5TJ5E 5C5DA 1VE9A 3QVMA 2OC9A 1A7EA 4E5DA 1YQ9A 3PQ5A 1SWWA 4KIGA 3M0EA 4PO1A 4DRXA 3O2JA 2EC5A 1A9RA 1SC3A 4DFDA 1F1MA 2ILTA 1NGSA 3EUAA 5F1YA 4KBFA 1AN9A 3SICE 1VE1A 2WR8A 4B87A 3B51X 4NH4A 2G5GX 5FEMA 3MRXA 1M5UA 3CSUA 1VJ5A 3COPA 5K4HA 3S2YA 4JDUA 3RWMB 2PXCA 5LDGA 2HHHB 4DVZA 4XD7D 1DAIA 4FWBA 5KWJA 1ZGAA 4DR2B 2WWFA 5KTKA 5JJKA 2HJGA 4WX2B 4DY6A 2PGJA 1CE8A 3R9XB 1AX9A 3HSSA 2DT5A 4Z4IA 3WHLA 4AF6A 4RM2A 1X2BA 1EFHA 4L5BA 1FNBA 1WX1A 1E89A 4AF7A 1LNQA 1DWUA 1RYYA 3F7TA 5EESA 5ECWA 3GEHA 1U1DA 5T5QA 1YL7A 1ZVVA 3QF4A 4NY3A 2JJYA 4LXXA 3G6KA 1HR0B 3CX8A 4TXMA 1HKHA 1FSGA 1IN5A 1ZCZA 3ZJ4A 4ZOQI 5FWYB 4ND1A 2YC4C 2BFMA 4R8SA 5JWHA 2W71A 2PJRA 1EFUA 3BFPA 4ENTA 1VCHA 1XDUA 4KGVA 4UCWA 2VYCA 4F4JA 1U9IC 3GUYA 3UUWA 4FBLA 5LZ2A 2B8TA 2Q6OA 5KNCD 4OB8A 3D54D 3RVJA 4Z3DA 4JT4A 1EBFA 1U80A 4JTCB 2XT6A 5B3JA 3U37A 1XTJA 1E8MA 5F5FA 3V7YA 4U7FA 3HBLA 3OX1A 2WTBA 5ECYA 1KEVA 2H3EA 2PT7A 3MINA 3QE4A 3LUFA 2I2XB 4BDTA 4ZO7A 1ISGA 4Q3AA 4D81A 1CP2A 3GNQA 3IVRA 2P75A 2FOLA 3I30X 3PEEA 4N4AA 1CGNA 1V8OA 4U5XA 1L5LA 2NN3C 4LJ9A 2BFEB 3MJHA 1RLUA 3HJTA 3A36A 4Q7EA 5CYGA 4KPFC 5E6RB 2YWAA 3SYNA 5E6UB 1G4US 3RIGA 4E07A 1G6KA 4K9RA 4M83A 3SM3A 1LNSA 1G20B 1Z3CA 2VPZA 4LLEA 5DTMA 2W90A 1BWRA 3L6OO 3THWA 4YO8A 5BSRA 4MUBA 3HNOA 5LB2A 5T4EA 3PZBA 4DBLE 2EL9A 1ENPA 5JW6A 2VK1A 2X9VA 3MN1A 1BCRB 1VCNA 2VSOA 1XZNA 1XWWA 2ZSDA 3SVTA 1SKBA 3JRMO 2YOHA 4IJUA 4OJTA 1CQIA 2EZ8A 3X1XA 1SY7A 1P74A 1HBJA 4G65A 2P8SA 1ZN8A 3ER8A 2ZBUA 2X0JA 2WTNA 1QKJA 4GZLA 3OFKA 1JR4A 4GL4A 4M53A 1S3FA 1L5HA 4K28A 5A6BA 1QWSA 4DLTA 5KHLB 1KEEB 2OOCA 4YWJA 2PU7A 1Q0ZA 1Z38A 4C43A 2LD4A 3QKRB 2H29A 3MWDA 3UICA 4Q37A 2O20A 3NVAA 2Z9DA 5BV7A 1Z4JA 3L49A 3M4JA 4XQ0A 1N1DA 4C4AA 4Y2PA 4URZR 4AKSA 1SUFA 1V16B 3L4EA 3GDGA 2ECOA 3AKZA 5IJ0A 2PIAA 1KAMA 5A4DA 1S4MA 2HMQA 2QDKA 4TT3D 4NQZA 4FDVA 4PNZA 2MYSA 1VJGA 256BA 1PZHA 1U0EA 3BCRA 3NWPA 4PPQA 4URYR 4AZ3B 1K3TA 5DTJA 3NTQA 3FCSB 1ECJA 2WU8A 3AUAA 3DBLB 3CKYA 2X5OA 3ZDDA 1ZD1A 2IODA 3VKHA 5DGHA 4GKJB 1MH9A 3IHWA 5EIBC 1X13A 2OBLA 1JH8A 3BK7A 3U9JA 5LJLA 1OAOA 4YJ3F 1OXKA 1W0JD 3AGUA 1NFOA 2ERCA 2ODQA 4ZVKA 1KBQA 4ZVMA 4BJHB 3MSCA 4UFOA 3WKBA 4D3DA 4TQUS 5CNKA 1FJGB 3VM6A 3FZQA 3ZW9A 1DKRA 1KI4A 3T9EA 4TVOA 1E2JA 1X86B 4J7TA 4JASB 3ZV6A 4Q7CA 1K7FB 1XZCA 2P2ZA 2JKVA 4EUFA 2R86A 4DEYA 2J4DA 1G8YA 3AUJB 3GLIB 1Q91A 3TG2A 5BQXA 2O8BB 1BFKA 4OI4A 1CD5A 5SY4A 1QF9A 4MYHA 4ND5A 2IEBA 1DC6A 4M21A 2HU8A 1REQB 4XM0A 3GXBA 1SBNE 4DZZA 4O63O 3OT1B 5FWNA 3IMEA 4DWVA 2OZVA 5KCMA 3CCBA 2H11A 1M34B 2Y3HA 1VIYA 5DNWA 4FB4A 4R84A 1J8DA 2IWHA 3NIGB 1HTBA 2ANCA 2OHVA 4BMOB 1NJ1A 4MV5A 3U17A 1Y7IA 4Q82A 3GW8A 4XFDA 1T9CA 4YAUA 1XRMA 3NWJA 2BZGA 2Z8XA 4HNQA 1TO2E 3TGLA 2JNWA 1TGYA 4IIXA 3DAOA 1AE1A 4JK3A 2Q07A 4EA6A 2R6GA 4AJHA 2I3DA 1L8AA 3WIEA 3WZMA 2WMYA 4DB4A 2HMWA 4ZPJA 4OQZA 2KJQA 3O3OB 3PUIA 1CIVA 2A1DD 1WXEA 4EM6A 4NR0A 1RCTE 2ZVDA 5IF9A 1XV5A 4G36A 2DF8A 5CJ2A 2FUG6 4XWTA 3RLFA 3NEYA 5HX7A 2J48A 4WPGA 2FNAA 1XZPA 4L57A 5COBA 5LOVA 1QPZA 3WIOA 1PS0A 1GR1A 5C80A 3REFA 3GPBA 4MX8A 5CU7A 2V4MA 3JYQA 5REQB 3TS1A 4AB1A 1VHJA 2P9CA 4MR7B 5G0WA 3UR3C 2FB9A 4CF5A 2OZKA 4F9FA 1HZZC 3AKCA 3S81A 1LFDB 3HCCA 2JFUA 2GBIA 5B5SA 2PJZA 1KDZA 4LGYA 3FVTA 4CMHA 3IUSA 4IPTA 2PFKA 4I19A 2C5SA 3MWLA 5B58C 2YJ6A 3H7IA 5H0IA 2FR8C 4LDZA 2IRWA 1NRJB 4FJ0A 1JIKA 1PTKA 3UJ8A 4P34A 4LJ6A 2ZITA 3F8TA 2QJWA 3RUDA 4UTNA 2IXAA 1XLUA 4J75A 3KZNA 1VLZA 2REQA 4W9NC 4RQTA 1T5IA 5I9MA 1AC5A 5EXXA 4K9QA 1NN3A 2N42A 4R69A 3OE1A 2HJVA 4CLXA 1S2MA 3QVYA 2HF7A 3TL3A 4UUBA 2AH5A 1K0UA 3PCTA 1D0XA 1AMUA 2I9PA 2VOEA 4OG2A 1YA7O 1UWVA 2GJ8A 3HXOA 3PIIA 2GN4A 2E49A 1MQAA 4PCUA 4AP5A 3FAKA 4Q48A 3AV0B 2RCNA 4NBLA 3RQSA 1RLIA 4N12A 5GAJA 3NVDA 2JIDA 4EBJA 1QKRA 3M8KA 2GZMA 1WCV1 1VDMA 1XMQB 3WB0A 4BU1A 1NXWA 1BSVA 1YR7A 3UGJA 1KQGA 1O3YA 4HRXA 2G5CA 3B60A 1KC3A 4G5OA 2H54A 3FF1A 4MRNA 3DW1X 2QA5A 2O3SA 5ER9A 1ZH2A 2GSDA 4UEKA 1CV2A 4L15A 1RXIA 2P9TA 4C4RA 1U7UA 5EHHA 5LZ8A 3QG1A 4PTZA 3R76A 2YBDA 1Q19A 3DMNA 3SXZA 2WNHA 2PZGA 3ASVA 2PGIA 1Y3BE 3USZA 5FB3A 3GGDA 1JR3A 3VO8A 4L6IA 2IHUA 3T34A 1JFFB 1JKMA 4B81A 5JRJA 3H0EA 3M2TA 1JA1A 5M3BA 5JZVA 2H08A 3C1AA 2B82A 1RWOA 5GY7A 3GFPA 1V3VA 3U16A 2P2SA 3BGSA 1N2GA 3LY7A 2I55A 1NKVA 5JQGF 3NOXA 4R8LA 1EHIA 4AJIA 3TLZA 1N0UA 4J7UA 2P7IA 4N6HA 1J21A 3JSEO 4TLAA 2ZP1A 2O7RA 3NRJA 1EUCA 4JUIA 4N5NA 1W5EA 1T2EA 4EELA 3A3PA 4LJ8A 3I9MA 2BMEA 1B41A 2CD9A 2OQMA 3H4MA 3KEFA 1E86A 4KNYA 2VP9A 2Z83A 1Z0DA 1DE0A 1E1QD 2UYQA 1GN9A 3W8RA 4L0CA 4YAIA 1WU8A 3EWSA 5ELLA 3HQ4O 2CLSA 1ZKDA 2JIOA 1FMFA 1QIHA 3GARA 4GEKA 4BX8A 5DEOA 2V97A 5HJ2A 3W5HA 4RJ2A 3BXPA 2YWGA 1FIUA 1BDBA 5AW6A 3NHWA 4GO1A 2ZXWC 4AWXA 2O8CA 2WYWA 5C5IA 1P7YA 2XOXA 2P6PA 3V1NA 3GLHB 2BI8A 2YXPX 2Q5EA 3EK2A 2JZOA 3JYNA 3GLFE 3HC7A 1OH6A 5L0GA 3JZIA 1F2TA 2BHNA 3OH8A 4LJ7A 2NU7B 3WL3A 1YS6A 1M0EA 1H6CA 1KPGA 2PGDA 3REOA 1XZJA 5TPWA 4EJ2A 4X8MA 1IHXA 1ISIA 1PFKA 1QXSA 3UA4A 3GELA 4RYDA 1XA4A 2ZUTA 5F4ZA 1X38A 3ZVKA 1R0WA 1EEHA 4Q4JB 2UZAA 3SBOA 3LXUX 3KYDB 2BMVA 3OQIA 4TZ6A 2EFCB 2WY2D 1Z23A 1BWPA 2CKDA 3LC2O 3NP9A 3SM9A 4BFXA 3UW3A 3JQ7A 5GIOE 3L8IA 3EF0A 5M04A 3TE6A 4KWCA 4CMBA 2TS1A 1BS2A 3W6ZA 1BHSA 4WQMA 5IXSA 1WETA 3O8LA 3P27A 1V2HE 3FLMA 4Y3UA 1N6KA 1VBFA 3AHIA 4LYDA 4NECA 1JFLA 1ECBA 2CXRA 3BHMA 5IJWA 3EZHA 3RI3A 2RBEA 1QR6A 3UK0A 5DNDA 1C29B 4K87A 4X1OA 4K6CA 3GLQA 1WAMA 4FGUA 1T6IA 1DFGA 4H60A 2KI5A 1II0A 5IASA 2NT3A 3HGTA 3DCJA 4OJMX 3IGFA 1FLDA 4ZOLB 3BORA 2I6TA 3BB1A 4PQFA 4LF9B 4ZJPA 4CT4B 1KDTA 3IUEA 2C20A 4XEVA 3RFCA 3DPIA 3QWFA 3OIUA 4EI9A 4UE3S 4QDOA 3ZTYA 3F7NA 2OK7A 3OE4A 3TEFA 3SXPA 4F1KA 2IXTA 3IOBA 2DLCX 3B82A 4U6SA 3L46A 4YMGA 3EMKA 2V6BA 3M82A 4AUNA 3ZNPA 2YZNA 5ULLA 4LYHA 2HNKA 2QPOA 2DWUA 1U98A 4MINA 5KWEA 2D0IA 1T4DA 3AHDA 1OB2A 4JLPA 4XRGA 1NDHA 1QTRA 5E4YA 4PTYA 1U1GA 1NMYA 3DKKA 2PKWA 5K09A 3LLCA 4TMZA 3B89A 1XLWA 3JQAA 4AYXA 4BXOB 1BW9A 1AZLA 3GT0A 1R5OA 4X1IA 1UZMA 2CF6A 3QXSA 4P31A 4U7JA 3CJTA 3LD9A 1IQRA 1LBEA 1QFZA 4CM9A 3JQBC 2P67A 1KQ3A 3I4LA 1OZAA 4RDAA 2OFFA 1JT9A 4BN5A 1OQAA 2NX2A 1OIWA 3OO1A 2PS1A 4FDLA 3AFOA 1LPSA 2ZIVB 1Z6YA 2VT3A 3RR2A 2IXNA 1IB6A 3PFBA 4K0RA 4YT5A 2YW2A 3AUYA 2CFCA 3ZCXA 5FWAA 2H2IA 2OEPA 2QV0A 5BOSA 4MGKR 1JPJA 4E2XA 1TW2A 2JB9A 4BO0A 4YPOA 1DIHA 3VOSA 4Y0VA 4M0EA 4O2LA 4CDMA 3JTLO 3DDSA 3WV5A 2JD0A 3CTMA 3W2TA 5TVKA 2V45A 2BDEA 4WESB 4RD9A 2OOSA 2XAAA 1R4TA 1JFVA 4IDNA 4A6PA 4UOQA 1GPH1 3WKEA 3LSYA 3RQFA 5LUAA 2I87A 1YB7A 2ZYGA 1K06A 4HDQB 1V6AA 4QECA 4DKXA 2VPWA 4TWZA 1T9BA 2A1UB 3VXKA 3DZHA 4H7FA 5JADA 1RYBA 4MW4A 2R6FA 3G89A 5AOVA 1VSBA 1W73A 4YRBA 3G23A 3GRRA 3STYA 2WWRA 5C5EA 1QX3A 1YTUA 3HU2A 2PO7A 3TR6A 1Y80A 3Q9SA 1TWGA 3DFZA 3MSXA 5EJ8A 1G4HA 3JYOA 1YHYA 1DNPA 4I44A 1VPDA 3DULA 5SY6A 2F8SA 2CJWA 2LZ0A 4IIVA 4IDHA 1CRZA 4H6PA 2VDOB 1D0SA 4G9GA 1HFKA 2V55B 1DZ3A 3RYIA 2CXNA 3VYUB 5J2UB 4B47A 5H1YA 2QE6A 4GVPA 4A91A 1NC1A 1TCCA 1TM7E 4W5JA 2QRNA 4M46A 5K8LA 3OJOA 3LZCA 1FU4A 3II6X 2CL7X 2EJTA 3RFUA 5F98A 2V6MA 1FUKA 3F97A 3TRDA 4KHPB 3H5RA 4J0QA 3UPUA 1XZ8A 2OVFA 3TTWA 3L7CA 1E77A 4BMNA 2YXLA 3HJNA 4I46A 2HU7A 5I8PA 4L9SA 3RRMA 1YFLA 5I7VA 1WU7A 3N7AA 4YQFA 1U0TA 2OD2A 4ER6A 4XQGA 4F38A 1E2GA 1OIVA 3HJGA 4PV7A 3COWA 1EXWA 4CKZA 3DDWA 5KDLA 4BNYA 3ADKA 3W1VA 1DQZA 3WLLA 1HDEA 2DC1A 4WGYA 2ISQA 3R9IA 2D5CA 4G5GA 1EK2A 5LA6F 4K9NA 1M2HA 4LC1A 3JSZA 5BN1A 5CB4B 4W5RA 1XRNA 4ALLA 2FN4A 5JLJA 2OXIA 1G6OA 4W8GA 2GQ0A 2H4HA 2RCYA 4HXEB 1YS9A 3N2KB 3R20A 4Y98A 2Z8ZA 4I8XA 1LDBA 3KBBA 2WWYA 2F9MA 2WIFA 3IQ6A 1Q12A 1U4NA 3LQYA 5AO9A 2NT4A 3CPJB 4CQJA 2RAUA 2MINB 2ZLBA 3KQVA 4RDIA 1HE5A 3ZI7A 3AVVA 3A4VA 3WO1A 1JEAA 4DLPA 1J09A 3RIHA 1ZU5A 4AJ4A 3G8CA 1DWPA 1VYUA 3ROZA 1IZ8A 2JGNA 3M4ZA 4L28A 1XJWA 4O2BF 3WK8A 4F5EA 3HZZA 2EXXA 1SUBA 1OWNA 3AO0B 4KDEA 3B0UX 3L8FA 1NHGA 2HRBA 3EUFA 2CVZA 4HLCA 1GG2A 2VHCA 2NADA 3ESZA 3FYDA 1OSNA 1N9KA 1HOXA 2CDAA 2VZLA 2D7JA 3IESA 4RY0A 3P71T 2C82A 5T8KC 5ALTA 5FX2A 3D7KA 4DSNA 1E2PA 4M38A 3UHFA 1XK7A 3RFTA 3RAJA 3ENNA 4ZMBA 1NLUA 4IDAA 5EFZA 4KU4A 3MWYW 4JQYA 1D4ZA 4B45A 2BZ1A 4AULA 3T4UA 3ZW8A 1Q6ZA 3R24A 1RZRD 2FSVA 1Y81A 2VNKA 1PGJA 2ERXA 3PHCA 6ADHA 1G2PA 3GGJA 3NOQA 3V5NA 4EY8A 4UNQA 3QOXA 3DB2A 1APCA 1W87A 2A7QA 5HZKA 3USES 1FPQA 4HWGA 4RDCA 1GO2A 2C2XA 4HUTA 4G5XA 2JAOA 3IKJA 1C3EA 5AJXA 2J0QA 5CA1F 2OPBA 3K16A 4QM7A 4BRWA 3KUXA 3PV0A 4Q4LA 1EAMA 3KAKA 3VPCA 2J3QA 3P45A 4FE4A 1NSYA 4LTNA 3NWOA 3KWLA 4D8UA 4JFAA 1QZZA 4P9NA 4F8YA 3L6CA 4UAUA 2AT1A 1RM4A 3PNPA 4IKOA 2L82A 4JP8A 4D8TA 1N6RA 4NBKA 2XA1A 2OWEA 1PL8A 2A1TR 3UVEA 4F93B 3U4QB 5FOWA 1KNQA 1E79A 2VJBA 5SV2A 1T8RA 2VJCA 2Z57A 4D44A 2B92A 3BMCB 1CZRA 4PPFA 1HA3A 5EAIA 3RM3A 3LECA 3H84A 5AFSA 2HNAA 3N7TA 5F2KA 1NXPA 5G02A 4OMCA 3O1IC 2LCIA 3RCBA 1EP1B 4RHEA 5G53C 5FFMA 1IVNA 4LWPA 4ZKDA 4QJ3A 2NZWA 1XTTA 3BIFA 4KLCA 3R9KA 2VPTA 3USCS 1SR8A 1OREA 1X7WA 4TL8A 4OHYA 2J1LA 1QO0A 2CHQA 2XVXA 3KUUA 1JU3A 3FSGA 4LLCA 1MO3A 2WRZA 4I1RA 3F4KA 2O4UX 1JIQA 3OPYB 3UAOA 1CETA 4KIFA 2YIDA 3C5WP 4G6ZA 3WBFA 1BEZA 3JD3A 3TMAA 4OUDA 1BS9A 4AL0A 2CE7A 1UPAA 2UUCB 1UBTS 3UPTA 5AKYA 3U0VA 4UUQA 4J0HA 3L41A 1G8GA 3BPSA 5EXSA 4PZEA 1R0LA 3IO3A 4AAYA 2WHYA 1GGJA 5PGMA 1YS2X 1OT5A 1YA6A 3N2IA 1XCGB 2C7OA 2G1KA 2WWXA 3IDQA 4RKQA 3PUVA 3C98A 3WK7A 2WJJA 3WNZA 2VJAA 3FG9A 2HDOA 3W2WA 3HDTA 3UWOA 1VG0B 4Z7JA 1ONPA 2HLNA 2BGTA 3O39A 2JLSA 3UMIA 3WLHA 1RACA 2KBEA 1Q92A 1U8UA 1UT8A 1CUVA 2B25A 2X0RA 1I5RA 1VKRA 4CTNA 1OX6A 3FTCA 3RUCA 3EY4A 3A4TA 4AM8A 4BWGA 4TZ0A 3M4YA 5HS4A 4GKAA 5A0TA 1IIRA 2R8XA 3ISJA 3QMMA 2A14A 3EY9A 1KJNA 1X7ZA 2ZT5A 1DP4A 5ANRB 4KUGA 3PNBA 1M7BA 2H59A 1YU9A 2G1AA 3EXEB 3IXQA 3WQSB 5CDSA 1LTQA 2D2VA 3AJ8A 1FW6A 4KE9A 4OLFA 1T9AA 3OLWA 2C7BA 3UFXA 4NL4H 5DXAA 3N6XA 4MVJF 2JFZA 2HB6A 3GRUA 1PT7A 1RXCA 1RZ3A 3TIXB 2WZLA 3DUFB 4CM4A 2H5JA 3GZNA 3IDAA 3CW2A 1EK0A 3QW0A 2VB6A 1VHDA 2B21A 2E4WA 1E96A 3R40A 3VZBA 1U8YA 3KAPA 4L3OA 1T36B 3B2NA 3WWDA 2PR2A 1F2UB 1O7JA 4DBZA 1UFOA 3HVHA 3AVYA 2Q50A 4ZU6X 1CR2A 3OCUA 3QQPA 4O59O 4IG4A 4FFWA 3EXG2 3RUFA 2E4AA 4NYJQ 4RVDA 2CVOA 5T3UA 2BBOA 5JXIA 1IY8A 1KK0A 4HDMB 4BLTA 1PYDA 4IR7A 4HK4A 2A94A 1ONSA 3MTJA 5CXQA 5K8TA 1KMQA 2IHZA 3UHOA 3FMPB 1ZUHA 2IELA 4XXHA 3AERA 4Z1MA 3E4CA 4NBTA 4R71A 3OOWA 3KFXA 2ONJA 2BE9A 2YHSA 2WYIA 4H3KB 3ROEA 1LSOA 1E9BA 2Q49A 2DLDA 2IZ6A 4LWZA 4L5YA 3Q2KA 4TMKA 1XD2B 3KQPA 4XSVA 3LUJA 4OM8A 1TJ5A 4PR3A 2W6CX 2BFWA 4DWWA 3KD2A 3KEOA 2FN3A 1WQ3A 3G8DA 3OEOA 1QG2A 4G0ZA 1LVUA 3G5UA 2R3SA 3NYWA 2K7FA 1HDRA 1A3CA 2ZSUA 3CEAA 3FOWA 4EGQA 3A4IA 3EPVA 5DI3B 5A0VA 1D2GA 4N3GA 4Z9FA 5GJVC 4REQB 4ENSA 1GFWA 4RETA 3KTFA 2OMKA 5A7GA 3Q3GE 1UPCA 2BC9A 4OFBA 1U65A 1AGRA 1P5HA 5HTOA 1VBNA 4QPDA 4JJAA 3V4LA 2J0WA 4HVCA 3ZZMA 4NXNB 1ZK3A 5EJFA 4G89A 1CULC 1ZA1A 3TGWA 3QU9A 1SRRA 1XLTC 3LO8A 2W42A 1SCBA 2NXCA 5BRNA 2D5AA 1L5QA 3GLFB 1JU9A 2X3YA 1NVAA 4PG7A 1T5TA 3SQWA 4O29A 3KQTA 4EG4A 3L8EA 1TYZA 1X80A 1UWLA 3BT7A 2YDXA 3D7SA 1JR3E 2HKVA 3WYAA 4JI4B 2AC7A 2WQZA 4F3YA 5EJMA 1E0KA 2ICWG 3A25A 4DA9A 2IOHA 1RADA 3WRYC 3B1YA 4A4DA 3UWKA 3JSXA 2XCQA 4PFOA 4XKJA 1G16A 3AT1A 4ISCA 1XLVA 2FKAA 2VN8A 1NJ2A 4Q9LA 2AYYA 3RBZA 5KAMA 1PZGA 1PDWA 4WBXC 4JI3B 1FP6A 1U1EA 1VE3A 1E2BA 3AI3A 1FTWA 4HPWA 3DTNA 4URUR 2HLHA 1RI1A 1G59A 5AOCA 4YXWA 4EG6A 1EI9A 4LOKA 1R6AA 3U4DA 1MNEA 2DSTA 1EESA 2RK3A 4ASUD 2H7YA 3KE8A 4TV8A 4AY2A 3PFIA 4FOOA 1GG9A 3I12A 3NC1C 4XLNF 4ANJA 4MVXA 3IQDB 1WUTA 1L9KA 1F48A 3DAFA 5AICA 5EC8A 4B4DA 4DJ5X 5K03A 2X0IA 4HJXA 5D1HA 5JPCA 1C0PA 2BI7A 1VSUA 1E58A 5EINA 3IT3A 1NBBA 3CKMA 3T3PB 2OV8A 3NKEA 1T2DA 4LSWA 4M8NE 1MBZA 1YDIA 2WD8A 4O02B 1UBJS 4HH4A 3T95A 4LSMA 3GVIA 3VPHA 3SHVA 5JFGA 2AVDA 2E37A 4GR4A 4N0DA 1I6MA 4JYAB 4E0IA 3G85A 4K9MA 2A2ZA 1Y5MA 4DBLC 3Q0EA 1ORSC 3LNMB 3SG0A 3PHHA 5JT4A 3CEJA 3HDHA 1GGMA 3OCXA 1Q7CA 3GPDG 1MZPA 4LE0A 5IY5C 1AQIA 3NHMA 2GPNA 2ZUVA 1ZHOA 2RARA 1J97A 3F67A 4IHKA 4KAXA 3V8MA 3IMGA 3P0IA 4G7HF 1J2EA 2YZ2A 3ZU2A 4CXMA 3AB8A 4RF4A 1G7RA 3AJDA 1LX6A 2X5XA 2HJ9A 3M33A 3AMVA 1M74A 1HDZA 4DLRA 3VU9A 5JCOC 4XLPF 1K7XB 3ISTA 2YR0A 2H3HA 1HFWA 4I6JA 2OCLA 4KNVA 2R1UA 1KTIA 1FQOA 1YKFA 3JD0A 1GYPA 3Q7TA 5F3RA 5H02A 4HG2A 2HEIA 3FZYA 1IZ7A 4E6EA 2GHRA 1XU7A 2VS1A 3D8TA 1FYWA 1FJ2A 4Q9NA 1SCUB 3CVXA 5TGDA 4NNJA 4QYIA 4RGYA 5IAEA 4DUGD 2GYVA 1FQWA 4NENB 4TYNA 2X23A 1IOVA 4YBZA 1ZRMA 4HQLA 4WA8A 4INJA 5BQ3A 1J0EA 2YRFA 1L4YA 1Z2PX 3ITEA 4X7PA 2I3BA 2JLBA 4I5GA 1FBTA 5I3CA 5DX1A 2P1AA 5KKAA 4YRLA 1QRTA 3DZJA 2QSJA 1O95A 3R1IA 2JLXA 2VUHB 2V7GA 2CEKA 2X51A 1JPUA 1SNYA 1JHOA 2QX4A 4YAJA 3TX2A 2KQ9A 1OJ7A 2HWKA 1Z82A 4BO2A 4XJTA 2X58A 3N0RA 1X1TA 2GB4A 4EGAA 4QQ8A 4PN7A 3UK1A 2WOJA 2Y66A 2PIDA 2CEAA 1ZRNA 2AJDA 1Q2UA 2OHFA 4GPD1 4WFQA 2LP4Y 4M7RA 1H9CA 2Z0MA 1ZIPA 1CFJA 3WOHA 3H11B 2F1JA 4L02A 2PX6A 4MS1A 4NV0A 3QLJA 1ZWKA 4HMPA 3OD5A 1B2LA 1GY8A 4LXHA 4DRXB 2ZANA 4WLUA 2G0TA 1YB6A 4EMSA 1P1KA 4YASA 5B1HA 2QD2A 1PF7E 3OEED 4WOPA 1EG2A 3BS4A 1TEHA 4RH3A 1ZR4A 1K4KA 2NO9A 3H2GA 3A4MA 3RRBA 1IM2A 2ACEA 4RY8A 3OM9A 4KC0A 3HCEA 1TEXA 4UNSA 1JHVA 2XE4A 5DISB 4QO8A 1D4AA 4V02A 2L6HA 3M4XA 1S2IA 1SPBS 5G4KA 5FPTA 4BGDA 3S0XA 4DEVA 3OVMA 4DCUA 3X2QC 2YOGA 2XRHA 3B0VC 5BYJA 2Q6KA 1CE8B 4KQ2A 3TUJC 1MOSA 3UBMA 5IM4F 1Z12A 2XEXA 4EPXA 5KNDA 2WB7A 5ES4B 4PJMA 4C3UA 2AL7A 2CBZA 4EYSA 2HIHA 4LTMA 4HWSA 2HZBA 3W04A 3QF4B 2BCEA 3NEPX 3NB0A 4ZVOA 4GC5A 4G81A 3NHPA 1Y4DE 2ISCA 1E9AA 2IA5A 4Q7QA 4EG1A 1CJCA 1Z47A 2JCBA 2PQ0A 1V3QE 3D5QA 3KOYA 1G55A 3H8WA 1JPNA 1QCCA 2JFBA 3LC7O 4KPUA 3H5VA 3O10A 1EM6A 3KZVA 4Q9IA 2ACVA 4UKDA 4C0WA 4LG1A 4X8HA 3ZZUA 2H5LA 3ZBUA 1G7TA 4B0OA 1THGA 3HA7A 3TW8A 5BY2A 3ZV3A 5F2OA 3UPDA 3X1ZA 3OIVA 3T1NA 2IU0A 2GZ1A 2V74B 5DX0A 2WJVA 3TYXA 2IP2A 3MINB 1LZLA 4PX2A 2R7TA 1QGYA 4X91A 3GMDA 3N2NA 2WKWA 3KEGA 3VAAA 4LK2A 2PWAA 3HPRA 2P9ZA 2W6QA 2PX4A 4XDGA 4LXTA 5FFNA 3AR9A 3EJWA 2CNKA 5FUVA 2FEOA 5LKAA 4OYRA 2H52A 2EW1A 2CHEA 5KOHA 4MRAA 3D6FA 4I1YA 2J6BA 4XWKA 2ZT7A 1MB3A 4FYXA 5BO5A 1EHCA 2W22A 4Q24A 4PACA 4PWZA 3RGWS 5IANA 3FNBA 3EHNA 3ZR4B 4I1PA 2FVYA 3ADOA 3THWB 3QYFA 1QYCA 3C8MA 1YR1A 3ZWAA 4JUCA 3WLQA 4Z4QA 4PGMA 3LUAA 1AB6A 2RHMA 7ABPA 3FHOA 3CRNA 3GN2A 1KIMA 3PYLA 1BBHA 5BXQC 1VL2A 4DDUA 3JWHA 1H93A 3ZHTA 3EPLA 4Y6PA 2NPOA 5DIZA 1CQIB 1WUIS 3AI2A 4ZGWA 1WOLA 4RD6A 1CRQA 2D1FA 1KWKA 4L51A 1L5HB 4G4SO 2DPYA 3TCKA 1TZBA 1CY4A 1K6MA 5GM1A 2XT0A 1X1RA 4LJYA 3WYNA 3GUUA 4CS7A 4QQFA 2JI4A 2HU2A 2ZI3A 1BOOA 1XEFA 1XU4A 1A50B 1RCUA 1EDOA 1A8UA 1L2TA 2BTEA 1CF9A 4PU0A 4F5YA 1LD3A 3ZEIA 1TUEA 3JTMA 2HC9A 3GEGA 3ADDA 1VE5A 5IJ0B 5IK2D 2Y4NA 3T9OA 3D1VA 4DRHB 1UQRA 4JZKA 4MVWA 2PRSA 1QUFA 1NF2A 1CWUA 1Q22A 4ZYLA 4YRIA 1E7RA 4NJMA 3AY3A 5IXYA 4NFHA 5DLDA 1POWA 2QNRA 2HBZA 4O8ZA 1MDFA 3G2NA 4N6OA 1EQ2A 2R7VA 2XZTA 4JI6B 4AD8A 2VK4A 2PO5A 3X1KA 2XA2A 1E9EA 3HP1A 2VJQA 2BGGA 4P9TA 3T0IA 1I2DA 4NTZA 2E4UA 2FWBA 3L4BA 2Q5OA 1OXKB 1NRXA 4BBZA 1SOVA 1ESMA 4JT2A 5IKMA 3PDCA 1BN7A 2OO7A 2C88A 3C7CB 2EBFX 5LLTA 3NBYC 5LWHA 4NATA 4M9XA 2J0UA 4KQXA 5F5XA 1H2BA 1JWBB 1K75A 5JZOA 3KB6A 4F8JA 1P2GA 3GZJA 1E1DA 2JZCA 3I32A 4P32A 1K5PA 4F2HA 3DNPA 3W05A 3B5EA 1WMSA 4K26A 3VPXA 1OTYA 3UJHA 1H2EA 2L2QA 3TTSA 1F20A 4TSRA 4JLUA 3A14A 3LBAA 2YYAA 1V74B 3Q6MA 2FRDA 1VLMA 2XLEA 5IAAA 4WI1A 1IBSA 3NVKI 1DDOA 1N7HA 2D0DA 2H85A 4II2A 3RJ9A 2CLIB 2ZTVA 2P0AA 1IOLA 2Y99A 2EGUA 3TOSA 1NBOA 2EL7A 3CMCO 5K3DA 1M56C 5EHXA 1KKMA 3EBOA 1JYSA 2I7TA 2QMZA 2ZU6A 3D4BA 4OHVA 4L6AA 1M75A 3VR2D 4B83A 1YUBA 5TQ0A 1M7GA 3PRJA 1J42A 4ZHQA 4X5OA 1VTKA 2NU8A 4OX9B 2ZUCA 1W36D 1Q6YA 1JR6A 1QAMA 3OZXA 2ZU0C 2QDXA 3U9LA 2IE0A 4TLBA 2RG1A 2ODPA 4P83A 3TKYA 3RS4A 1DBWA 3EQ6A 1N5JA 3VR6D 2K5UA 2VDUE 4HX5A 2JJ2D 3UH1A 3DWWA 1YZLA 1XTBA 3H2HA 4FE3A 4RSGA 2F48A 4PHTA 4H0CA 2H1CA 2WE7A 5LOVB 3IPRA 1W19A 3ZY4A 4E3ZA 1YDHA 1SBCA 4O8CA 4X6XA 2HUJA 1MDBA 4E5UA 3QXXA 5CH5A 1S5PA 1YZCA 4R1LA 1JXAA 4ITVA 5EHGA 1RXUA 5EUMA 4LY9A 2WZCA 3KH2A 1F17A 1VB3A 5E95A 3F1KA 1Z07A 5CD1A 2GLTA 3QSGA 3I9OA 2J8ZA 4DDHA 2JF0A 4LY3A 1UIMA 1UL1X 4QVKA 4L8LA 4CMKA 1L4GA 2QR3A 4CG3A 4GBMA 1RABA 2X77A 3ZD6A 1CGME 1SQGA 1RRGA 3IT1A 1SUPA 2CW0F 4XM1A 1PT6A 4JLAA 2B6HA 3VZDA 4M0UA 1BDJA 1T6YA 1B3BA 2HSEA 4AJ1A 4P84A 1UDBA 1FR0A 3OTWA 1ESNA 2APJA 4MUAA 2QMUA 3BH0A 2XLOA 3UB4A 4C88A 5KKCA 4CKCA 1E2XA 3QX8A 5ALZA 3D6HA 3SEZA 2MSNA 3D3JA 2AG1A 2GPYA 1E60A 6REQA 4QBKA 2Y1KA 2DXIA 3DXJF 3PUJA 2HUPA 3H9CA 3IMFA 2D3TA 5EMKA 4RVSA 3RK1A 2IYLD 4LEIA 2VHWA 2QG4A 4ZEXA 2X86A 3TBHA 1Q7EA 4M1WA 3CZCA 1OXTA 4UAGA 2J31A 1I3CA 4TLCA 1K5GA 5HRUA 5KQGA 1SBTA 1JRAA 2J67A 1GT6A 3B8HA 4KFCA 2IWRA 1ZUIA 4TL6A 3V2UA 3V1TC 1L7CA 4LKOA 3ST7A 3E9RA 1CCWA 4EHDA 5BV0A 5CURA 1ML4A 4FW9A 2P9HA 2FF7A 2OV2A 1AHIA 3NHLA 1N3YA 2Y3BA 2AHOA 2GKSA 1PYGA 3ZWPA 2PM8A 1NXVA 4YP5A 2OBBA 4DLAA 3UCFA 4LFAB 4XYLA 2WWGA 4CL0A 1CLEA 4DMGA 2GEKA 2IUYA 1G7SA 1Z6QA 2Q99A 1P4JA 3CBQA 2JI9A 4EZBA 5EE5B 2O9JA 1ADGA 1Y8AA 4CL2A 2QN7A 3F3SA 3VHXA 2A0UA 2ZTUA 3W1EA 1UBHS 2XGJA 4JUAA 1JN0A 1L3IA 2H51A 5BQHA 1FZQA 3AZQA 3PHLA 1YRQA 5AT1A 4D9EA 3QPAA 3FCAA 2HMUA 4F6CA 1VDZA 2PX5A 3K9FC 2GK3A 2DFKB 1EUCB 3D6MA 1K08A 4MJ7A 3TOMA 2WWTA 1E2DA 1DBPA 3RT7A 3QP9A 2JDIA 4FLEA 3A6ZA 4C7JA 4CR7A 1ZK4A 5DTRA 1GA4A 9MHTA 1Z3IX 1XQ6A 4YP0A 4HEHA 3V42A 4KOEC 3JASA 1Z13A 1QUEA 3PHBE 2HPAA 2HMYB 4R1QA 4P7BA 4OXIA 2WHXA 3QEAZ 3SQXA 1KNXA 3WGHA 4EFKA 4KO2S 3HXPA 1VBMA 2KLHA 3SS9X 4MV0A 4D92A 5HFJA 3VU1A 2O8CB 3G0CA 4MVZA 3SC3A 4V0OA 2WUVA 3ZE1B 4A92A 4DCOA 4GX5A 5BR7A 3LDAA 2YC2C 3B6KA 4E14A 4RFLA 4QU5A 2VXYA 1F2TB 2WA2A 2QWXA 1GR0A 5KVQA 4B73A 4L5AA 1X7XA 2QVZX 1LX7A 1A4XA 4LYEA 1P3Y1 2VR1A 4BMCA 3V4OA 4IYRA 2CXUA 2VKTA 2M64A 5JYCA 2NSLA 5CB0A 3K72B 5IJ9A 3THOA 2XSZA 4WVFA 4BVFA 1B26A 3HV0A 1DDGA 3GLKA 3OQIB 4W99A 4J07A 4N3BA 4CM1A 4ZXPA 3C85A 2HQSA 3E7DA 5IUKC 3RC8A 3JQ7B 2PQ2A 1KJQA 4P38A 1TI7A 1D1SA 3T99A 3S9OA 4JY7A 4O33A 1J23A 2PLRA 3ZW7A 2ZCJA 5JZBA 1CY7A 5I51A 3UMBA 3UT5A 1KDVA 1TAHA 2JGMA 2BP7A 4ZRDA 4J7XA 3LG2A 3UQZA 1CX9B 2JJ1A 1H4TA 3KLMX 1O6GA 4LJLA 2JVIA 3C3PA 5T4HA 4FK8A 3H5LA 4UMEA 3BK1A 1QVRA 2PVPA 4ZAYA 1U04A 2WUWE 1J20A 2HO4A 4ZYUA 2HV9A 5ALDA 3FRIA 2UYCA 4RS3A 4QRHA 2QP3A 3IUJA 4W5WA 5H8WA 5H9VA 5JNUA 3CCFA 1YXMA 3DBRA 4I4TA 4MQFB 5TT1A 3HTKC 5K3EA 4M98A 8OHMA 4EB3A 3RAPR 4NOKA 4R6XA 2C2WA 1SIWA 3TFOA 3SJCA 5K0SA 3K20A 1QTNA 1CB0A 4IXNA 3ICVA 5H80A 1XZDA 3ACBA 5KJEA 3AZPA 1KU6A 4RULA 1P5JA 4YS6A 3W7VA 1PNVA 4Y2GA 1T1IA 1WPRA 3E53A 2XUDA 3PMRA 1D8TA 1CEXA 5EQDA 3IXLA 4X9XA 1O0CA 4QXAA 3K9NA 3RBVA 2JD1A 4OQXA 2C5EA 4XEHA 3UNXA 1E2NA 2WLTA 4LVNA 4KQKA 2HPZA 5A6SB 3BGWA 3IMCA 3JQAB 4P3PA 3S2IA 1MB2A 5C1OA 1BW9B 2GILA 2NTEA 3LI2A 2CK3D 1K98A 4ICIA 4CR8A 2JLUA 4X1IB 3PTZA 2FWIA 4QOJA 1VL5A 4E32A 1NYLA 3UK6A 2J4FA 2C4HA 1QHEA 1T26A 2XUIA 2GM5A 5EGNA 3AF5A 3M6AA 3CO0S 3BTOA 2VAMA 5LVAA 4TS1A 1Y3HA 1OT3A 4GP9A 3D6AA 2JX0A 1F6BA 3FZNA 2XLCA 1ODKA 3ZYCA 5ENVA 1Q1AA 3T1VA 4A0QA 1GZ5A 4GNKA 3L0SA 2WJZB 3FFXA 4FFPA 5BOSB 4MMZB 4JLNA 4U2BA 5DLJA 2F3QA 5C3UA 3C3EA 1T8SA 5T4BA 1OAOC 2DERA 1NSTA 1RHMA 1SN7A 1Z16A 3KQWA 5FAKA 3BC1A 3FHDA 1FP2A 2C0PA 2ODAA 1QC5A 3RVMA 4KO1S 2R47A 2J5BA 5CCDA 4BGEA 1W46A 2WHQA 3DT9A 1M72A 4IINA 2GI4A 1FRVA 4A0FA 3NRHA 1EVKA 4BRZA 3RIMA 4DQUA 1EG7A 5ABPA 1F1JA 2O8NA 1XQWA 3DAYA 3BIXA 3AG5A 2WU0A 3O2NA 1DT3A 3ZK7A 1B0AA 1EVEA 1UFVA 3PGVA 4YAGA 3NM6B 2ZI4A 3HZOA 1NY5A 2C9OA 3CXUA 1IN6A 2LUOA 1ZZGA 4ARCA 5EN4A 3KOMA 2IY8A 1U5BA 2CJWB 3B53X 4E6PA 2XHZA 1WE2A 1RWMA 4PZZA 4EEXA 4CJOA 3RYIB 4N9QA 5LIRA 3P2MA 2L9JA 4DKJA 1N7IA 3PX7A 2LKCA 4D4MA 1YONA 4O6YA 2HYIC 4INPA 1EGVB 4OIMA 4L2IA 2W6ZA 2WZFA 3H1EA 5JR3A 2PG3A 1XTUA 2NTNA 1MA3A 4L72A 3D4LA 3A9UA 4B3JA 1T35A 2ADFA 2ZIEA 4MQLA 3RC9A 3N05A 1KVSA 2QRLA 5CT5A 4YRQA 5HJEA 2ZQ5A 1U4SA 4MVJM 3IV6A 4ZQFA 2Z58A 4UDXX 3F6BX 3AL0C 3C7KA 2A58A 2VCHA 3IC5A 1RD4A 1CQXA 821PA 3FB4A 4RSHA 4C7VA 5F28E 1RMTA 1YUMA 1P45A 3EFOA 2UZ0A 3GBPA 3ENKA 2BV3A 5KAPA 1VL1A 4D9HA 4OHKA 4CWAA 5I7SA 3EEBA 4UCXA 3L1JA 1ECCA 4TKZA 3DZGA 2B7BA 2VCCA 1HC7A 3NAGA 3L0BA 3B1FA 3R75A 4IHJA 3AHFA 4L85A 4RD1A 5JAZA 3VR5H 3ANXA 2WFAA 5LQNA 1TD9A 3PA6A 4W1RA 3GJXC 5JCZA 4BFWA 1PE0A 3QPWA 4JL5A 2UU9B 2NO0A 1AZWA 3HI6A 5AW5A 2FQYA 1GQQA 1SAYA 2C4MA 2ETSA 2VBFA 1TM1E 3MJ4A 4L8WB 2G88A 3KJIA 1A7VA 5EE3A 3GFQA 3P8ZA 4CG0A 3VVCA 3PCXA 1JAIA 4LRQA 1OWMA 3RE1A 3UW1A 4CFSA 2CCJA 4DCTA 3VSEA 4QPJC 1UH5A 1PL0A 3FRHA 1QP8A 1NASA 4BQQA 5G1PA 4AMGA 3AHCA 3EODA 3AJ9A 2PMBA 1MB9A 3JWEA 1QWOA 2VNHA 5T64A 4UVIA 5BR8B 4FM9A 5CJPA 2YWDA 4A27A 1T3TA 3AP2A 1J8FA 4M88A 4I4NA 4NTFA 4KIWA 5FO1A 2Z2IA 4U63A 4XUCA 3H86A 3HCBA 4JVNA 3GGOA 3ML1A 3MF4A 2A6PA 4HWTA 5DM0A 3FR7A 3T6JA 1DC4A 4YDRA 4M7OA 4EG3A 1RLMA 2ZXUA 3AIMA 2AN5A 1Y1SA 1UPUA 1DKNA 4MICA 3GJZA 1NU8A 4AX8A 1QOZA 2DFVA 3DVQX 1FCJA 3KSMA 5FBZA 2NXJA 5KJ6A 4GXTA 3EEFA 1TU3A 4I6EA 4FLFA 3AUUA 3B13B 4I1MA 3C6YA 4POAA 1UCFA 4PSUA 4QSMA 4N48A 1IZ9A 3U5SA 2AD1A 5TIIA 3ZJTA 4PFQA 4A4AA 4ARZA 3VYSB 2OCKA 4KHZA 2ORED 3D7LA 4XIFA 5K9ZA 3Q7SA 1MC5A 2BMDA 4PC2A 5D5HA 1GCOA 4UMFA 1W1IA 4IVNA 3IVAA 3PB3A 3CX6A 1NVGA 2IHNA 3T06B 4WK0B 1K88A 4MVUA 1RAIA 1XTPA 5L0HA 1W8DA 2BTQA 3VJLA 4UU7A 5TQ2A 2C4NA 4FN5A 2ZRAA 3U3MA 2WF7A 2YLGA 3F2VA 3MMXA 3PHJA 1YJ5A 2XZPA 3U81A 1A88A 2RAPA 3I2FA 4RVUA 3KQSA 1ZW3A 3IIEA 1I2AA 2H2WA 4FOSA 2C5AA 3HB5X 3RW9A 3MBKA 2LIPA 3HWRA 5L7WA 1QYRA 5HE9A 1NSGB 3F6EX 2IU4A 2C95A 1EP9A 4HXGA 4MMYB 3N2YA 1EVYA 3E8SA 4N47A 3OEHD 3G7UA 2RGNA 1U8XX 2IV2X 3PWSA 1E3TA 4HFJA 3OA0A 5GVRA 2GYUA 1PV1A 2D7CA 2DT8A 4Y6OA 4KXUA 2FPUA 1TW3A 4AN4A 2L7AA 3HDQA 1P73A 4OD5A 1X7WB 4IFIA 1YJAA 4G67A 2OT3B 4IUDS 2CKMA 1ZMXA 5HSWA 2OAQ1 4M87A 4G97A 2RGYA 3CNHA 4UBLA 3ZK8A 4RC9A 2QSYA 4YMTA 5K0NA 4OUDB 3ZE6A 1JLLA 5FOVA 5JI3E 3ABIA 2QLAA 2OE2A 3L7DA 3TZCA 3SMQA 2J7PD 1BGXT 5EZSA 3ZGOA 3TR0A 3CNBA 2XNJA 3ZWBA 5AP9A 4NMLA 4C4OA 1LVKA 2D59A 2GPBA 1MU0A 4NMHA 1WZIA 2R25B 3AEXA 3M2PA 2QTMA 4FD3A 4HN9A 2VWPA 1OH8A 1QCDA 5AYVA 4U9UA 4QTYA 4JYZA 2I80A 1O97C 4XGNA 2XHEA 2CHUA 4LA4A 3KYJA 5TMPA 2DM6A 3CLRC 3RSSA 4D0GA 2XOKA 5IG2A 2W7TA 1N34B 2QKYA 4WFIA 3QBDA 4YCDA 3QPVA 3HH8A 3MPOA 3NH9A 5ERXA 2P69A 1KP3A 2OV4A 2EX1A 3T4PA 4KVGA 2FYTA 1ESDA 2ZB7A 3SEAA 2DY0A 1PL6A 4J1NA 5TLSA 1R9MA 1PFVA 3I9KA 1X7ZB 4F4IA 3D31A 4W6ZA 5JH7A 1KK1A 3M83A 2P40A 3EOAI 1PIWA 3C3JA 4PAGA 4YT2A 4KVZA 5BSTA 2GTIA 3QU5A 5G0SA 1RYFA 1K63A 5AH0A 3QE9Y 3TOVA 3LSTA 3UFXB 1DV1A 4NYIR 4N6NA 3HABA 1MJGM 1GZ6A 4CM4B 2VSNA 3GZNB 1NRWA 1PJAA 2W2LA 1T9GS 3CRW1 4X66B 4XLTA 1GG8A 4QLBA 4GSYA 3H2IA 1M2WA 3GFRA 2G09A 4JVOA 2FFHA 5EKSA 5CTJA 3N74A 5JAQA 3ASUA 3K1YA 3N1UA 3ORRA 4NCIA 4BNUA 3O4FA 2JCXA 1XCPA 1NXOA 2H1RA 3HUUA 3IULA 4BCBA 1ESEA 1US8A 1WUHS 1VJDA 1KH3A 2R05A 1U2TA 3IKTA 3MS2A 1FXUA 1S05A 2VP3A 3GK3A 2VTDA 3GRZA 1RXSA 3AERB 4A9AA 5LYYA 2Y1EA 2D8MA 1E2QA 5I5EA 4Q02A 2HA2A 3IT0A 3TZBA 2BF7A 1B16A 1FDWA 1WXDA 5H9WA 1TA4A 4HRVA 2SKCA 4EA9A 2VUSA 4IO1A 1XXHA 3I9FA 1ADJA 3LP8A 3I58A 1PGQA 4MQEA 5C51B 1W7AA 1A7AA 4N18A 3VPBA 2IDMA 5ESRA 3DE3X 4MYRA 2Q9CA 1M3SA 4YRSA 3VF0A 3QYJA 4H0FA 3O8RA 3V4SA 3ISVA 4RIIA 5H83A 2PD3A 2O07A 3KSRA 3M15A 4MYSA 4EJSA 2A4MA 5B12A 3TX6A 1IBRA 4ZTUB 2TMKA 2WJ4A 1Z7YA 1LPEA 5TJHA 1F6WA 3U3DA 5E4TA 1YOVA 2FG5A 3TZLA 3D8SA 2Q4EA 3A9TA 4ZXFA 3W5BA 3K30A 1DIOB 1YLMA 3ZQYA 5FCLA 1MX1A 3C8HA 4RL6A 4JGIA 1KI6A 3FBGA 1O4VA 3CRVA 5FF9A 1T8WA 1Z2EA 2AN9A 1ORJA 2WSSD 2W58A 1KY2A 2IE8A 2JATA 3D6VA 1RC0A 2HJMA 1VIAA 2AW3A 1EGAA 1ZIOA 3ZI4A 4WASA 1F0YA 1RJWA 4BJTA 2PH5A 4A6EA 3BQMB 3AFIA 5EWJA 4BEWA 4NXMB 5EMNA 3FOPA 3AR3A 3SHFA 4JZYA 3Q40A 3CHYA 1OOEA 4X00A 3LNRA 2OG2A 2BJWA 3Q3HA 5F35A 3JV7A 3B5IA 3TSZA 1GCUA 3G0OA 2V5AA 3MXOA 3UXMA 2GEJA 2FZWA 4M6WA 3ND7A 2QTLA 2HA7A 1X80B 3BFXA 2GO7A 5BSVA 1YC5A 1I5OA 5CDGA 3I8OA 4BJ3A 2BGRA 1QH9A 2J9YB 5I4CA 1TTQB 1I10A 3I2KA 2X7JA 2O1WA 4NZPA 2XOEA 4YP6A 1TT7A 1TVCA 1X14A 2J08A 4H08A 1V25A 1AUVA 1YVPA 4ZOLF 1UG7A 4WTOA 5FQNA 2AI3A 2P61A 2D1YA 2WAMA 1PJTA 3LDGA 4FCCA 4KXFB 3U61B 4EY5A 1MX5A 4ARVA 3OAAA 5IT5A 1G0NA 3QMKA 4GRIA 4Q3OA 4H1TA 4M8KA 4B9EA 1P7ZA 2B2XA 3RU7A 5IABA 1WEKA 5A06A 4OLJA 1WMFA 3P9XA 4TV8B 4UCFA 4N6GA 3UV3A 2OBNA 2Z08A 2PH1A 4RMNA 5BOVA 3EDCA 5H5JA 5DM70 1YJXA 3GNSA 3EX7C 4MI1A 3URMA 2EPKX 5GJBA 1ORHA 1JB1A 1XYVA 2VZ8A 1VFNA 1ZM3A 4B46A 1UBUS 2O50A 5CPBA 2BT4A 1N75A 4FT4A 2H5IA 3V1LA 1ZIXA 3PHF2 4HDOB 1L5FA 4F84A 4DUPA 1SVLA 2ATIA 5DCYA 1ECGA 2J9BA 3DBHB 1MABA 3WLNA 3DKPA 1H23A 1Z0ZA 3T7JA 5AW0A 5J4KA 3LX5A 5IEJA 1U6JA 2PLWA 3OUUA 4K3UA 5FXMA 1NYQA 2F1RA 1R0CA 2PTGA 2X42A 4RTRA 3TLBA 3FLBA 1VPLA 4MVMA 4NEHB 5I4BA 2X4DA 5JPDA 1LB1B 1Y7LA 1USUA 3I2HA 7AT1A 2KPOA 3DHYA 3IEPA 4AECA 3HM9A 5HIJA 1KEZA 4RKEA 2D1RA 4II3A 3A6EA 4RY2A 3EH1A 3VU9B 1ZIDA 3HCFA 2MSCB 5SZJA 2VAXA 3WDKA 2GBFA 2A1IA 5BV8A 1RRKA 5FV4A 1L7EA 1DKOA 1ZCFA 2OFWA 4KWTA 2I2BA 1V9LA 5DVZA 1PLJA 4EHNA 3CB2A 3T41A 1F8FA 3DZ8A 1JSXA 2F2TA 2CLOB 5LR6A 1W47A 4RSRA 5JO0A 1KNYA 1JECA 2CXTA 1W93A 3A7DA 1F5SA 5U4XA 4Y6RA 4ZYWA 3IX7A 1SELA 1OW6A 1E1KA 1DBQA 2XGOA 4QYIB 8AT1A 3U9MA 1AO3A 1GPKA 1M54A 3DI5A 2P5SA 4MMXB 1LPNA 3NV7A 3F3MA 1FDTA 3UJ6A 1Y5NA 1CUXA 1D1CA 4GUDA 3LOQA 1ULUA 2EATA 3DONA 1S3IA 1RPZA 4CLEA 4AI6A 5DHPA 3IEMA 5BQGA 3OC0A 5J2UF 1C8VB 3MQ2A 3CA8A 5LIPA 2FSVC 3A27A 3DFUA 4AYWA 1DHRA 1R88A 2JA1A 2EQ5A 2JFWA 1RXYA 1RVV1 4BQSA 1P1RA 1JB9A 2FSIA 3X1YA 4OI1A 4KYIB 1AHPA 4PAOA 2R60A 3ZGNA 4FYWA 2E4VA 3TDMA 5A2GA 3L7AA 4CCYA 4MS1B 1YJBA 3LW8A 2RIPA 3TCNA 4JBHA 4UHJA 4YK5A 3VDNB 1LQTA 1QAQA 1ZJ4A 2PL3A 4PPNA 2J32A 3RK0A 3QHPA 3GRCA 4M1QA 2WF6A 3E7XA 4DVJA 4EVSA 3BILA 4HAYA 4XPXA 2ZJ4A 3OU7A 4B0PA 1SU8A 1NBHA 2VJOA 1QCZA 2G67A 2G9UA 4ZREA 5G4KB 4CHGA 3Q6IA 1QFXA 2NAFA 1ZXBA 5CB4F 3U49A 2J0VA 2QNIA 3QUTA 3U7JA 2HK9A 5F9FA 2HK7A 4BO6A 5HF9A 5HR5A 2PLAA 3FBWA 1A77A 4LF5B 2PY6A 4R05A 1OBOA 1AA6A 4U7HA 1NVVR 1ULBA 2I6GA 4M22A 3BTVA 4BO1A 4NZMA 4B74A 4D45A 2GKGA 2MHCA 1DAGA 1GNQA 2H1OA 1YJGA 3AJRA 5EP2A 1WD7A 1CIJA 1TQHA 2G76A 3PGMA 1BR4A 4CBVA 5F5HA 3EVAA 1RQGA 3NIWA 4KXQA 1SHUX 3LLSA 5FLYA 3PFGA 4HMQA 4BZZA 3DR5A 1PCXA 4LW8A 3DNFA 2PRYA 4KBYA 2HWXA 4FYMA 4IJ5A 2WT9A 4KPUB 2REBA 5EIBD 2Z56A 4LXYA 1C2YA 2OQIA 3PXDA 2GXSA 1RQNA 4U5HA 4GOOD 1RFLA 4K6HA 4HRAA 1U7PA 4RPHA 5DNYB 4ZGBA 5JS6A 5EXPA 1AQNA 4NG4A 1MO6A 4F3KA 1PK9A 3H5NA 4GMHA 4YCJA 3ETCA 1Q7GA 3TW8B 2IXOA 1LPAB 2WAYA 3COZA 3MMZA 5DHQA 3RIEA 2RAFA 3PX2A 3PIDA 5EQFA 4B3CA 3VJRA 3AUFA 4AF8A 1MRSA 1PHPA 3H3FA 3ZJUA 4H1UA 3QTBA 2ZYRA 2XB9A 2P5TB 2QE7D 4IP0A 4WJ0A 3IQZA 1MAWA 4EHLA 3LGSA 1L5RA 3I34X 1KQNA 1JEQA 4R5MA 2HT6A 4TXLA 3ZPXA 1FX1A 2ZJAA 4S1PA 2LPMA 2D00A 4G84A 5KOHB 3M1YA 4A36A 3BZWA 1VMIA 3PTLA 3KEQA 3EYWA 1QFSA 2O54A 1XJ5A 3JQFA 1Q1EA 2A0YA 1T2CA 4NP6A 1DVRA 1TECE 1XDSA 4UC0A 3W06A 2DKOA 3S1AA 1D2HA 3R7WA 4ERXA 2QG6A 3X3HA 5AM4A 4KP7A 4UDNA 2GZRA 3B1ZA 1TNDA 1E6WA 4KFTA 4XGQA 2EG5A 4B71A 4DIOA 4JAVC 2V26A 1D9ZA 2PRZA 2Y1LA 1XAIA 4Z3KA 2BGMA 4KSYA 9ABPA 2V5VA 2OAP1 4F12A 2YZGA 1H2YA 3VBEA 1Q17A 3EFHA 3WL8A 5L3RA 1DIAA 3NMIA 3MLAA 1E5DA 2OHXA 3BJMA 4EUKA 2GD6A 4FU0A 1KZ1A 3GRVA 3UA3A 3K92A 3WRXA 4EUNA 2IYPA 1UK9A 3U2LA 4QUHA 5I48A 2OCCC 5CM8B 3EG5A 3WGGA 4EFLA 4WY8A 1I7QB 4J0EA 1Z4OA 5JRZA 1YOBA 1ZH8A 5A5FA 2XWBF 2DEUA 1OMOA 1ZITA 3TUIC 2ZJ8A 1EU1A 1WB4A 3IIIA 3ZQUA 3NPMA 1F4VA 2A9PA 3FSJX 1E4YA 4PY2A 3IHKA 4ALJA 4LCJA 4XH9B 5J5AA 4IW3B 4NJMB 4RZHA 1THZA 3U48A 5KDOA 2ZJOA 2UVDA 3DZFA 1U2SA 1EDZA 2OL4A 3UBTA 3I5QA 1LUAA 1MCZA 4P4LA 1L7BA 3E8MA 5IAKA 1EIZA 5AKGA 4FGJA 1BE6A 2B0JA 4OSEA 1YCFA 3LT2A 1UT5A 2Z95A 4G9BA 3C6KA 1NNI1 2NXNA 1ZEMA 2XMRA 2P0NA 2GAIA 2QPTA 3W7AA 3R5TA 1DC3A 1XEXA 4P1ZA 4LECA 3J80A 3MWDB 2J3HA 3LBHA 2ODWA 7REQA 1LU9A 2IUFA 2WYUA 1TM2A 2J0UB 4A10A 3VO2A 3ZQ6A 2XGGA 1NONA 2PGAA 4RPJA 3UKJA 4QQRA 3PD1A 1FFCA 2VH5R 5KOJA 1QM5A 3WLKX 4LF6B 3W5IA 4MW8A 1X9IA 4NARA 1G9TA 3VKFA 2P6MA 2FQWA 1NQOA 5AW3A 2E3JA 2GCNA 1DI0A 4GPTA 4KQ9A 1GL6A 4EL0A 4AN0A 4YV7A 3ABOB 1UR5A 3NW9A 2KC3A 4BMXA 4QTUB 3OU2A 3W5VA 5BSHA 3GVXA 4M0PA 2IYOA 1V48A 3FPJA 4XAQA 4FOPA 4NF2A 4B35A 4D98A 2ZEJA 2JLYA 3F6SA 2DQKA 4XQEA 2CYDA 1HUQA 3ENQA 1RHQA 2P4HX 4H18A 3WGJA 4DV3B 2IYVA 5TQ0B 3NYIA 4V1CI 2XS1A 2DWCA 3WGKA 5JZMA 4D02A 5FKJA 4H2DA 4ZHQB 2NP6A 2FETA 2NU8B 5G2OA 2XLHA 1CW2B 2OB2A 3GEIA 3WI7A 4PLZA 3R0QA 4JB8A 5EQTA 4BGVA 4OSOA 3WB9A 5AXBA 2MSDB 2R5FA 5EUCA 2Z9CA 2O2ZA 5JFTA 3GMIA 3I9V6 3OM0A 3N59A 2V1XA 4R2XA 4W8HA 4ENVA 1I3KA 4ZDIA 1N8TA 5LZ4A 5DT2A 1FZTA 2EJBA 5DSTA 5C1DA 4KEAA 1O5IA 4DNFA 1OFGA 5DBHX 5TMDA 3L92A 1KOLA 2ZDHA 1OR8A 4YALA 3CZ9A 3HHPA 1VJRA 3VH1A 1S2NA 5IRCD 1MAAA 4NAUA 1Z0FA 2G25A 1KF0A 4RHFA 4UHEA 5HRCA 3BWYA 3CM0A 1G8AA 4BIIA 5A9TA 2GBGA 3TSCA 1WXXA 1WSWA 3DOCA 1P8AA 1WXHA 4U5GA 3S3TA 4K1LA 5DT9A 4FNOA 1DJNA 3B2EA 1SXPA 2Z2KA 3QXHA 1KVQA 4FMPA 2ASVA 2ZBEA 2CXXA 1EH5A 4BQEA 2NQ8A 4B7CA 2GXQA 3MRSA 1ZD5A 3CN9A 4YUXA 3TZ6A 1BDJB 4DRZA 1ZUNA 3EHEA 3A05A 4BX3A 1RAHA 4LRXA 1GNLA 3M6MD 5L4SA 2EKBA 2CWWA 3DGFC 3JSAA 2MMCA 2C7GA 4Y2XA 1HNNA 3VBCA 2J0EA 3PS9A 3IEIA 2AQHA 5K1ZA 4CKCB 3TM4A 1S02A 3THYA 3OZEA 1B1CA 3QKIA 3Q5EA 4RPLA 3KR1A 2F4VB 4EG8A 6REQB 1YZGA 5K8JB 2H06A 4W4TA 1E1NA 4WOCA 5EKTA 5CLIA 3DO5A 3O4IA 1Q5PA 1Z2NX 4HWPA 4YJGA 1KYXA 3MD9A 1CNFA 3A3NA 4PG8A 1CRLA 3L9WA 4G5RA 2JKZA 2X6RA 1SU4A 4LNUA 4MK4A 2EHJA 1G3IA 3TLCA 1YQDA 1EUYA 4AMZA 2JFYA 1J6UA 2R7UA 2FEWB 1ZJWA 2HF8A 2I99A 4ALNA 2UZIR 4X8LA 3FZGA 3KKEA 3RYFA 3VFDA 2VUUA 3MWJA 1A9XA 1Q16A 1WPQA 4DQLA 1U7DA 4C08A 5FZTA 4R81A 3EEOA 5J58A 1BJTA 5LN1A 1QP0A 4RCYA 5B1SA 1IYZA 3NR2A 5DPMA 1O95C 2RDMA 1J06A 3V7UA 1ZVJA 3K7DA 3FNQA 2REQB 3K9WA 1IHPA 4DMUB 1UDWA 3NVMB 5H70A 1IFXA 4BNKA 3I0NA 1ZM7A 2RHOA 4RM3A 4W1QA 1HPLA 1LI4A 2LDBA 5FBQB 1CQZA 2VQDA 2ZR0A 1XNJA 2UUHA 3NASA 1XXHE 4BFSA 4FC6A 5EMMA 3VHXB 1GPLA 5KPJA 4ZJYA 1ISSA 1Z22A 4FDAA 4LCBA 3H0KA 4TXJA 1BCSA 3LX8A 4YB8A 5I9NA 1YS4A 5KKNB 4J1TA 5AUNB 2OLKA 1E0SA 4R9SA 2PKCA 3CNNA 3PD0A 2ZQYA 2JIZA 2CSXA 4Z4FA 1K3UB 3GCWA 2W4BA 1C7QA 2YICA 1HE9A 3VNVA 3KKNA 1IEQA 4TKVA 4J2OA 2Z2JA 1CY2A 1PL7A 4BYGA 4QPPA 4TSFD 4YCSA 3N8GA 4P7KA 2QQ5A 5A69A 2HFKA 2QLMA 3JASB 2O3JA 2Z6UA 2GUWA 3HUDA 3H9JA 4FEEA 3ECSA 5DHTA 2BDTA 4QWWA 1IY9A 1V39A 4YMHA 3DLAA 1IUKA 3W4KA 3UAWA 4X6YA 3WTBA 5LP6A 1WY7A 1FUUA 1D2MA 3KETA 3PFKA 4P2GA 3NT5A 3MCAA 3C18A 2ZW9A 1UBOS 2RB4A 2UUIA 5IVKA 3I6MA 2O7QA 2QTBA 3W5CA 2JJMA 1IH8A 3PHGA 1JHUA 3L82B 5LQKA 4R7ZA 3ZTWA 4JH0A 3PKIA 4G0HA 4DJJA 1X7XB 1SCKA 2NWQA 3BWBA 4KK4A 3AOEA 4RO0A 3GJ6A 4HEQA 1IJFA 621PA 1MMAA 2X22A 3CLSC 2FMIA 1O03A 1I4LD 3ITKA 2Q7RA 5IJ9B 1HRDA 2OZPA 1L4FA 3ITNA 2YY5A 4U9HS 2OCGA 1KPHA 3PNOA 4IH4A 4KQMA 4IIGA 4Z0TA 3LKVA 3DOIA 4PX3A 1IN4A 1Z0KA 5TDHA 2H17A 2X76A 1L1QA 3EZ9A 4ND4A 2C61A 1I51A 3ZZNA 3B2QA 4CIAA 1PJLA 2O8DA 2VDQB 2OQRA 3UT5B 1A5TA 4BUCA 3CV3A 2HYDA 3DDNA 2ZI5A 4UBOA 2O3RA 2XNCA 2DGJA 4ZV9A 3PLNA 4WDRA 4LBWA 4J1QA 2OD9A 3HYTA 1HDOA 3OPQA 3GP5A 4HFNA 3I62A 4CM3A 1XZBA 2JL1A 5DHSA 4O4JA 1NMQA 3LQKA 5TPWB 3GFGA 1YE8A 2W2MA 5KVSA 1TQ8A 4MLPA 1OHHD 4G0WA 2GUGA 5DYIA 1L5KA 2QS9A 3VC7A 3NAZA 1NU6A 1QKIA 3SZRA 4A15A 3CWCA 3S7ZA 4CIVA 1W75A 1PZFA 1ZRSA 1Z56C 1CUJA 5JJBA 2ONCA 3DBRB 2O2IA 3GYBA 5B3JC 1NXTA 4DRIB 3JWIA 4I4TB 4JBXA 4PNHA 2ARKA 2Y1DA 1IMJA 4CQNA 2L69A 1N32B 3ER6A 2V7QD 4P33A 5BWOA 4X61A 2P2YA 4YY3B 1OBCA 1R0KA 3HI4A 3MTGA 3AONB 3H2ZA 3HO6A 3ECAA 3JQ6A 1E85A 3HCDA 1JLRA 3PNQA 4EHJA 1LFAA 4J6FA 2MYUA 4MP6A 4NCNA 3H1BA 2QBYA 2Z4SA 5AVKA 2EX4A 3PXGA 1TJNA 1KE2A 1S7GA 4OHMA 3I37X 1JDNA 2H63A 2O9XA 3EXHA 5EJIA 4ZVQA 5D87A 2FP3A 2N3ZA 4DC9A 5CVTA 3R4CA 1DHTA 1GL3A 3ADBA 4DJ9A 1VRCA 4OXNA 2YV2A 3SD7A 3CRRA 4YX9A 2IUUA 5HMLA 3FI9A 2NZVG 4AY3A 1TC1A 4E30A 2WJ3A 2Q5JA 5G4LA 4X1KA 1DINA 4XWAA 4EKEA 5DYYA 4YRRA 1DMRA 1GPAA 4FVTA 4MS4A 1W88A 2Y0PA 2QF7A 3FCEA 3GGGA 1P0MA 1DEOA 2YJZA 3MWEA 3PVSA 2BL2A 3IEEA 3QEJA 3KNZA 5DW3A 4DR5B 1HW2A 5ED0A 2WVGA 1DGQA 5FTKA 1KRXA 2JI6A 3L4BC 1O6ZA 4CM8A 4D4IA 2MDTA 2J5QA 1FP7A 1E2KA 2P1DA 4YRFA 3P32A 3T54A 1G5HA 3LUKA 1QC5B 2B8WA 4WE3A 4BP1A 5IEBA 5F3DA 4ENRA 4R83A 4XGIA 1UOOA 3RNLA 1FNSA 3GY0A 1FYXA 5KWVA 3SIRA 2GA9A 3ANNA 5JRAA 3DD1A 3G1WA 2CBXA 5IBQA 1LBIA 1JKXA 5AM3A 2HHLA 3NT4A 1YRYE 2VNSA 3A3OA 3T7AA 2E1PA 1XNQB 4R9NA 3PQCA 1WR8A 3FYSA 4MDFA 3WSWA 2W43A 2V6FA 3G7SA 3QVTA 2FRDC 3KOZA 3EISA 5DNUA 1P17A 1C1HA 2P7VA 4K1OA 1U5BB 3KJZA 1GGNA 1FNTc 5IZCA 4TTVA 2WKSA 3PQDA 2UXBB 1FFHA 1NPYA 4D9CA 5IDQA 2Y6VA 2FSPA 3HFGA 4L2IB 1ORTA 3SHTA 1SU6A 3B9RA 1W48A 1EP3B 1A2KC 1H2HA 4FB5A 4PFPA 1AGXA 1J00A 2OECA 3Q0TA 4WVLA 4LJAA 3PNVA 5AIBA 2XAUA 4Q7LA 5JD3A 3FUXA 2FZVA 1WVGA 3ICCA 2H4XA 5EP3A 1EBBA 2JGAA 1KBOA 4KYVA 2OCPA 4B2YA 3K8ZA 3O2QB 3AF3A 1R4MA 3I53A 4GUAA 4PR0A 1Z26A 4QAQA 3RFVA 3EFOB 4BNDA 2HGZA 1XOIA 1LI7A 3MELA 5EIFA 4UASA 1JFSA 3WZLA 4MTOA 3OZUA 3HBFA 5I4IA 3GA7A 3OQOA 3HA3A 2XZOA 2FMUA 3L05A 1BMQA 4IHJB 5B55A 2HMZA 3QOFA 1UP4A 2B1GA 1EXNA 4WXPA 5FUWA 3DE8A 4XJVA 5LQCA 4A6XA 1EFAA 4AZTA 4J0IA 4GI3A 5C53B 1Y9EA 5AESA 4LXGA