3SP1A

Crystal structure of cysteinyl-trna synthetase (cyss) from borrelia burgdorferi
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
469
structure length
418
Chain Sequence
b'MILKLYNTRTKDFSELTNFENVKVYACGPTVYNYAHIGNFRTYIFGDLLIKTLRFLGYKVNYAMNITDIGHLLTVYEISEFFTEAFFNDCRKLNIVYPDKVLVASKHIPIMIEVVKILEEKKITYFSNGNVYFDTSCFKSYGEMAGFKRNKTDFVLWFTNSKMKWDSPWGFGYPSWHLECAAMNLEYFKDALDIHLGGVDHIGVHHINEIAIAECFLNKKWCDVFVHGEFLIMDFITVKDLEDQNFSPLDFRYLCLTSHYRNQLKFSLDNLQASKIARENLINKLSYFYESLDPVDLNTLNKDLKNFGFSVEKEYYDSFVEKISFDLNVAQGLALLWEIIKSDNLSFVSKLRLAFIFDEIMSLNLREEILKNLQNHDVVIDENMKALIEERRIAKCEKNFKRADEIRDFFAKKGFVLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteinyl-tRNA synthetase
molecule tags Ligase
source organism Borrelia burgdorferi
publication title Ligand co-crystallization of aminoacyl-tRNA synthetases from infectious disease organisms.
pubmed doi rcsb
total genus 153
structure length 418
sequence length 469
chains with identical sequence B
ec nomenclature ec 6.1.1.16: Cysteine--tRNA ligase.
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01406 tRNA-synt_1e tRNA synthetases class I (C) catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1910 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3sp1A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3sp1A01
1Q77A 1A8HA 1EUQA 3COWA 3ND5A 4CT0A 3CLRD 3FI0A 4JFAA 1O5TA 3CLUC 2CSXA 2A88A 3NV7A 2AG6A 2QJFA 3SYTA 1ZH6A 2YWBA 3KT8A 5DEOA 2J5BA 1VL2A 5LFAA 2X1MA 1KKUA 1V47A 1QRSA 3KFLA 4ZCTA 5DK4A 1MBZA 5HG0A 3FY4A 3FNRA 1JIKA 2D13A 4MW2A 1N2BA 3L92A 1XNJA 1N2JA 2V0GA 4PY2A 1NZJA 1Q19A 4AQ7A 3ZJTA 1PFWA 1V8FA 3UK2A 1NP7A 1ZUNA 4MWBA 1EFVA 4MVWA 2CYBA 1IFXA 3X1KA 2B7LA 4NATA 1TYBE 1CT9A 2C5SA 3FWKA 4MWCA 1F7VA 3ZJUA 2DETA 1H3NA 4MUGA 2HMAA 1OD6A 1O97D 3A05A 1EFPA 1TQ8A 2E0IA 1VBKA 2NZ2A 1G59A 1O96B 5HUHA 2V0CA 3PNYA 4NZPA 4NDAA 1XNHA 4MW1A 1IQ0A 4MVYA 5KWVA 3S3TA 1JMVA 3C8ZA 1GN8A 3A04A 3KT6A 4EG4A 2CV2A 4YMIA 3IVGA 4DDMA 3KT0A 2D5BA 4OUDA 4EG3A 1MAUA 4DE5A 4EG7A 1N78A 1DNPA 3FH0A 1N2EA 2IJGX 1K4MA 3P0IA 3NBKA 5TEVA 1NUUA 2ZP1A 3INNA 1N2IA 1SURA 2G36A 2PZBA 5FO1A 2QJOA 1JGTA 1COZA 3IODA 1N77A 1EUYA 1WY5A 1GPMA 4F4HA 4CDMA 4L2IB 3IVCA 3AG6A 3ELBA 2VTBA 1U3CA 2Z09A 3GUZA 3OP1A 3IMEA 3PXUA 4MW6A 1T9GS 3TNJA 3MUEA 2Z08A 3RBAA 1H3EA 1R6XA 2OQ2A 3CLTC 1HYBA 2PZAA 1B6TA 3H9BA 4MW5A 4JZYA 3AL0C 4I6GA 1EFVB 1MAWA 4ARIA 2VXOA 1WXFA 4P2BA 1OWMA 3FG9A 3RHSA 2PXHA 5JBNA 3H97A 5AHWA 1MJHA 1TEZA 2YXNA 1PFUA 1P7PA 1G8GA 3BL5A 1F4LA 4K0RA 4OJMX 3HL4A 4ZCRA 2A4MA 4EG1A 3IVXA 3H99A 3HGMA 2WB2A 3Q10A 3H05A 1O94C 1WOYA 3A4IA 4F3RA 3OTWA 1J20A 4JYZA 1RQGA 3HFJA 3U1VA 2CFOA 1XNGA 1JZQA 2DUMA 1JZSA 1O94D 3HV0A 3IOCA 1OWNA 4G5FA 1J1UA 1IQUA 2E18A 1KH2A 3ILVA 4ARCA 1O6BA 3SP1A 3IOEA 4HJRA 1I6KA 2Z3VA 3P0HA 4KPUB 4YP7A 3UOWA 2BTEA 1VLHA 1WXEA 2QJTA 3CA8A 3IH5A 3PNVA 1R6TA 2J07A 4MW9A 2WQ7A 3ZJVA 4J75A 1PFVA 1KR2A 1JEEA 2J08A 5TEWA 3COVA 1BS2A 1GLNA 1MOPA 2GM3A 2WQ6A 2DXIA 3LCJA 4Q93A 1N2HA 2CUZA 1JILA 1YIAA 3COZA 4NAUA 4KR9A 1VBNA 4MW4A 3TQOA 1EFPB 4QBTA 2X1LA 4MLPA 4I6EA 4R2LA 2QTMA 3IUBA 4K03A 4YBRA 3TS1A 2O5RA 3P0JA 3Q12A 3FIUA 1FFYA 1JEDA 1IHOA 3QE4A 3FETA 4MUEA 1UFVA 4JXXA 2YY5A 1KORA 2WSIA 3AKZA 3CLRC 4A91A 3SZ3A 1GAXA 4DLPA 4MWEA 3MMXA 4MUIA 4EFKA 1M8JA 2DLCX 4MW7A 1H1TA 2RD2A 3HZRA 1JIJA 3AFHA 4CDNA 2J09A 1MB2A 2XRZA 3ISJA 4KR6A 4HPWA 3RK1A 3SEQA 1OBHA 2IELA 3UY4A 1NUSA 2DPLA 1MB9A 1KQNA 2A1TR 3VRHA 4G5YA 5EKDA 1J09A 3L93A 3HMQA 1F9AA 2A1TS 3PNBA 1WZ2A 1WKBA 1IQRA 1N2OA 1U7DA 2PFSA 4MUHA 1GTSA 1WXIA 4U7JA 3ZXIA 5HUJA 3FOCA 3CVXA 1NUPA 4BWVA 3G6KA 3SZGA 3ZUGA 1EJ2A 2QUIA 3F3MA 3RK0A 2HZ7A 4MQ6A 5KHAA 4ZT4A 2XRYA 4Q16A 1PG2A 2EJCA 1EXDA 1PFYA 2JANA 3CVVA 1F7UA 5IJXA 4ND7A 1M8PA 1IRXA 1NI5A 4NX2A 3CVYA 2E21A 4JXZA 1D2RA 1KAQA 3JXEA 3KT3A 2PIDA 4MVCA 5BNZA 2QUHA 3N8HA 2BYTA 4DDKA 2OV4A 4MUKA 3GMIA 5LLTA 1QQTA 3MLBA 2ZUEA 3MLAA 4QRDA 2YWCA 3M5WA 1QU2A 2A1UA 1JHDA 3N2YA 4MUNA 4YP6A 2CYAA 4ZCQA 5DB4A 3RJZA 4AS1A 1M8GA 3CLSD 1O95D 2O8VA 4MWDA 3TQIA 1K97A 2J4DA 3E27A 3IMGA 5H16A 1MC1A 4L2IA 2EL7A 1N1DA 2H29A 4RUKA 1KQPA 3LOQA 2GKSA 3MXTA 3DO8A 4RPIA 4ZCSA 1O95C 3CLSC 1M8KA 2CV1A 4YP5A 1U0BB 4EGAA 5KCMA 1TYCA 2X0KA 4KPUA 1Q15A 4R2MA 1WQ3A 3P52A 3DV2A 3ZXSA 4MW0A 4E1AA 1QTQA 1QRTA 3N05A 3PRHA 2TS1A 3IMCA 1WXHA 1OBCA 1O0CA 4U63A 1ZH0A 4FZJA 1NSYA 2IP1A 1U7XA 5DASA 1GZUA 4ND6A 4KR7A 1N3LA 4ZT6A 2NSYA 3CVWA 1TYDE 1YUMA 4ZT7A 3AG5A 1J70A 2CYCA 2CV0A 3CR8A 4UZFA 1YUNA 3SDBA 1KH1A 2QUJA 1T9GR 4EF6A 5LM3A 3NBAA 1OWPA 1Q11A 3IDFA 5FO0A 4MULA 4MUJA 5IHXA 1T6YA 4MUFA 3TZEA 3QTBA 4ZT2A 1YI8A 1QRUA 1NUTA 1LI5A 4QREA 1M83A 1WJGA 1N75A 3UC5A 1MRZA 1K4KA 4PBRA 5TS2A 4MVXA 2RE8A 3FDXA 3AIIA 4WSOA 4I6JA 1KAMA 1QU3A 1GTRA 3DLAA 4KKVA 1YIDA 2GOYA 1IH8A 2H2AA 4XFDA 4EG5A 1N2GA 1I2DA 1KP2A 4G6ZA 4UZEA 4GRIA 3COYA 1J21A 4H3SA 3CLTD 1T6ZA 3X1MA 3DPIA 2AKEA 2QUKA 1EE1A 1FYDA 2PZ8A 4HJXA 3ZIUA 2DEUA 3VGJA 5K0SA 2VTBB 2AZXA 4DDHA 3TZLA 3LE8A 4EG8A 4EG6A 2HGZA 3CVUA 3N9IA 5J58A 1VBMA 1JIIA 4ZT5A 1NYLA 4TS1A 4R0NA 2JA2A 2DERA 1TFUA 5F23A 3RFFA 1KH3A 2QTNA 5J5AA 1OWOA 2A7XA 1TYAE 5J59A 2ZUFA 1QJCA 1K92A 2D54A 3K9WA 1X6VA 4OUDB 1H3FA 5H7XA 3SEZA 1KP3A 1G8FA 4XSVA 5TGTA 1LW7A 1R6UA 4CQNA 3ZGZA 4GU5A 1PG0A 1NUQA 3K32A 1I6LA 4ZT3A 4PBSA 1QNFA 3I05A 1O96A 1YULA 1ZJWA 1KQOA 3G59A 1ULHA 2I1LA 1ILEA 4S1OA 1O97C 2A86A 3UMVA 1IVSA 2A1UB 3Q4GA 3IUEA 5K0TA 3FHJA 2DR2A 1X8XA 1J1ZA 4DNXA 2QTRA 3VU8A 4MAFA 4XFJA 1M8FA 3A2KA 3ND6A 1G8HA 4U8HA 2E89A 1M1ZA 2JAXA 1WQ4A 2A84A 4NAHA 4WNYA 1S4MA 1T6XA 4DJAA 1O0BA 1OWLA 3D6UA 1U3DA 1WXGA 1Y42X 1XJQA 3GLVA 2R5WA 1JECA 1LI7A 4J76A 1I6MA 4HK4A 3QTTA 3G5AA 1NURA 3X1JA 3IOBA 5FNZA 4PBTA 3ND7A 2PG3A 3D6VA 4X0EA 3H9CA 4ZCPA 2CT8A 3CLUD 2X3FA
chains in the Genus database with same CATH superfamily
4DIUA 4HQRA 4P3NA 5JCOC 1PGQA 2X2OA 5JAHA 1T0UA 4KO1S 4KJZA 5EMJA 4PPNA 4OP2A 3MYIA 1QV9A 1XDBA 4P4LA 1OI2A 1QLWA 2Q6OA 1R0RE 2BH9A 3SXYA 3SYTA 2Y68A 4RY2A 3F1LA 5DS4A 5BSHA 2VCCA 1Y8RB 1A7AA 3ELDA 3OSUA 3PZRA 1HR0B 4ZKEA 1G6KA 2RARA 3GHYA 5BQ3A 5HKAA 2F9MA 3IURA 5CA0A 2VYND 2WMDA 3V4ZA 2QE6A 3A4MA 4ZCTA 2HB6A 2VCAA 1KFKB 1QGAA 1XLVA 2PMBA 2QXUA 1J22A 4RWZA 4TYMA 2WNSA 5CB4B 3L49A 3LL4A 4C6TB 1JG4A 1JHVA 1OU4A 2O2IA 2W37A 4RY9A 3Q0IA 5HF6A 4CM4B 1E4EB 3V3TA 2ZT6A 1PJ2A 2OZKA 3G89A 1FFSA 3L05A 3E8XA 3QNWA 2P68A 1W25A 2W2QA 1HDCA 2ZZKA 2YHAA 3H1AA 3P2KA 5SY9A 3WIOA 1F60A 1TC2A 1XK6A 3WGHA 4FBMA 1NP7A 1XDUA 3H9GA 3MSXA 4DSUA 1NQVA 2AC7A 1UC5B 4LMAA 4CODB 3CKMA 3OA0A 1VE3A 3K70B 5JALA 3FKSD 2O8CB 2RHCA 2CBXA 1ACLA 1YDGA 4OXRA 5LSAA 1TYBE 3QFCA 5HS6A 4O25A 1E99A 1Z0IA 2PBFA 5K2MA 3WI7A 2UXCB 2BLNA 3D0RA 2FDXA 5AVWA 5JCPA 2CGEA 3U2LA 1W47A 1E9EA 1Y5LA 2IYOA 1N3BA 4NENB 3GORA 4OP1A 3LLKA 2QB5A 3E0XA 2UAGA 3PYMA 1YFLA 3IE2A 3AETA 4MR7A 1QPBA 1RFGE 1RQXA 2EPKX 3MXOA 1JXAA 1OC2A 2XM4A 2I2BA 5HSGA 3BZBA 4F7WA 1QH1A 2VSYA 3W3AA 4KWHA 1P91A 1VK5A 2HLDD 1JG1A 4UHJA 5TVKA 4Q7CA 1ZIYA 3J7TA 2Y1OA 3LRPA 4XLZA 5TB5A 4D9JA 4ZMBA 5DCWA 1K1EA 2BFEA 1RMYA 2PMFA 4EG7A 3FH0A 5TPWA 5HUHA 1AKEA 2QUPA 2X40A 3HBNA 3GIWA 1J1IA 1K4MA 4MSUA 4BPRA 5LOVB 1BU5A 1UBTS 5TEVA 3G0HA 3IO5A 2ZXRA 2WSLA 3FAKA 1YOVB 3D7RA 1SURA 4IILA 2CZQA 4WY2A 1JG7A 1ORJA 4IOJA 1JQLB 1TNDA 4BO4A 2D5RB 1S6YA 3P5SA 4GVXA 1HFEL 1T8PA 1MB4A 3AOEC 1Y7HA 3GX1A 2J3QA 1EUYA 3PFIA 4C3DA 3RE1A 3MTDA 4F97A 1L3BA 2YUTA 2XGMA 2R7UA 1DKMA 2VXCA 5BXYA 5CP8A 3KETA 2PH7A 5FA6A 4MYRA 3W5SA 2ADFA 4GUAA 1XRMA 2VQSA 3WSVA 3UJBA 1U3CA 2R1TB 3L07A 1VSBA 3C87A 2F6RA 2CXUA 1OV6A 1DUVG 2OE2A 1IBKB 3RC8A 3I4UA 3AQIA 1CUYA 3ZKAA 3ZWBA 2FUG6 5LN1A 1M2HA 3OPMA 2HJSA 1NZEA 3KH2A 1QZZA 1PN3A 2YC4C 5JZBA 1NVWQ 2GK3A 3FZQA 3MPUA 5ITSA 4RESA 5I7FA 3AL0C 3IYLW 2Q3FA 2VHCA 4F4IA 1UK7A 1U9YA 2L2QA 4Q1AA 1B41A 2V7WA 2BJVA 1ZUNB 3UWKA 1ND5A 1YB4A 2CDAA 4TWAA 2FSSA 2IBMA 2VR1A 3DD5A 1II9A 2PUAA 3PLRA 1H7IA 1E8NA 1FMLA 3PUJA 4LTDA 4DLSA 1M2JA 5HXAA 2P7VA 1IY8A 1ZSVA 4R1PA 5AI6A 3D3WA 1PZFA 2I65A 4I1IA 3KQVA 2CMKA 2FLVA 3MWDB 4PG6A 3BL5A 1R0BA 2IC5A 2WBLC 3KKZA 4WWHA 5F2EA 1MJ5A 2Z8YA 3W5UA 3Q85A 3WX0A 4QI2A 2H7OA 2HD4A 3NBZC 4PC6A 3RRZA 2IPOA 3TZKA 2ZS7A 4BBAA 4GE0A 3DOIA 4OIOF 1OIXA 3OEYA 4POOA 1L7RA 3SYLA 2NACA 3QX8A 3AKYA 2OAQ1 2W2PA 1O9BA 4C0JA 1CZLA 1GCGA 3CS3A 4B3DA 1PSZA 4Z54A 4BLWA 4IWNA 4ZHSA 2IU4A 3CY6A 3VR6D 1MP0A 3KZNA 3WKBA 4DV5B 1HNNA 4ANFA 5BWMA 3DE2X 1N9ZA 2ZKIA 5LMNB 4I8IA 4D26A 3FCUB 4WY8A 3U1VA 3ZDYB 5CFQA 3R09A 1YR6A 3C70A 2H0QA 4ZOLA 3Q7QA 4CM8A 1E9BA 1KYWA 1OC4A 2XQFA 1EK5A 1Y9JA 2YL2A 1H22A 1O6ZA 3GVIA 4MNTA 4N12A 3BAFA 1FS6A 3S44A 1KH2A 1K9SA 1W5EA 4L5JA 2XMDA 1LJUA 1P17A 3ZWYA 5IWAB 3BE6A 1WLYA 3RVJA 1I6KA 1PJAA 3N7UA 1I6WA 1XXHB 1NX9A 3IMFA 2PKXA 3LPAA 4IHQA 3FPKA 4LRTB 4UZSA 2J6BA 3ZS9A 4BGVA 5BP7A 1QANA 2AC2A 3B9QA 2XVXA 1KEEB 2G0AA 4RMNA 3RC9A 5KX5A 1FXWF 3DTYA 1L5RA 4PYOA 1TM1E 2HPHA 5D7NA 3ETJA 4F4UA 4MRNA 3HZHA 4RGYA 1YVEI 2J08A 5TEWA 3H42B 1RS0A 2W6JD 3M9WA 1MOPA 1J00A 2AOXA 4RIIA 3V8PA 4CU2A 3EQ6A 2NZVG 3OQOA 2FRVA 3F71A 1VFNA 1JILA 2R7NA 1C81A 2PD3A 3IAM6 3TRKA 2Q49A 2XMZA 2OAP1 4S1VA 5BSVA 5KBYA 5IBPA 1PX0A 2D2IA 1II8A 5TE9A 4U7FA 3KALA 2X41A 1DJLA 1M1YA 3OWHA 3QG1A 4CLEA 3H17A 2JLBA 4M8IA 4LBVA 2GESA 4RNCA 4FR2A 3P96A 2VCHA 4J3NA 1KMQA 3DJFA 1RBYA 4PGHA 4PRKA 2GZHA 3BXFA 1G9XA 4C7KA 3RSHA 3K8ZA 3EIUA 2I9KA 3FUWA 4EABA 2XLDA 3OJOA 1Z45A 2HBYA 2HKIA 5KYXA 1C1HA 4IKOA 4P86A 3ZGXA 1H0RA 4WOCA 4BFXA 5A1TA 1QVWA 3AR5A 3IUYA 3LXRA 1FTSA 1I4LD 1ZJ6A 4P3KA 5GJBA 3K09A 3Q7SA 1T6NA 2VHTA 3SJZA 2B99A 1T29A 1EJ6A 3EFOA 1H8HD 2WY2D 4ZAFA 2WSSD 4UE2A 3PFKA 4E5YA 2DLCX 3EXIA 2PUBA 2G8LA 1Y8QB 2IXNA 2XEDA 1NWHA 3KBBA 3PFFA 2A5LA 2R86A 1AV7A 1ESCA 4PHHA 2NXWA 3QUBA 3EN0A 3CH7A 4NOMA 5CTAA 4CV3A 3V2HA 1GT6A 3ZU5A 4GNKA 2A6PA 5DM70 2BRUC 4TMKA 1P4AA 3CN9A 3JARB 5JXIA 3FNBA 1RM5A 2XECA 2EAUA 1F8UA 3D02A 2CLCX 3QUCA 4PINA 3KJGA 4JIMA 5EKDA 1B0AA 5DN6D 3L93A 3OBBA 3NTXA 5CNIA 2OJQA 2ZXEA 2HHJA 1WIWA 2ZBGA 4DLNA 4E3WA 1Y1KE 3H0EA 2B37A 5E8RA 1IQRA 1N2OA 4MUHA 1GTSA 1H4VB 1X1SA 2C88A 4HWOA 1IUPA 4GR4A 1PJ3A 3E9RA 2O3UA 3EASA 3JVIA 2LVBA 5FR2A 1L5NA 4GZ5A 4ESEA 2V7GA 5FTWA 4DMLA 3ZUGA 3TGWA 4AWBA 1T2CA 4KE9A 1QCDA 3GGDA 3KQQA 4DRZA 3P0RA 2VSQA 3SFVA 1UKVY 5DWDA 1L4BA 1T4GA 2ZE8A 2VP5A 4QRHA 5HCIA 4DEXA 2XVMA 3JYPA 3W2WA 2DC1A 4OGLA 4I9FA 4QFCA 4BQNA 2GEJA 3N5KA 4DXDA 1ZCJA 4A36A 2XCSB 2ZIUB 4QARA 4N7JA 4BLTA 1J7JA 1L4KA 4YUXA 4TT3D 4JXZA 1ENOA 5K3FB 3PJFA 3JXEA 3WGQA 2WT8A 2VDNB 5JE8A 3LWBA 5BNZA 1AF4A 1QYDA 5AM1A 2LIGA 5JOQA 1S2GA 1TT5B 2FPGB 4WNAA 2GYUA 1JXQA 4U9EA 3RVYA 2QRKA 3PFHA 4R6XA 2BGTA 2BZGA 2QMYA 1A7UA 2FUCA 1V39A 2LDXA 2ST1A 1PDOA 1UEJA 3HCCA 3M5WA 1OIWA 3H5TA 3KQPA 4OMFG 3GV0A 4Q7QA 5EJ4A 3DBVO 1QU2A 2R1VB 1W0KA 2H0RA 5DI3B 1PQYA 4NG4A 3WLIA 1EKXA 4XPYA 4FE3A 4P7BA 2NUAA 4RZIA 2QD3A 3G5UA 3JQDA 4ITVA 1ABFA 4JMLA 4NOJA 3DP9A 4QU0A 1KDYA 1XLUA 2YS7A 4GKAA 3U8VA 3QMVA 5TF0A 3I5PA 4F93B 3NHMA 1J2JA 3S2ZA 4J4TA 4G56A 1BMTA 1AUOA 4DWOA 4N54A 3T5DA 3GI1A 5ITZB 1Q2UA 4AJ1A 2I8LA 2W2KA 3OFSA 4GDMA 4TKLA 4GPEA 1HE4A 1Z7WA 2GYYA 4IZHA 2WMOB 3DFIA 2DWPA 2I3AA 4EB8A 4RPIA 4DOZA 4XUGB 4YUYA 1OYYA 1IN6A 1WD7A 3Q72A 1XZEA 5DMXA 4C0HA 4JWKA 4TMXA 1XTVA 2DOKA 1FUYB 3M9XA 4CKEB 4AYXA 4JU9A 3HKKA 4ZI7B 5L7YA 2FZVA 4EA7A 2H65A 3ZXSA 1W2WB 2Z2ZA 4XIGS 4EVIA 3KQHA 4QRIA 1BD4A 4D8XA 3NVKI 2JHAA 2ZYTX 3FLMA 2VDVE 4G0WA 4J8PA 1INLA 3OESA 3QUTA 5DASA 3R7NA 4NABA 4B3HA 2CVHA 4EARA 2V4ZA 1UM9B 2JPUA 5AM2A 3B89A 4KUGA 3ST7A 4A1OA 4Z49A 1E2HA 4L6CA 4A2QA 5B36A 4EKNB 4E2YA 3FPFA 1O6GA 2HPAA 3ZE2B 1G60A 4M37A 4MV7A 3EVDA 5JSZB 4QYXA 3HM2A 2PMDA 2ZIVB 2QUJA 3D5EA 4FNAA 4MKGA 4P7KA 4WJ0A 3A1WA 3WZLA 4EF6A 3OPQA 2HV7A 4G86A 4MULA 4WADA 5BN4B 2OZPA 2UYOA 1BTOA 1EXVA 3HFRA 4MRAA 1LS1A 2PCLA 5JXJA 1FSFA 2O2HA 1RAFA 2BOVA 4OHFA 1N6OA 1YNOA 1G17A 1NXTA 2EG5A 1USKA 2KX7A 2CNBA 3FSGA 3Q9NA 4YUVA 1PJLA 3JZDA 4G2TA 1E9AA 4D9KA 4WSOA 4YALA 3PUKA 3IUNA 3VYVA 2AVDA 2P40A 1G21B 4DCMA 3R75A 3TLKA 2R65A 2NQ8A 2KI5A 3U4HA 4A8PA 3FSJX 1VCIA 3IJPA 4BNJA 1FUEA 3OCWA 3PZBA 1AO0A 1Z36A 4UQOA 4BO6A 4EG5A 4BGUA 3CX3A 4DG9A 2PQ2A 3LCCA 4CKZA 2FN4A 1V16A 3COYA 3CLTD 4TS3A 5IZCA 2O07A 3ENKA 1KEPA 1G8JA 2WFLA 3GVHA 4MCIA 1J0AA 5SY4A 3MK31 3GBSA 4H4DA 4WJZA 4WN9A 5C34B 5CDSA 1L7MA 1W59A 3PJDA 3A1VA 1FMVA 4I4NA 3PNKA 1OR8A 4ZC1A 6NULA 4DUGA 1LK7A 2GH1A 1SKQA 1K3FA 3FPGA 1DZ3A 1QO9A 4PG8A 4FHGA 3V5XA 2Q27A 4PYKA 2O1XA 1OLOA 2HRRA 3A6KA 2K6GA 4IM7A 4KQFA 4LI0A 2B6NA 5IMSA 1V11B 5CDYA 1VBMA 3E3MA 5FL3A 3RAGA 1X1QA 4QBHA 4HFFB 3EZIA 1RJWA 3RGWS 3U4GA 1APCA 1M2VA 2E7ZA 4H3VA 2GT1A 5D1NA 2IEIA 2NAPA 1K8RA 1TMYA 4AWXA 3K2BA 4CHGA 4KFUA 2AD1A 1N9GB 1QM5A 2AJ8A 2BE7A 3E7FA 4WESA 3E2MA 1Z88A 2NO0A 4YDHB 1P75A 2WUVA 1YONA 1JQAA 3L7YA 3MGAA 4ECEA 2W4BA 4C7BA 1KP3A 4LKRA 3AFIA 3TR0A 3ZHOA 5A4JA 2XKJE 4B3MB 4KXUA 4KQMA 4UVEA 3GWLA 1LW7A 1ULZA 4MLZA 5CNKA 4CQNA 2D5AA 1HMPA 2FR8C 2OL4A 1RRVA 5B2EA 4MVJE 1IM2A 2HTEA 1IHUA 4LZAA 4M1SA 3QU2A 4Q9HA 4BNDB 4Y67A 2REXB 4FWBA 3H65A 1QSGA 1Q0LA 2A9KA 1S8OA 1ZJWA 1TIBA 1H6CA 4UHBA 1VP9A 4ZARA 2C94A 2IV7A 2VBFA 4A6EA 2CZGA 4G5SA 4D0NA 4JI2B 1KIFA 4BE4A 2AJDA 5MFPA 1GUYA 4WOKA 4UAVA 4EECA 5JU6A 2QQFA 3CNBA 3FUVA 4U0KA 4DVZA 5EQJB 4J29A 2RG7A 1A9XA 3EGXB 4NCQA 3K33A 3CIFA 4TV8A 1M0SA 1ZN2A 2OLEA 2EJWA 2ZR0A 4ENUA 4W1QA 1IOLA 4HVLA 2Q3MA 2AN1A 4MB2A 5IEJA 5FFFA 1DVRA 1AGNA 5K5EA 2EKLA 5C7YA 1JAYA 1NQXA 4JQOA 5CM2Z 3UUGA 2I9PA 2OY0A 2GJ8A 4CT0A 2KE5A 4DBLE 3JRTA 3HNJA 2OCIA 2YW9A 4CCYB 3IQEA 4HGPA 2YVQA 1TM2A 3NHRA 3QSYA 2QK4A 2F00A 5TARA 5CLGA 3GLVA 1XZLA 2GPBA 3L46A 3AP2A 1VQ1A 2SKEA 4P8RA 4CMCA 1YDEA 5I9NA 3JRMO 2PJDA 1ZGCA 1Y8AA 3DH0A 2BHTA 3MVEA 4Q37A 3CAXA 3UT6A 3IDQA 3B0UX 3GOHA 3GP3A 2N75A 1F2TB 1W5SA 4RVDA 4KIUA 3KXPA 4W8PA 1T6QA 2O2EA 1V11A 3GJQA 2B2CA 2PWPA 2NU8B 4IO0A 4U39A 4WMLA 5F64A 1O57A 4BKQA 4RPKA 1JH9A 1A8HA 1H05A 3ZHXA 5IN4A 3ND5A 4F71A 4EY6A 4QL3A 4ZVPA 2OXTA 3B71A 1I7QB 3ZHTA 5LP6A 4WT7A 3KOUA 3JQ7B 2CXTA 3ABZA 1SEVA 3MTIA 1AO3A 3UENA 3GRPA 3ZHVA 1L7BA 1UJ6A 3FNIA 1GAWA 4G4JA 4CFSA 2FPXA 4QDXA 5TIIA 4E08A 5D6NA 4M76B 5DEOA 5FBLB 2GCEA 1ZM3A 3RU9A 4DM7A 1Q7RA 1LBIA 1V7CA 3DEJA 3JWHA 4JBHA 1QGYA 4AQDA 4BNZA 1WUHS 1LPPA 2QX8A 4M87A 1N5DA 3HDJA 5DK4A 5GV8A 1CQJA 2QLMA 3SHVA 1HI9A 4ENWA 3K70C 5A5VA 1E2XA 3B2NA 3ZDAA 1OZGA 2HA2A 3ZCXA 4MQUA 5I8PA 2ZYIA 1SXJD 2H0AA 5HE8A 2XVAA 2QBYA 4BP9A 2C97A 4V1CB 5EINA 3G4ZA 3NT4A 4PY2A 4AQ7A 1P2DA 2VEDA 5JD5A 2A0YA 3P32A 4FYWA 1RKQA 1MKYA 4AURA 4GMDA 4UEJA 1SC9A 5BSUA 2ZD9A 1Z74A 2AOTB 2BJWA 2I55A 4FYJA 2NSLA 4RVGA 3B36A 4E2FA 1RTTA 2YV5A 1NC1A 4HAOA 2CYBA 3GFTA 1WMEA 2IZOA 4AC9A 3ZCTA 5ADWA 3WMWA 5ALYA 4DA8A 1RHJA 2FPIB 2OOCA 1MB0A 2C5SA 2OC4A 3NBYC 1LNZA 1RE0A 4ZZ1A 4TTRA 1TYEB 2BR3A 3M81A 4URZR 2VYVD 4Y1GA 5EEGA 5EMNA 3E4CA 3RQEA 4RA6A 2E3JA 1SBHA 3EEQA 2WJGA 3O90A 2ZBEA 1W0JD 3CKYA 4PZZA 2CXOA 4BNDA 2WNHA 2BZ1A 4FEYA 3T12A 4ZTUB 3OTQA 2G9NA 1SKYE 4TZ6A 3R5SA 5FAKA 2D0PB 1V4AA 1ESEA 1GGHA 5CVJA 5UKDA 3DZAA 2JGLA 1Q17A 2Z2KA 2UZ0A 3EQ9A 1O4VA 3C3XA 2WF6A 2XD9A 3OX2A 1LVGA 3UT5A 5CFNA 4XJXA 3B5EA 3MRXA 1LS6A 1ZYRF 3KYCB 3WA7A 1G21E 1JV2B 1RZVA 1WXQA 2GJAA 4KQHA 4KNYA 2GO1A 2G28A 4A6DA 2FMKA 2VJCA 4AJOA 1THTA 2WTBA 4HXEB 2CDQA 3TGLA 1JWAB 4GVPA 2XEXA 4B82A 4Q9JA 3AGUA 4B4WA 1E98A 3EW7A 4G36A 1AC5A 1UJBA 1O9GA 3GOQA 3ZQ4A 5GOZA 2SNIE 4HDKB 4BX8A 2XT6A 3T5GA 4OGWA 2QN9A 2XE6A 4JYMA 3SSNA 4YC7A 4P3YA 4DYHA 2JFQA 2OVFA 1FA9A 3I92A 2ID4A 1AUVA 4WK2B 5DW0A 3SM3A 4GL4A 1KDOA 3HCBA 1JSRA 2FVYA 4ZVNA 3LLIA 4XYGA 4NEGA 1C30A 2Z30A 1M6NA 3QXXA 3VZDA 4GQHA 1BWQA 1HG0A 1YFKA 2OQVA 2F48A 4IJMA 1JN0A 1G55A 1UXJA 3Q1KA 1QP0A 2GXQA 3KYDA 4WUTA 1XNRB 5K05A 5ER9A 2X22A 3CUEF 4JEMA 3RJ5A 3AP3A 5GM1A 5A4DA 3E5HA 1B6TA 4HQLA 3DOFA 4IDPA 1KK0A 2FPIA 3DFMA 1CQWA 3X43A 4YJ3A 1YR1A 5CFLA 3JQAB 2FZ4A 4WXPA 2MSNA 3CMCO 5J63A 4DQXA 5IVKA 3HCDA 1YBVA 4KYUA 2MMGA 2KHZA 2P30A 2QGZA 2XB2A 2AOTA 2O7SA 4HXYA 4RPGA 5DCUA 1E92A 3QYPA 1GPYA 1ZR4A 1SXQA 3U0CA 4RHTA 1T6UA 2YZSA 2PXHA 3E84A 3TQFA 1GDTA 3R6GA 3AGPA 4I4TA 3T7TA 3GARA 3UAZA 1VPWA 1NW7A 3H8WA 4ITRC 5ISMA 1MJHA 2OCCC 2JD0A 2QN7A 4ZODA 1OPRA 1R5NA 2XYQA 1VL0A 2BFCB 1HSOA 3NW9A 1IBRA 2XSZD 3OP4A 4FNGA 3TSOA 4A6XA 1ODFA 5FLYA 5P21A 3CUSA 4BV3A 4RV5A 1TO1E 4BLPA 4H60A 5SV2A 1RPZA 3RQSA 2VK2A 4PFJA 3LNRA 4G9GA 4MX8A 3FVRA 4ZVVA 3GLHA 1PYDA 4O0LA 3VOTA 3B1JA 1KC1A 4WK6A 1TJ3A 1YO6A 4GGMX 4YRCA 1UK6A 2AF3C 1YJXA 4KQ9A 4MB6A 5FADA 5G0UA 1Z4KA 2I8BA 4OM7A 3SD7A 3TOVA 2PEYA 1GZ5A 1T8RA 1Q50A 4EA6A 5J2TA 1XMXA 3QFSA 2MSKA 2XLCA 3HTXA 2XUZA 1I4OA 1XNGA 1H6DA 1E2KA 1JZQA 4NCNA 4KUHA 2NU8A 4D6PA 2I2CA 5HKOA 1CUWA 1VSTA 5CCXA 4CUZA 2MIIA 5JAMA 1RADA 1D09A 3HB4X 3N8DA 4FE7A 3VVLA 2PRYA 3BMXA 4IDEA 2Y0CA 4O2AB 4RFVA 1J24A 1E1DA 5IUKC 1I1NA 4LYHA 4RAOA 2JLRA 1O6BA 1Z2NX 2FN3A 4EHNA 3W5AA 3TVDA 1EMDA 4XTCS 5FA5A 5TNXA 1PEYA 2BTEA 4I3MA 2RHLA 2KK1A 1SB9A 2YIMA 3HU5A 1BEEA 4IJ6A 3QELA 1IXRC 5LYYA 2J07A 3WKCA 3OFND 1UMCA 3DPUA 4JKYA 2HREA 1HT1E 2AF4C 2J9GA 3B7WA 1XZKA 4X54A 3SZUA 4E0BA 3PQDA 1IBMB 4KKXB 4QQ8A 4W8HA 4IDHA 2Z3ZA 4RZ2A 2BMVA 4E14A 3IQGX 2WIGA 3JAKA 3JTMA 2AWYA 4JJIA 1GUAA 1A7JA 5KKAA 2ZSUA 1PYOA 2QYOA 1Y6FA 3N0XA 3E82A 3JQQA 1SQ5A 1Z8HA 1EFPB 1VJ5A 2ET6A 3EGXA 3G2JA 3RH0A 1PRYA 3EGIA 4R2LA 5B1YA 5EP1A 5EEHA 3M1IA 5KOHA 3OA2A 1II8B 3Q12A 1XDWA 1NMEA 4O2LA 2CLOB 1GFWA 1OXMA 2BCJQ 2DE0X 2Q5EA 4CM1A 3UB3A 4K9KA 3KQNA 5AC4A 4P1ZA 4O4IB 2B3DA 1SC1A 3LC2O 3O8LA 3CLRC 4Q9AA 5F21A 5JDCC 3FTDA 1YDMA 4D8YA 1DEXA 1EESA 2KJQA 2NU6A 1X9IA 2Z0MA 2D2EA 4OHCA 4QVKA 3LQ4A 4QULA 1XALA 3L4EA 4BMNA 2D5CA 1RD4A 1CY8A 2AUNA 3VOSA 2RAPA 2JGJA 3UKDA 4II7A 5E6SA 1JTFA 2IYWA 2WSYB 3C2QA 3H4MA 3OTIA 4X5OA 4COKA 5JS6A 1E0JA 1MFPA 3HI4A 2F62A 2AFIE 3D6TB 2BMDA 3EAFA 4DARA 5AUOB 4Z1OA 1OJ7A 4YRKA 4WHMA 3LY5A 3GMDA 1DFIA 2PGNA 2YVUA 1NRWA 3R4CA 4QFBA 3PQ2A 3VRHA 4NY1A 3N5CA 3RVOA 3UHJA 5KVVA 4F3TA 3LKVA 5A4IS 4XPIA 5CLIA 1Z2OX 4F6LA 5KTKA 3A6LA 4NYJR 4TZKA 3LRXA 2GBLA 4NU8X 4MJ7A 1P1FA 3WLMA 5GIOE 4BVFA 3E3LA 3EZNA 4GNRA 4I8XA 4LRSB 1UXGA 1EFUA 1WKBA 4WOBA 5FOWA 4G84A 5C5DA 5LLSA 1XVIA 1QG6A 4TUYB 3PMRA 5HVNA 1YMVA 2AI1A 3FOCA 1YQTA 2H92A 4LNAA 3OPYA 4QVGA 3W1WA 1TJ4A 1BRTA 1XZFA 1LE4A 2PSDA 4W1SA 3UK1A 4HWGA 1NLUA 2WWVD 4US1R 1USUA 4NYIQ 4CSAA 2HIAA 3P2OA 5JDCA 3RYCA 4RJ2A 2AE1A 2WVNA 4MB0A 3RVRA 4CE6A 3B2QA 3LHDA 4U7TB 2BP7A 3M3HA 4MA4A 5IVIA 2JANA 3HHEA 3BSFA 4HEJA 3PENA 5DFAA 1U1DA 1KFEB 3STTA 4AG6A 4YO8A 5K0BA 3UEOA 3VR4A 2PLNA 5IAKA 2MHRA 4MVCA 4O4IA 1WQ1R 2H4FA 4AJKA 3FTEA 2Q6LA 3FSEA 1L5HB 2BELA 4NI5A 1Q0SA 5LMUB 5KNBD 2FMXA 5TC4A 5HKKD 1RM3A 3R7WB 3LVBA 2HK9A 1CUXA 2X7XA 1ZXLA 4D6XA 2XVYA 1U31A 4ETWA 4OQNA 2NT3A 3GODA 2W6QA 2HXGA 2JFGA 4NBKA 3TTTA 3TTYA 1PT8A 3PFCA 4E22A 2F1HA 4NH4A 1MJGA 2E6UX 3TQIA 2XNJA 4HD8A 2VH1A 3ESQA 3MJVA 1ML3A 2AZDA 4MKHA 2AJBA 2NPOA 1QQ7A 2FPLA 1XMVA 3AVQA 4MP8A 1DKOA 4CVNA 4ED9A 3GLGB 2O9JA 3NMIA 2N3ZA 1KJJA 2GDJA 2VJLA 3PGLA 4LG1A 3PDIB 4BVAA 4Q7EA 1RCTE 5AQEA 3UQZA 5BO5A 3REFA 4D9MA 1O6FA 2GLTA 3WIEA 1E2DA 5A03A 2IUFA 3MCAA 2XZLA 3B52X 1EIWA 1G16A 4OOEA 1UBSB 3UMHA 4AKSA 1U0BB 4W8GA 1DRWA 2C99A 2FSFA 3MCZA 3S2EA 4EQ6B 4MNDA 1BDJA 2JGKA 1I2MA 1Q15A 4IYJA 4PAGA 1OFTA 5JZOA 1EXNA 2C20A 1G8KA 2IIQA 2JJ1D 4QQKA 1TK2A 4ON9A 5KSPA 1BDJB 1W44A 2QMQA 2PA0A 2EX0A 2DCUA 1PUIA 4K6KA 4J2OA 3UXEA 4OIPF 4K26A 5C0OE 4K6OA 1GPUA 1N6LA 1MQAA 4OQXA 3OO0A 3VR5H 5KYYA 3TE7A 2RDMA 3E9QA 4ZO8A 1IPEA 1NW6A 1UMDA 4I99A 1UKZA 2CJYA 1C0PA 1W46A 3RVZA 1RAIA 2JLVA 4U7GA 1EG7A 3E5MA 4BNWA 2PO7A 1V2HE 1XHFA 3NV9A 5ESXA 5CBKA 1CUCA 1SQ6A 3BHNA 4IEIA 5HOQA 1DC8A 5HJ2A 1NXOA 1RI3A 3NYIA 1DOHA 3QBTA 4LQLA 5EJMA 4EHKA 2YFHA 5K3AA 3W2TA 1G4HA 2L7AA 2XIJA 3RASA 4D7AA 1E77A 1GUZA 3I9LA 3NYWA 3LUTB 3QHAA 4M0DA 1FYVA 2P1DA 4EW6A 4ZIRB 3K66A 3K6SA 5A0TA 4YIKA 2B83A 9LDBA 3MWDA 1ZHOA 1DPGA 2UZ1B 1KYQA 4A0SA 1HL7A 1ZITA 4Y6OA 5FI1B 4YMGA 5JY1A 1KO1A 2IEDA 3NC0C 3UGOA 3BILA 3VDMA 2OYRA 4DBZA 4XA8A 1L3CA 1SVMA 2YN2A 5J4HA 1OE0A 1A7EA 5KNCD 3B9RA 4Q3NA 3UO8B 4RTQA 5LP6C 1SD1A 2G5CA 3EZHA 2JGDA 1SUPA 3EARA 4J1TA 4OI2A 1S2OA 2XKKA 3FVVA 2A59A 3CIOA 4G9EA 2VOEA 1FFCA 1Z6TA 4PXSA 3VNBA 4GLBA 3U61B 2X0RA 2KYHA 3K31A 4N7MA 5BWLA 1GKKA 1XP8A 2QSYA 1YS6A 3EWAA 1J21A 4BFSA 4EX6A 1T5TA 1BOFA 1VRVA 5SZKB 1V4NA 4NC9A 4EPVA 4EW2A 1OHHD 4P81A 1KZ9A 5ES4B 3V32A 1DT5A 1W49A 1BMFD 5AK5A 4KFCA 1E66A 1CDZA 1G3QA 3GLTA 2W9YA 3RS5A 4YFVA 2AZXA 3KXLA 4QGAA 5HIMA 2FW7A 3U6BA 4PNHA 1GNRA 4BVJA 5JAUA 4JT8A 4P35A 4JUCA 3H86A 4EG6A 2P7IA 2QVXX 1K8YB 3CM0A 5J58A 2DUJA 3WG7C 1POXA 3I01A 3UMGA 4ZT5A 4HLCA 3AGQA 3NHUA 2VPPA 4WCVA 3VNSA 3W6OA 2JA2A 1R6BX 1RWQA 2HMZA 3UMIA 2LP4Y 2OFOA 2IQIA 4ZXFA 2A6EF 4Z1MA 3RUFA 2VP2A 3THXB 4WLNA 3PC7A 1DWUA 1Q0ZA 4HDCA 1OTYA 4PC2A 4ZJPA 3AKDA 2FR0A 1BA2A 1X2EA 3EVBA 3L79A 3KYCA 3ZK7A 3NB0A 4ZGWA 2O5CA 1ZMOA 1FQWA 1I2CA 3ZD6A 1US8A 5COGA 4HH4A 1P4SA 5CVDA 1YE5A 4JJAA 3O10A 1TZMA 3ZGZA 3F6PA 4AYTA 2DM6A 1XLWA 3UB4A 4BMVA 4KZKA 1DX9A 3AY7A 3QE2A 1B43A 1S7GA 2HYDA 4GAEA 1CS0B 3GUUA 3HA2A 4RDIA 3ZWNA 4EHHA 2UUCB 1V4VA 3OHSX 2Y1DA 1SELA 3FNQA 2P62A 4YREA 4OFBA 2ZWVA 1SXGA 2Q1WA 1QS0A 3WO1A 1Z26A 4M4SA 1AGPA 3CZQA 4EOGA 1A27A 5A3VA 4Q0MA 3T94A 2EQAA 2QM0A 2Y77A 5KVCA 2F59A 1KIAA 1QS0B 2NVWA 2RSEB 4E51A 4D46A 1CUIA 3KV1A 5FUWA 2JJMA 5COMA 1QLHA 2HK7A 4JI1B 4RY8A 3NHPA 4E7SA 3JAKB 3B1VA 3HXPA 3DKPA 3Q7EA 1QWSA 3WLKX 4W8KA 3AQ4A 5EE3A 1R9GA 3QE9Y 3NIDB 3IR6A 3LJBA 3RWOA 4TYYA 5K6AA 1KGSA 3Q8LA 3WGTA 3WJ7A 1GAJA 3DR5A 5AJYA 4DPLA 2F55A 4TRNA 3LPNA 3L8YA 1WXGA 1Y42X 1UDRA 1Y3AA 4TPKA 4TLBA 1MMDA 1QE5A 4Z7QB 2J0WA 1W0CA 4B17A 1D1SA 4UAJA 4B0OA 2EYQA 3R9XB 2R00C 4A27A 5F98A 1DOWA 1GQQA 5L4LA 2HSWA 3X1JA 1DEHA 3CRW1 5FL7A 1FPQA 3L8HA 4R2IA 3ZLUA 1RCPA 2FKAA 5G0SA 4TUYA 3BULA 3EOBI 4XDZA 1LTKA 2MWQA 2EKDA 3B9PA 5JC1A 2G4CA 2YJNA 1BCRB 3JD1A 3OQBA 5SICE 4JVMA 4JR1A 2J9WA 4OIRF 1Q6ZA 3ABIA 3DVAB 2XA2A 2UUOA 4LYYA 4PGMA 5DLPA 3UK6A 1JAXA 1OXKB 2DTXA 3O4VA 5AVJA 3QXCA 4CM9A 5MGBA 3FI0A 4JFAA 1XROA 4M0LA 4B4DA 1E2UA 5T67A 2BFWA 2ID8A 2RGDA 2CW0F 3O9VA 4AVYA 5J43A 3RF3A 2NP7A 1OTXA 2QJFA 2CBGA 2OCLA 3OF5A 4COOA 1WZEA 1A3CA 1MORA 2W7TA 3I3OA 1ZR2A 3UK7A 4DLTA 3ZW7A 2BY4A 2Z1NA 1LLDA 3ILXA 5HS4A 4Y2UA 2HPVA 4I55B 1D4OA 3ZS8A 3CQZA 3QNMA 2XF8A 1IVNA 1SC3A 4GI3A 4HDMA 4NCJA 3NZEA 2FY8A 2BL2A 3HRKA 4EEKA 1YGPA 2NU6B 5ALNA 2A3RA 3TZ6A 2V0GA 1H2BA 2PN1A 3ZH2A 5H0IA 4LF8B 1V8FA 3ZHYA 5EQFA 1IWBB 3C4QA 3OZRA 4N0EA 2X5KO 1NZFA 5A9RA 1HNWB 5EIBD 5MGNA 1TR2A 2AJLI 2O2YA 4M0KA 4D43A 2A3NA 5JNSA 3LQ1A 5ICGA 5AQ1A 1FNTc 2JG3A 1QVXA 2O8CA 3P1JA 5JD6A 4FFDA 3LPCA 3EIXA 1A0BA 4J7CA 3TZCA 1RRKA 1VYTA 1EFPA 1FFBA 2G0NA 4HEQA 2WUGA 3BE8A 3GUCA 4Q39A 1ES9A 2F67A 4GXRA 4JP8A 4PNPA 4J7TA 1D1TA 1X7DA 2JCBA 1VKNA 4HUJA 1YI1A 1XVLA 2O4CA 3EMDA 4MMXB 1F17A 4NDAA 4RORA 3EG5A 1U6IA 4KBFA 2ZM5A 3I5YA 1A71A 5FFMA 4Y6SA 3VZSA 3ENWA 3ZI7A 1D2NA 4MIYA 5JNUA 4YV2A 3F96A 1WW8A 2P1AA 5KTOA 5WRFA 2IS4A 2ZSBA 1MO5A 4YMLA 4GKKB 3JRWA 1YCFA 1F0YA 3RIEA 1A96A 3AIKA 3NKDA 2OXFA 2CSUA 3HBMA 4RABA 3NMJA 3NEJA 4WESB 1N2ZA 1OZAA 3EMBA 4QX6A 2I7TA 3QU9A 2IUSA 1IB6A 4PACA 2QRZA 1IATA 2VDOB 2R7SA 3B8HA 3N2KA 2FPMA 4HN9A 4OHOA 2FQQA 1BR1A 4RZ3A 5HA5A 5LOVA 3M6XA 2ETSA 1GA4A 3FUXA 2P2DA 3KPJA 2Z1DA 4TKUB 4KLNA 4TTAA 4UM9D 3VJMA 4Z4HA 5HQ3A 4ESVA 2RKBA 2WPDD 3IODA 1KK2A 3W2FA 4DGQA 3KXKA 4INPA 2C07A 3RS0A 1M1NA 1ZVKA 2I5PO 5C4MA 3ABQB 1T36A 1U63A 4KZPA 4M89A 1PE0A 3X3HA 3N2ZB 4BCDA 2FZ5A 3GPBA 3AG6A 3O1HB 2IYRA 4Q12A 4YYZA 5JYCA 5G4KB 3BIFA 1ZLXA 3THRA 3IMEA 1I3MA 2DWOA 4QU8A 4B6RA 3BN3A 3GJ8A 4E88A 4ZREA 2QUAA 3HCEA 2DPGA 5BR8B 3PU6A 4JZAA 2Z08A 2BI4A 2G25A 2YHIA 2X51A 3MJSA 1VHLA 1V35A 1XYGA 3SX4A 1AZSC 2LK4A 1O08A 1UBLS 1F6WA 2DKNA 2R6FA 3H9BA 1XRSB 3CT4A 1XZGA 3AI7A 1TO2E 1TF2A 1VE1A 1WDTA 2AD5A 4TROA 1SUWA 3DE6X 4N01A 1TIPA 2ATEA 5CT8A 3S0JA 3UK0A 1JX6A 1L1RA 4C3BA 3PC8A 4C43A 5A1JA 2BE9A 2BEWA 5G41A 4RM2A 3RM3A 5DNUA 1KJYA 3I9MA 4P31A 4P2BA 1ONPA 1HE5A 5HK9A 3C14C 2UXBB 1MX1A 3DVSX 4I50B 5ABPA 2RC6A 2VWHA 2Y8EA 3MAGA 5FTNA 3BMCB 3EEOA 2WYOA 2ZBFA 3DC2A 3DZ8A 2DHQA 3JZMA 4C20A 4FNOA 3DAYA 4XEKA 1WP4A 3OEED 4P4NA 2WAXA 4QEKA 3VC3A 1IRIA 3HCWA 3IESA 4DB2A 4G97A 4TMTA 2ON6A 1JALA 4PR9A 3K2QA 3FPAA 4DPKA 2VF7A 1UZAA 4RTNA 5KJEA 2Y2VA 1LU9A 5K3BA 3QVJA 2FSUA 3MJEA 2QPAA 1TMOA 1XYYA 2PGAA 3EGVA 1U80A 3EQ7A 4ID9A 4LK3A 4P08A 2Q3CA 1TZJA 2CWWA 2W2XA 2RHBA 4AMUA 4TZTA 4LE0A 3A27A 1I13A 3CVOA 3T6GB 3LM8A 1UM9A 4A0HA 4JYZA 1T24A 3FYDA 4RHFA 1UZUA 3U7EB 2DU8A 4ZLDA 2BFMA 5SZHB 2GA0A 1AURA 1UT6A 4LQCA 4C6HA 3HG7A 4R0MA 3ENVA 5DM60 4N5MA 2X9QA 3Q8WA 3ZTWA 1OWNA 3HNRA 3HP7A 1Z5NA 2GEBA 3O26A 1OGIA 4KPEC 2IEYA 1ZD1A 3OPVA 3Q11A 2FQXA 1P3DA 4PE5B 3ECSA 2IF0A 1JIQA 2VLBA 2HFIA 3VTKA 3P0HA 3LDAA 4LNUA 3UOWA 3F5QA 3FX2A 2VYVA 3CEMA 4MR8A 2XCOA 1QGDA 1AB5A 1REQA 1I2AA 1LS4A 4YXWA 3KR0A 3PQEA 4O4HF 4PR3A 2XKAA 5LQUA 1EUZA 1T9HA 3DTVB 1F51E 1MMFB 3AUUA 3BDVA 3HNKA 1C0LA 3HI6A 3QLVA 1KR2A 3HJTA 2CJWB 4RK6A 3UT0A 3DD7A 4L7VA 3T4RA 3PNLA 4RQUA 3I39X 3CRRA 4MICA 1J99A 1RAHA 3J81k 4R40A 2FEAA 1W4AA 5IZCC 1VBNA 1E2JA 3JYOA 4WX2B 1U65A 4ZOAA 1CZHA 3IUQA 3PR1A 4S1NA 1A88A 4TT8A 1C1XB 2WQZA 1E7QA 1BVUA 3D3EA 3PEEA 4BKOA 2DYSC 3NAGA 4YDRA 5C8ZA 2V6IA 2FMHA 2PX6A 1L7VC 4ULVA 2LBPA 2YMMA 3CMMA 1I3LA 3B51X 4H7DA 3DV0B 4U9IS 5COQA 2XUIA 4ZEOA 3ZTTA 2UUBB 1R6AA 5HGXA 5F35A 5T6MA 1QIKA 3OY2A 4JXXA 3AEUB 3CNHA 5LBUA 1KORA 3BEOA 3GK3A 3HR8A 3AKZA 3T06B 4O8ZA 4DAOA 1HA3A 3A0UA 3D7SA 3KTOA 2IIVA 1V3TA 1U11A 4V1CA 1L0BA 4MUIA 4CW7A 3U44B 1Q0QA 4KSYA 2WL8A 3H5WA 1RLOA 4H54A 1YS9A 4EW3A 1GRRA 4G1FA 3WNVA 3UVEA 2WIBA 2ORVA 2Q4BA 4NE9A 1MB2A 3DB1A 4P4SA 5I9MA 1L5GB 2AFHB 4Z1MD 2J46A 4HPWA 1V1JA 2FWNA 3OWOA 2I6GA 5JI3E 2PQ6A 4O2AA 1MNAA 4GC9A 4TWRA 1JQEA 3IX7A 1MD9A 2ZEJA 4PFSA 2QLTA 5IJAA 3BCRA 1JA9A 5FHQA 3VPGA 1K9VF 2AQ8A 3NI2A 4FFLA 4JVOA 3HXQA 9ATCA 2EKZA 4X8OA 4A0QA 4G5YA 3BWYA 3IQXA 3M1YA 5F1PA 4C4YA 4W5TA 3WAJA 1Z63A 1ISSA 2A9FA 4L4YA 3OKCA 4LWOA 2C2MA 2XRHA 1WZ2A 1SZDA 2X2FA 4MEJA 4GOJA 4TRMA 4WDRA 1XTZA 3HVHA 4AT1A 4AI6A 1BHO1 2E5FA 4B79A 4W7HA 4I1SA 1QLJA 2GD6A 4RVCA 2Q2NA 1XCMA 4DBQA 3WOVA 4PAWA 4QUHA 1WP9A 4B2PA 1C2TA 4HWTA 4IF4A 2Q6TA 1BCSA 3A9WA 4HNGA 4OIFA 4WINA 5DS5A 3WRXA 4N5NA 1MC8A 4J0JA 2I67A 2PMEA 3A36A 1FFWA 1MENA 1Q0GA 1FYEA 1PNTA 1KDRA 2C61A 3CX4A 5AW5A 2ZFUA 3BWEA 4FP9A 2R11A 1GCOA 3ERCA 3RD5A 5TQJA 4NX2A 2VF5X 2HOQA 4BPBA 1G7CA 2FLWA 3KKKA 3QOXA 3PC8C 3D8NA 1YB6A 2PIDA 7MDHA 2BEWB 1U3UA 1I36A 5JCJA 5L3QA 4MUKA 1A9TA 1FNBA 2WVGA 4G1UC 2OR3A 3R5JA 1Z73A 2IXDA 1TLTA 4FHCA 5A7GA 4XM1A 3MGCA 3N3BC 3DBHB 3PX3A 3LAYA 4FFMA 5JVDA 5CCBA 1YRQA 3RARA 1JNYA 1Q7CA 2WF8A 4CDAA 1HYHA 4YP6A 1J2RA 4RO0A 3HLKA 1C7JA 4CR8A 3ASUA 2QT1A 5JNWA 2ZAMA 3U7GA 2ZB3A 3KZ1E 2VTKA 2XWQA 5DO9A 5L4SA 2PVSA 2H1HA 3U1BA 3FE2A 1SKAA 1MC1A 4HWPA 1CNFA 4C9BA 1PJ8A 1Y9AA 3ZWOA 1OFGA 2DBQA 4AMGA 1T36B 4YCSA 2Q9UA 2VCYA 1JT9A 2Z5LA 2PX0A 2LIVA 3DVRX 4P0QB 1P4HA 1C8LA 2L0XA 2W8ZA 4LMPA 3EF0A 1Z2EA 4ZCSA 1P1CA 3KVVA 5HHTA 1SVKA 5BRNA 2XBUA 4GBJA 4IVQA 4F8EA 5F3WB 3OM9A 5BVGB 4UUNA 3F78A 5C32A 4CF7A 4IH9A 5LQDA 3M4BA 4O6MA 3NHFA 5AKGA 4Y2JA 2IA5A 2GILA 2ZQZA 2W90A 3FTPA 3PC2A 4K46A 4QSMA 4XARA 5BVGA 4QXMA 4KV7A 2WIFA 1ORWA 3L40A 4H4KC 1BC5A 1M72A 2XMCA 3R3SA 3SWWA 3O5AA 3H11B 3K4QA 2WWFA 2V8OA 3MWFA 5CH8A 3BIWA 1MH9A 3KCQA 5DTIA 4ZHQA 2VK4A 4MJLA 5EWLA 3HTKC 4X1YA 1GL6A 1MAVA 1T5DX 2XKBA 3COJA 1U3WA 1E4OA 3DT8A 4WZBA 1DX6A 5DIFA 4KE8A 2CKMA 4J0CA 1LY1A 2NSYA 2PD4A 2HDWA 4NNJA 4KITB 4CLXA 5BV8A 2QN6A 3IAS6 4GRAA 5DTEA 5KWEA 1RHUA 3SDBA 3WGMA 4MCAA 4KAFA 3KQYA 3PPXA 3OQIA 5B3KA 3QF7A 1Q11A 2NO4A 3PF8A 1FBNA 2Q6KA 4XKJA 1ILWA 3WWEA 1D8TA 5B6PA 1Q57A 1T6YA 3PL1A 7MHTA 256BA 2YL3A 3U3ZA 4G0HA 2XLHA 4IQ8A 4CTNA 4EGQA 1Z8DA 1YI8A 5F12A 4QVIA 1LTHR 4NSNA 1M6HA 3CCBA 4R1TA 2HHLA 3D1LA 4JOBA 2ODBA 1X1BA 2WT4A 3BB1A 1N6IA 3QLVC 2P5UA 1D0IA 2GM4A 1A72A 4BBZA 3UAYA 2OVBA 1ULSA 1Y33E 2WHQA 1PS9A 4TLEA 5B6JA 3UG7A 3DOHA 5LP1A 3DL7A 3ILSA 4JS0A 1JFSA 3WV5A 1E86A 4DA0A 1M6TA 3GLGE 3IBGA 2AQIA 1G4US 3ANSA 3DZHA 4AKIA 2HUJA 4JCZA 2VPZA 1Z56C 2X0EA 3EWNA 1S8AA 5AK3A 3NYQA 3S2SA 3FJOA 1U6HA 3IHUA 3REOA 2PFDA 4WNCA 4WK4B 1SKBA 3GGPA 2Q46A 2Z6AA 3RS8A 2Z4RA 4E2XA 1JA0A 1FYDA 2BZ0A 2RKWA 1YB5A 2DFKB 1QMPA 3PHF2 2VJAA 3BE4A 3PUYA 1ZNZA 5E3CA 4HDAA 4UBOA 2DEUA 1XTUA 1ZICA 2PX2A 1SBZA 3G0BA 5G4KA 2OCXA 3BYZA 3SZOA 5GIPE 4FZ3A 1ORYA 4IGAA 4NBWA 1BDIA 2QN2A 1OCRC 4LVCA 5T4BA 2IPXA 1A7VA 1PI3A 2GVZC 1LBHA 3O4JA 1NN1A 2HO4A 2HCFA 3DVAA 3B38A 1FP7A 3LE8A 3UGKA 4LXTA 3TD9A 3Q15C 3COPA 2D4AA 5TY0A 2ZBDA 2QSZA 4OCZA 4ZOQI 3EZGA 1AH2A 4JE9A 1DV2A 5D5PA 1H66A 5ECYA 2DERA 3BF7A 3PJGA 5FOQA 2JCYA 1U0OC 2VOJA 3F2IA 4E5PA 4YV7A 4D25A 5I4CA 2M2IA 1FFXA 2C9BA 4Y2YA 4L07A 1UJCA 3G5MA 4DJJA 3V1NA 4DGSA 5JI2E 2Y4OA 1DEOA 3LLSA 3OU7A 2YKGA 2JI9A 3AZQA 1WRBA 1JFLA 4P36A 2YJ4A 5EQTA 2F1IA 3B7GA 4I5DA 1N6NA 4LLEA 1FYFA 2AV6A 2OORA 5AR1A 4EL0A 3F8WA 3ZWXA 1QDUA 4C3OB 4IIJF 5FOTA 4QG3A 4J0DA 2DPHA 1J2YA 5ILOA 4JL6A 2CLIB 2ZJ3A 4JBGA 4N03A 3MWEA 4UEKA 5HK8A 4Q02A 4DTIA 2NUPB 3D6AA 4CF6A 2J4FA 2CHQA 5H9VA 3AEKB 3UJ3X 2NP6A 4I46A 1OT3A 5LP6B 2L6HA 5INTA 1ZUIA 3OOWA 2W2VA 2WJHA 1FVXA 5AOBA 3WDSA 2I54A 3RTEA 4OU5A 2VI5A 1A69A 3O39A 1EFRA 3LC0A 3VKFA 3U49A 1KI6A 1A9XB 4DLLA 4GPTA 1W2HA 2O52A 1V7ZA 5KYWB 5FOVA 4ES6A 4EUHA 2BTQA 3QLJA 4GLOA 3WK8A 3LSTA 1ZWLA 3I58A 3MAAC 1WBBA 1HDEA 4FEGA 4MTGA 5ILGA 3UAWA 3IMKA 3C7DB 5D3MA 5T6BA 2Q4RA 4NV1A 4U8HA 1G8HA 1QHNA 1S2DA 3SOPA 4A26A 4NDNE 1NT2A 4ENSA 1E2FA 2WFZA 1KVRA 3AP1A 4I1UA 3T95A 1WQ4A 2WNIA 2QIOA 3FHDA 1ZD2P 3G50A 4PK4A 2XXJA 1ZGGA 1XJQA 1GCIA 1XI2A 4BGIA 2C4VA 3ZR4B 2YLDA 1EFRD 3UH1A 4RK5A 5DN6A 1HDOA 2PPVA 2ZBVA 1NONA 121PA 2FJUA 5AKKA 2C4KA 1LIHA 3ZCUA 2HDHA 4F86A 1YR7A 4MP6A 5FFNA 5JFTA 3FHTA 2VT6A 1BMDA 2OHIA 4Q9DA 4RVNA 4UVGA 2EW2A 3RRXA 4W6ZA 4KRGA 4TQ9A 1H1DA 3LX5A 3UV7A 2QIPA 4XUEA 1K66A 4LF6B 2BC5A 1Z83A 3F8SA 3TUZC 2COKA 1RKEB 2HNBA 5ECDA 3F9IA 5M29A 1E5DA 1WCWA 4CQJA 4PZLA 1ZCBA 4GI5A 4WA7A 1Q7BA 3I6MA 5D00A 2OZLB 4E07A 3OLZA 2ZATA 5J4KA 1NMSA 2EIKC 1B8NA 1CIPA 1JDJA 1S9HA 1Q74A 1BCRA 4JBLA 4ZAVA 4E5NA 2DUUA 5BV0A 5EJ9A 4N06A 3AEQA 4BKMA 1CR2A 4Z7NB 1F2UA 4MJ3A 4FWVA 4R4JA 2PGLA 2H07A 3VR4H 3ROPA 2ID7A 2VDWB 2B8EA 1VKJA 5DRTA 3VNQA 1KKUA 1NVUQ 3N75A 3PD0A 3C97A 4QTXA 3QVZA 1G4UR 4IGEA 1TRKA 4QE3A 4N6NA 4C0KA 1GPLA 1QIEA 1AA6A 1YQQA 1Y8QA 3PPYA 3DUWA 4IV8A 1N2BA 1ZYUA 3JQFC 4WKCA 3RSLA 5BW8A 2Z6QA 3NHSA 4Q1CA 4TV9A 4Q4JA 2XLEA 2WAOA 1H4TA 3P26A 3MJ4A 2J7PD 2PT6A 2YCBA 4JSTA 4Y6QA 1ZIOA 3HB0A 4QJ5A 3C85A 1PFWA 2WDZA 2VDRB 3WLSA 3W9YA 1Q1GA 1ZUNA 2FP4A 4GYTA 5BSWA 2MYSA 4LOAA 4M1WA 3ZDXB 4IRUA 4H1TA 4MWBA 4F1JA 2XJ4A 4JCCA 3L6EA 1ZU4A 3HVJA 1NDHA 4RE5A 3W04A 4V1CI 4FKMA 4BG0A 3KKNA 4BOYA 4MWCA 1IQPA 2C5EA 3S90A 3FWKA 3W5IA 3J80A 2ZLBA 1NW9B 1QPGA 1H3NA 1P5HA 3MEQA 3AW9A 3QYFA 2ZUVA 4OHVA 4S2UA 1P29A 2O54A 3OT1A 2Q1XA 4DMCA 4AWAA 4A23A 1T1SA 4BEVA 4GYJA 1I4EB 1DELA 1GRNA 3JQGB 4UVDA 2ZWOA 4CQMB 4DQLA 4G63A 1Z2DA 3KLMX 3INGA 3M4JA 1IXZA 3ND9A 1Q1BA 1SR8A 1Y98A 4DSOA 2RAUA 2I4NA 4JKIA 4Z3KA 3AM1A 1GEEA 1XCGB 5CYPA 5U1PA 2BMJA 3GPLA 2YX1A 5K4HA 2SECE 4MYUA 5T3WA 2H08A 3BVPA 5I4IA 2JI6A 3ZQUA 3MMSA 1N78A 4V02A 4KVZA 5KNDD 2VF8A 4Z9BA 1J39A 3DF7A 4B09A 2L9JA 4Y2RA 1LLQA 4AL1A 4CX9A 5E6RA 3ZJ5A 1IBSA 5TPWB 2PZBA 1N0UA 3IQCA 2NXNA 2VJPA 3PNPA 4NVRA 4UUBA 1VL5A 2X6RA 5D87A 3GANA 3B1YA 3BXXA 4Q9IA 2J7PA 4GWLA 1GDDA 2FRDA 5CUQA 2ZYHA 3L82B 3B9BA 1O8BA 4J3FA 1DUIA 5H81A 3SYKA 1E63A 3WGZA 4CLRA 2KW3C 1YKFA 4HBGA 5ADVA 3GP8A 3ZUPA 3BF8A 3RYTC 3V46A 4GFDA 4F7DA 3GLSA 2FWJA 4EIYA 2C5BA 1SVWA 4JQSA 4BNIA 3GROA 3QVMA 4JX9A 2P79A 4YR7A 3HLTA 2ZJ2A 4L51A 1YS1X 3AL3A 4XWGA 3ZI4A 3RBAA 2RK3A 1XIVA 4XUCA 4V38A 4HC4A 6PFKA 1V5FA 4EUKB 2WJIA 1LW6E 1I7PA 2R1VA 3FTNA 4P3PA 4W5HA 4BAUA 4BC0A 3EIWA 4JEHA 4KP7A 3BWCA 4TLMB 2ZWPA 3U3MA 2NOAA 4MA5A 1D2CA 2YHBA 2FKNA 3A4YA 4LBZA 2CMFA 5AH0A 5SYMA 5SYNA 3DLIA 4OH1A 3G8DA 1ODKA 3L2OB 1U2GA 1TE2A 4BO1A 2RGCA 3A7EA 1WOLA 4EGSA 3IAFA 3U81A 3RO7A 5IJ9A 3O94A 1CQZA 4OTZA 4MLDA 4US0R 3ZKWA 3EX7C 3L7AA 3SKYA 5MF6A 2GF9A 1SXJA 2FN8A 5AKJA 1N1CA 1Q1AA 1RXSA 1TZKA 2HQ1A 5CVEA 5EE0A 3ID6C 2XL8A 1L7OA 2HJHA 3TTVA 2Y3HA 1YK0A 4JGGA 1IUOA 4X60A 3QKWA 3FLBA 1EM8B 4G23A 3EJNA 2ZRIA 3UAXA 3DXZA 1CUHA 4JEUA 2XT9A 5DYWA 3SCZA 1EWQA 4ONSA 5KDLA 3DOCA 3HJRA 3WGJA 1LQUA 1CEEA 3HGMA 2J3IA 4LJ6A 5CBPA 2FNAA 4AULA 1FJGB 2FPOA 1VCMA 5LWQA 5EZYA 3OE1A 2J5QA 1O94C 3PHHA 3TIIA 2RHWA 1E2EA 1GPH1 3C7TA 4TTSA 5FA8A 3K30A 1TVCA 2GPAA 4DLVA 4U7DA 1DC7A 2G07A 1DSSG 1IK4A 1THGA 2AQHA 4LXXA 1ISJA 2NSHA 4U5EE 3LNTA 1QGUA 2ABWA 2ZSFA 1L8OA 4BNNA 2DUMA 1JZSA 3KSZO 2KC3A 5BNWA 4LVUA 4HLNA 2WMYA 1ADBA 2X0CA 1EZ1A 2P4EA 2WIKA 3AYZB 3U3FA 2A33A 3KL4A 3RBZA 1WF3A 3G1WA 3CJQA 3JQ6A 3SFTA 2H52A 5AXCA 4HOYA 3T1NA 3OX4A 4PICA 1KI1A 3GDWA 3TGPA 4TMVA 1S2IA 4YRNA 5EMHA 3R2PA 1C7IA 2GF2A 4ER7A 2EEZA 2ODTX 3PXCX 1Y4CA 4UM9B 1OF1A 3OQMA 1F5NA 1B8OA 2YYZA 1CXZA 4FJ2A 5G2OA 5E7IA 4TKVB 1CUBA 2V7QA 4PC7A 5IBCA 1J8YF 1JFFA 4FD2A 1KXJA 3ZE7A 1P62B 1DBVO 5TT1A 1AXRA 5DYYA 4NTBA 2NV2B 1X0XA 1ORDA 4I3GA 1Q12A 2PRZA 3LBYA 2GA9A 3DO5A 1PBTA 4IQFA 2Z58A 1BVHA 3QV1A 1M76A 3KQWA 2R7AA 4QJ3A 1T25A 1SBCA 2PK3A 4KLZA 3I5UA 4P9NA 2VK1A 2IZ5A 3ODPA 4R8SA 3ESRA 2HJMA 2I22A 1Z35A 4GMXA 5CVVA 3VYRB 4RIGA 1TUEA 3LW7A 3C4JA 2BPOA 4JKOA 4BN0A 1SGWA 1K6JA 1FJ2A 4D9GA 3ZZNA 4F3KA 2OLJA 1I2BA 4MI3A 3FETA 3QA3E 5DNEA 4TVSA 3A32A 4XWTA 2G1KA 3A9VA 3OIVA 1WBJB 3RIHA 4LRXA 4G5OA 3SSOA 4KO2S 2P91A 1Z7BA 1W6RA 1HORA 2SICE 4CKCB 4DLPA 4GVLA 5FP0A 5C52B 4X65B 5B53A 1ZM2A 3FDZA 3RVDA 1UXHA 1KAGA 2QENA 3NLLA 4RF2A 3OZGA 2XT0A 2FEWB 4Q34A 1ZMTA 4MLCA 4ZJUA 3A9SA 3OEOA 4Q01A 9GPBA 2BHRA 3CF2A 4G1CA 1OTHA 1XDZA 3B1FA 4UU1A 1NNEA 1EA5A 3ZDDA 1OAOC 1GN9A 2NT4A 4KGZA 3VC2A 3P71T 4W9NC 2P4SA 5PGMA 4PO3X 2Q3JA 4P2GA 1IEWA 2V97A 4WABA 1OLXA 3H2SA 3KZMA 1Y80A 2DPLA 4MUXA 1ZD9A 3UG6A 3ETEA 1YE8A 4GYWA 2ECOA 2DTDA 3QBDA 1TQ4A 1DARA 2C42A 2ZJ7A 4HFKB 3G2OA 2WAYA 4QBKA 5EP3A 5EKUA 1TK9A 5CH5A 1UANA 1GADO 1QV7A 4MDHA 5A0VA 5EIFA 2QS9A 3M6IA 3DYIA 5AP9A 2YLGA 3L04A 3KSRA 5DU2A 2OCKA 1PQWA 2V26A 9ABPA 4F8YA 5JISA 1K89A 5IM4F 4ZMSA 1H85A 4MGKR 1X3LA 3E9EA 3IRVA 4MA0A 2VHEA 3M6LA 1IK6A 1WXIA 1V7QA 3WDKA 5KTSA 2Y1KA 3G9XA 4FDTA 1TA0A 4KW7A 4M9ZA 4Y6RA 4HT3B 1G2QA 3H6KA 3E9ZA 5FWYB 4DUPA 3VKHA 5L4NA 4GH5A 1M10A 4HTAA 3IP6A 4M8KA 3SZGA 2A92A 3GLIE 3USES 3M1AA 4EI8A 2LGJA 1NZDA 4KFRA 2AYZA 4UEQA 4EY7A 3HVRA 1S96A 4KGXA 4U6QA 4RA9A 3EGEA 3T9DA 5KDDA 1IWPB 1G9TA 2JFBA 2YV1A 3CU5A 5BSGA 2A5FA 3SLGA 3R41A 1PK7A 3FZGA 4M9XA 1M1UA 1M2EA 1F7UA 3ZZMA 1PK8A 4GG1A 4I4TB 4MW8A 2VNKA 4YECA 1JU4A 1NI5A 2XMQA 3FA2A 1D1CA 4E18A 4J0IA 3M3DA 4JLJA 2HN9A 2O0LA 3ONVA 5DGDA 4YLGA 1T3ZA 4NZMA 4A2NB 5LLTA 1B00A 2EPLX 4BC1A 1VPLA 3L0ZA 2MSEB 1ZINA 1H1LA 1DUSA 3UWPA 5THXA 3SZMA 1KEKA 2GPWA 3K6SB 3TNYA 4AKGA 1PU2A 4EBJA 4B3IA 5FTMA 2A1UA 2VTEA 1DKRA 3R3ZA 4OKNA 5GONF 4W7SA 3IUMA 4D0SA 2QP4A 2WOOA 3IPCA 3QF4A 4ALLA 4ZLCA 1EE9A 5AK6A 1Q1ZA 2E87A 2IM8A 4PO1A 1EK1A 5AUQA 3TOLA 3ROZA 2H2IA 1K97A 1QR2A 2F4NA 4JT4A 4I3HA 1L5FA 3EDQA 5J1SB 1D3AA 3IP3A 4WH0A 1EZ4A 3VC7A 1VHWA 3KQUA 2YLIA 5HNKA 3H2BA 5JFGA 3CZMA 2R4QA 3G1UA 3KOOA 4AY4A 1EK0A 4RUKA 3BB3A 3CF4A 4HH0A 4IUBS 2QYTA 3WADA 4HPJB 2QM3A 4NQFA 1PD1A 1VP3A 3ME5A 4IFTA 4IS3A 1UBKS 1ZUD1 2LUOA 3GR6A 4NV0A 2D0OB 4BVLA 2QLJA 1YZVA 4DCTA 3I32A 4ABTA 1WQ3A 5T57A 1SOWA 2RHOA 3QHPA 4ZOEA 3BCUA 3VMMA 1G6Q1 1EDZA 1VLJA 2ZJYA 1C0EA 3S2FA 2GPJA 1VIYA 3SC6A 2YASA 1T9ZA 2PLFA 1WCYA 3PRHA 3VH1A 4CIXA 2GK6A 4CIDA 5FTKA 4CJGA 2P90A 3HN7A 1OBCA 4U63A 1S3GA 4WD3A 5AFSA 2PGXA 3NAQA 1WM1A 3OUTA 4LOJA 1HNZB 4O4LA 1WPQA 4FJ0A 4WXMA 5TQ2B 4K8OA 3SEFA 3U40A 3CVWA 1OXBB 1FFDA 4X3PA 3GGSA 4P82A 2Y0EA 4W6QA 1GPWB 1NXXA 3PI6A 4P7GA 1SOVA 3CPSA 3STYA 5U4XA 4NFYA 4UZFA 3EIFA 2YJTD 3N24A 2ECQA 2W8BA 4D4MA 1YJ8A 2A0BA 3OY7A 4MCJA 5G02A 5G4LA 2YW2A 3GA7A 4CTMA 3GLFB 1NBBA 4MARA 1YR9A 2IGBA 4BNGA 4KNWA 2D62A 3DTNA 3PVCA 4GPD1 3DZCA 4KAJA 3QENA 4YCMA 3UGJA 2V1XA 5FI3A 4DLYA 1UAYA 1D5CA 3S70A 3B3AA 1GYQA 4J7YA 1ZEJA 3LFTA 2O5EA 4RLSA 1B8UA 1DMRA 1R6VA 2ZRDA 4G8CA 3TOSA 1WJGA 3DYVA 4MRMA 1GSHA 3BSYA 1LH0A 2BI8A 2CD7A 2CXNA 3K73O 4PBRA 4ARUA 2GTPA 3KHUA 1PQ4A 4AYWA 2YFQA 3ROXA 3JYYA 3NHAA 3I5AA 4PZAA 1XEFA 3W06A 2C84A 3JWPA 1A0OA 5AXAA 4ZZIA 5CPFA 2I7XA 4GT1A 2OAGA 2JRCA 3KQKA 2Q8PA 4QUAA 2JAQA 1L4EA 4CL0A 3P9YA 4WFJA 4CS7A 2X23A 1E59A 2WEKA 4RHYA 5CK5A 2F2TA 3WGYA 3JZ0A 4ZVKA 5IK2D 1Y8RA 5IS2A 2AKEA 4N5IX 4IX9A 5M2QA 2HCJB 4N48A 4NFHA 2PS3A 2QXYA 2RGUA 2DYRC 5EK0A 4IQGA 1WF6A 1JHMA 5JJCA 3U60B 5KKNB 4QXRA 3SI7A 4XPIB 2WVJA 4MWOA 3K16A 4KO3S 1NNUA 5BW6B 4BZXA 5EP4A 3RGGA 4N6OA 1PWXA 3CVUA 3L7OA 2PL9A 2EFHB 1JIIA 2YBEA 1S4QA 3ZDZB 5DNAA 4YIHA 2UVDA 3K53A 1NOIA 2Q5LA 4H1VA 3AR2A 4IBOA 2QLAA 4R0NA 2FUG1 5F9HA 1P61B 5F23A 5GZ3A 3FB1A 2FSVA 2WU3A 3VTAA 4ZDKA 4ZV4A 1MTZA 1VLQA 2AMJA 2IEZA 3LCVB 3ONWA 4IIVA 3DEZA 5J1TB 3VI4B 1PNRA 4KDCA 2XUGA 2VF2A 3QPUA 5K3DA 1WZIA 4PYRA 1E1RA 1PV3A 4E6EA 4FYIA 3OTHA 2X13A 3O82A 3P9PA 1S7CA 1A5ZA 1DJOA 5KOJB 2GPTA 1KMCA 4CUKA 2BGMA 2R4TA 3H1TA 3K9BA 5EZ5A 4GU5A 1E0DA 1QFMA 3OUZA 4ZT3A 2ASRA 4OD5A 2FPPB 4YP9A 1FVHA 1M66A 1Z0JA 3ECCA 3H75A 1EEHA 3R2JA 1BXRB 2FWRA 4GM4A 2GO7A 3TLGA 1YI0A 4C0LA 2EPMX 1B23P 5H02A 3A4VA 1YULA 3QBVA 3DXYA 1PFGA 1GD1O 3EZYA 4RZHA 2AU5A 4ECAA 1BHJA 4MKFA 3AK4A 2QAGB 1ILEA 1JVSA 3G0GA 2C5GA 4P4UA 1VPDA 2BTQB 2XUFA 2WR8A 4K0KB 3B1WA 3RU3A 4MI6A 1WG8A 1EB9A 2CC2A 3DBHA 1X8XA 3JYQA 5KU7A 5BOSA 3ENQA 1ZJYA 1EXWA 2Y05A 1XU7A 2VRBA 1Z33A 2F64A 4BV2A 1NU6A 2BMEA 3RHFA 3VU8A 5CI9A 1L9XA 4F6CA 2P9BA 1CF9A 2ACEA 4MAFA 3V6MA 3PKIA 1XMSA 4AL0A 1PR5A 4ZCLA 1FMFA 1FQKA 4J30B 1Z4LA 1DX4A 2P41A 1E1YA 5HBRA 2J9FB 4FDLA 5DISB 3WK5A 1EFAA 2JZCA 2PMWB 3D6UA 4FS8A 4BRZA 4CKXA 4M6WA 1GCUA 1XX6A 3EY4A 1K7YA 2VWGA 4WZAB 5KAPA 3PLNA 1VKOA 1WN0A 1JRAA 3OEEA 5B1BC 4QI0A 3G6WA 1BKYA 2PT7A 4PJJA 1NURA 3RSZA 1WGWA 2BN4A 2VQ6A 4M7RA 3M15A 1U8XX 2VCEA 5EFOA 3RI3A 1J9ZA 1XZCA 4F04A 1XU4A 3MUOA 3IC5A 3G8AA 4R2HA 1GPBA 3MD0A 3FDFA 1MPTA 1UBCA 2MR6A 1TD9A 2JJYA 1U7UA 5EJ8A 2P69A 3BTUA 2HSDA 1BYUA 3S2UA 3SS9X 3Q0EA 3WQRA 4WBSA 1M34B 4UEWA 1EUQA 2QV0A 3COWA 4ZI5A 3WFZA 4RTLA 2UZ4A 3T1HB 3W2HA 3CLRD 4RENA 5F4BA 4BVGA 1G42A 3EXG2 2PMKA 4U5QA 4CKYA 3DWFA 4GPBA 3NV7A 2J5XA 1T5IA 2DSNA 2YWBA 2JFZA 2YH2A 1GFIA 4BJTA 4RK7A 2J5BA 2O3TA 3A9TA 2A67A 3OD1A 4ZRNA 4N47A 1LPSA 3PEFA 3PQ7A 4U5BE 1NR7A 4MR9A 3LT2A 3WLNA 4AG5A 2OU6A 2HTFA 4X1IB 3NCHA 3WLRA 5JXHA 4DV2B 4RNDB 1JFTA 2YDXA 4ROTA 2BISA 4GKBA 2CLKB 1HFWA 1QJ4A 5K51A 3RROA 4GOKA 3UXHA 1QX3A 5CLQA 3VAAA 3JD0A 4IKEA 4FWTA 3QWBA 4NOKA 2SHKA 3L1IA 2QLFA 1J8VA 4YHBA 1CK4A 4LZOA 3OKPA 1B0ZA 4J6EA 1L8XA 3G49A 4NYIR 4PCAA 3WK6A 4EJSB 4X90A 3ETDA 3CEAA 5TMDA 4M9SA 2IYXA 5AJZA 3W5BA 1SCBA 2FN9A 4X3OA 1IHPA 4XVCA 2OHJA 2GCNA 2R3SA 2O8DB 1T3GA 3D59A 4PJMA 4KN5A 2L19A 3W7AA 5I51A 5TPZA 5I48A 1QP7A 5C8YB 2YMPA 4XPXA 2WKQA 3VSAA 3VBCA 1TQ8A 3IOMA 2AXNA 3RS9A 1D2GA 1OBFO 3N74A 2LFFA 1OA1A 1O96B 4EZIA 3GMTA 4YFYA 4MW1A 4YJFB 4WE3A 4CIWA 4AIIA 1GOTA 1O89A 2WHPB 1JMVA 3ZC3A 2XQGA 3K09C 4MS3B 3UBTA 1C9JA 3OTGA 4EG4A 2ZR7A 1GNQA 1I5RA 2EZ8A 3H8VA 5FBRB 4CI0B 4B40A 4L4XA 4J0QA 1U8AA 2II6A 2HA6A 4RK4A 4B34A 1VG1A 2J5KA 2PDAA 3IERA 3K7EA 1A97A 1UFOA 5E33A 1DNPA 1X80A 2PZEA 2PL1A 2YWXA 3E3NA 3OLWA 4CR6A 1PJZA 1P81A 1L5QA 1SBNE 2IJGX 1XHEA 4GSKA 3H7AA 4OBWA 4URHA 3HLZA 4YRLA 2IK8A 2OD2A 2YXBA 3B1KA 2I76A 3DZIA 1NN3A 4JSRA 2C00A 3PFBA 1MEOA 3ND8A 4PR0A 5IANA 3FZNA 4G5HA 1GY8A 1OYOA 5TQ0B 1YU9A 1TF7A 4OOFA 4CEJA 2IWHA 1AT1A 4R32A 3DZDA 4L28A 1FXUA 2QVZX 1YAJA 3X1YA 5L3SB 1GPMA 5KHLB 1I3NA 2ORIA 3UICA 5HP4A 2BONA 4OEHA 3E05A 3OEHA 4XM2A 5B1HA 5L0DA 4BRWA 1UXOA 4CHTA 2VSNA 3RVMA 4F2DA 3MLEA 1N3YA 3JSAA 4Y9DA 4OXYA 3M6UA 5C8XA 1PUXA 4BNUA 2VBIA 2DFVA 4ZP1A 4C30A 4NQZA 3TR5A 1EU1A 1L4FA 2UVPB 2ZIAA 5ELMA 3TSAA 3VU3A 2XTAA 3IRUA 2NUAB 4YK7A 2CHFA 2ACWA 3CLTC 1KY4A 2I2XB 2OV1A 3HLYA 5DI3A 3RYIB 3JVVA 4D1YA 3PGKA 1N6KA 3GBPA 2R6AA 4PSVA 3T9CA 3VV2A 3Q3EA 3FVYA 2CXSA 4NNPA 1BX3A 2X4IA 2YRWA 3R0ZA 3AG1C 5COBA 1B68A 2O8EB 1XKTA 1FW8A 1J5PA 4FW9A 3VH2A 1UWLA 1WXFA 1GIAA 3TW0A 1L7EA 4EI7A 3G4XA 3OZCA 1LUAA 2PLWA 3RHSA 4H7PA 2O8NA 2R25A 2I3GA 1IOZA 2WD9A 3L1JA 3C3CA 1ULBA 3CEJA 4YRIA 2ZYGA 1OU0A 3FOBA 1F2DA 3ORRA 3TOZA 5IVPA 2VJOA 1QYIA 1U0JA 3KQLA 5BQHA 1EI7A 1L4YA 1SBTA 3Q3HA 1I7NA 1F3LA 1MHPA 1ZZEA 2C4NA 3G9ZA 5EIAA 3WSWA 4A92A 3ZLJA 1VB3A 5H70A 4S1WA 1XC7A 1IHYA 3H99A 1XJWA 4HNHA 2C92A 2LNDA 3L7NA 1U8UA 1GKUB 5HMMA 3SR4A 1NJ1A 1D0VA 4C3VA 2HR1A 1I0ZA 2VBGA 4GX1A 2EU8A 1DAMA 5C1BA 3NUQA 3VZPA 4Z3OA 1Z06A 2IL1A 4IDCA 5FOXA 2HMSA 3WLOA 1RZRA 5EXTA 3JWEA 2V74B 1CQIA 1W8IA 3W4JA 4TXHA 4ZVLA 4E11A 4R1OA 1PKEA 3WLTA 3HGQA 2NSDA 5K4GA 2REBA 3NFYA 2XOKD 2Q99A 2ZPTX 2D6FA 5FPKA 1QH8A 4YCBA 4CEJB 1PW5A 4TKUA 2G6BA 4IV5A 1IQUA 4JLBA 4GWGA 2O2ZA 1NQWA 1R3DA 1A5BB 4PG7A 1J4AA 4QLOA 1X70A 1A4XA 4BY9E 4FYPA 4YP7A 4CMIA 5J9FA 2ATCA 1MQ8B 3PS9A 5FLEX 5BN5A 1HW2A 2D5IA 1JAFA 1T34A 2P78A 3K1JA 3N2NA 1O94A 5KAMA 2ORED 1AUXA 2ZAYA 3O8QB 1KQ3A 3RUDA 2FEXA 3IT0A 2CLEB 2YHUA 4RAQA 4X64B 3PXAA 2JGIA 4C89A 2C95A 1ZNWA 3O3NB 1R00A 2ZB7A 2YWEA 4BFWA 2ZCJA 5CNMA 4EATA 1N2HA 2GBCA 4LV5B 1XVVA 4NV3A 3RU2A 1JKFA 2D7CA 1PD0A 2WHRA 3FYHA 5AVQA 3O75A 2VA9A 2B8WA 4MW4A 1NBME 2X1LA 1JDSA 4H7IA 2V65A 1E3TA 3BXPA 5FKJA 1LLCA 1N6HA 2ZSKA 3GELA 1T5SA 3VO1A 1C1XA 1V5IA 2JAPA 4KMSA 4N0QA 1TRHA 2RAVA 4NYMQ 1DI0A 3GFQA 4EF5A 3GCDA 3DKAA 4AN0A 3S7TA 4B87A 1QVVA 3H1PA 2X6TA 3I4CA 2RH8A 1ANKA 2RGNC 4RKYA 3TJRA 1PDWA 1WW2A 3PJRA 4ASUA 3TXXA 3ZY3A 1B0PA 2IBSA 2X9LA 3HFSA 3ZLBA 4A91A 4PN3A 4JUIA 4QDOA 4LCEA 2FMIA 3HYTA 3Q1LA 4LKOA 1BH6A