3SP1A

Crystal structure of cysteinyl-trna synthetase (cyss) from borrelia burgdorferi
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
469
structure length
418
Chain Sequence
MILKLYNTRTKDFSELTNFENVKVYACGPTVYNYAHIGNFRTYIFGDLLIKTLRFLGYKVNYAMNITDIGHLLTVYEISEFFTEAFFNDCRKLNIVYPDKVLVASKHIPIMIEVVKILEEKKITYFSNGNVYFDTSCFKSYGEMAGFKRNKTDFVLWFTNSKMKWDSPWGFGYPSWHLECAAMNLEYFKDALDIHLGGVDHIGVHHINEIAIAECFLNKKWCDVFVHGEFLIMDFITVKDLEDQNFSPLDFRYLCLTSHYRNQLKFSLDNLQASKIARENLINKLSYFYESLDPVDLNTLNKDLKNFGFSVEKEYYDSFVEKISFDLNVAQGLALLWEIIKSDNLSFVSKLRLAFIFDEIMSLNLREEILKNLQNHDVVIDENMKALIEERRIAKCEKNFKRADEIRDFFAKKGFVLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteinyl-tRNA synthetase
publication title Ligand co-crystallization of aminoacyl-tRNA synthetases from infectious disease organisms.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Ligase
total genus 153
structure length 418
sequence length 469
chains with identical sequence B
ec nomenclature ec 6.1.1.16: Cysteine--tRNA ligase.
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01406 tRNA-synt_1e tRNA synthetases class I (C) catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1910 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3sp1A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3sp1A01
3ZGZA 4MUEA 1U3CA 3MXTA 3P0JA 1XJQA 1J20A 1IHOA 1M8GA 4DLPA 2R5WA 3CLSD 5FO0A 5DB4A 1JEDA 4MUHA 4Q16A 1X6VA 2J09A 3FETA 2D5BA 3PRHA 2E21A 3ELBA 1JIIA 1XNHA 1F9AA 3N2YA 4L2IB 4MWBA 1GTSA 3A2KA 2V0CA 1LW7A 3G6KA 3HZRA 1IRXA 4DNXA 3FWKA 4EG6A 1N2HA 4JXXA 3SZGA 1JZSA 2CT8A 2O5RA 1U3DA 3P52A 4X0EA 4JFAA 4WSOA 5J59A 1MAUA 1Q77A 1IFXA 4U63A 4NAHA 2E0IA 1QRTA 4OJMX 3ND7A 4MW9A 1NURA 4YP6A 4R0NA 1XNJA 2JANA 4DJAA 4PY2A 1NUTA 1TYBE 4EG8A 5TS2A 5TEVA 4CDMA 4DDMA 1P7PA 5DEOA 2NZ2A 4JZYA 1KQPA 4U7JA 3N9IA 1T6YA 4U8HA 1EE1A 1LI7A 2DR2A 4MUGA 2GOYA 4ZT5A 2JAXA 3FDXA 1O94C 3IODA 4MQ6A 1TYDE 3M5WA 3SYTA 2HGZA 1KP3A 4KR6A 4PBRA 4FZJA 1I6KA 3BL5A 1O6BA 1SURA 2A1TS 3TQIA 3SEZA 1PFYA 2IP1A 1M8FA 4OUDA 2QTRA 2CYCA 4AS1A 1TEZA 3JXEA 1TQ8A 3IMEA 2IELA 1NUPA 4E1AA 4ZCTA 4MWDA 3UMVA 1RQGA 1N78A 1FYDA 2QJOA 5EKDA 3CVXA 1MB9A 4YP7A 1WJGA 4ZT2A 5HG0A 5LLTA 3FY4A 3GUZA 4G6ZA 4HJRA 3CLSC 5HUJA 3COZA 2AKEA 4XSVA 5FO1A 1QJCA 3QTTA 4ZT7A 3TQOA 4NX2A 2J4DA 1GPMA 1VBMA 4MWEA 4MUJA 1DNPA 3AIIA 1QRSA 2BYTA 3AFHA 4QBTA 1JZQA 2QJFA 3MMXA 3QE4A 4A91A 2WQ6A 3L92A 1OD6A 1MRZA 1D2RA 1O97D 2Z09A 4MW6A 2H29A 2VTBB 1O95D 3DLAA 3GLVA 3I05A 1U7DA 1EFPB 1T9GS 4CT0A 3KFLA 3RJZA 4I6JA 2C5SA 3CVWA 1B6TA 5KHAA 4MULA 3FI0A 4EF6A 2A4MA 1O96B 4EG3A 1QTQA 3H9CA 1G8FA 4PBSA 3UK2A 4NAUA 3VU8A 1EFVA 3IOCA 3X1JA 1KQOA 3ZXSA 3ND6A 2CUZA 2D54A 1MOPA 3CLRC 4EG1A 3AL0C 3RHSA 3H97A 3AKZA 1KAQA 1KH2A 3Q12A 1G8HA 3LOQA 2PZBA 5BNZA 4OUDB 3Q10A 3CLUC 4GU5A 1U0BB 1R6TA 1N2GA 1NP7A 4K0RA 4KR7A 3F3MA 4HPWA 3OP1A 1IVSA 1MB2A 4HK4A 1YIAA 3COYA 2QJTA 5LM3A 1OWPA 1TYCA 4NDAA 1IQUA 3D6UA 1G59A 2OQ2A 1N1DA 4MUIA 2DETA 1WOYA 3RFFA 1TYAE 1IQ0A 1KR2A 3IMCA 4HJXA 5H16A 2A86A 3ZUGA 4PBTA 1I6MA 1I2DA 2TS1A 3ISJA 2XRYA 4YP5A 1KH3A 4RUKA 4EG5A 3HV0A 2WSIA 1G8GA 1J1UA 5KCMA 5IJXA 2BTEA 4BWVA 3IOBA 3VRHA 3ZJVA 3NBKA 4UZEA 4ARCA 4F3RA 1F7UA 4MW5A 3SZ3A 3H99A 1N2JA 1QU3A 1VL2A 3TZEA 3A4IA 1WQ4A 2D13A 2PIDA 1H3FA 1M8JA 2PG3A 3ZXIA 1O97C 2HMAA 2J5BA 3SDBA 1JHDA 3HFJA 3S3TA 3TNJA 1QQTA 3KT3A 1CT9A 1O95C 3RK0A 1EJ2A 3HMQA 1NSYA 3ZJUA 4GRIA 2CYAA 1EUQA 4ZT4A 4MW1A 4AQ7A 2DXIA 2A1UB 3MUEA 3FG9A 4XFDA 1EUYA 1QNFA 2PFSA 3IMGA 5JBNA 5DK4A 5J58A 4I6GA 4S1OA 2AG6A 1GZUA 1Q15A 1Q19A 3ILVA 2V0GA 1S4MA 3CLTC 3IVGA 4KPUB 1ZJWA 1WY5A 1K4MA 1UFVA 1YUMA 1XNGA 2B7LA 2YWBA 4MW2A 1WXFA 2PZ8A 1T6XA 1N77A 1N2BA 3SP1A 1H3EA 3DPIA 1YULA 2CSXA 4MW7A 1WQ3A 3U1VA 2CFOA 2ZP1A 4EFKA 3CVUA 4KR9A 1X8XA 3N05A 1M8KA 1PFUA 1O0BA 4NATA 1PG0A 2X3FA 1T6ZA 2PXHA 1Q11A 4CDNA 2VXOA 3Q4GA 3TS1A 4CQNA 1KKUA 3A05A 3IDFA 2J07A 3MLAA 1JIKA 1JIJA 1HYBA 1JILA 3TZLA 2DPLA 3IVXA 1N3LA 3H05A 1OWMA 2I1LA 1V47A 3PXUA 5TEWA 3X1MA 2QTMA 4ZCPA 1K92A 3C8ZA 5TGTA 1JEEA 4TS1A 1COZA 3K32A 2GM3A 5DASA 3IUBA 2HZ7A 4DE5A 4ND7A 1VLHA 2CV1A 3PNVA 1EXDA 4F4HA 1M8PA 1Y42X 4ZCSA 1U7XA 4UZFA 1M83A 5K0TA 1R6UA 3A04A 1N2OA 1O94D 4ZCQA 5HUHA 5K0SA 3IVCA 1MC1A 2DLCX 1TFUA 3ZJTA 1J21A 3RBAA 3L93A 4R2MA 1NUQA 1ULHA 3UC5A 3FH0A 1VBKA 2G36A 2QUHA 4MVXA 1QRUA 4XFJA 5J5AA 1JGTA 2H2AA 1J09A 1I6LA 1IQRA 2J08A 3NV7A 2E89A 3INNA 1IH8A 4MUKA 3GMIA 2Z08A 1BS2A 3COWA 1PG2A 2DERA 1VBNA 2CV2A 4KKVA 3E27A 4J75A 4JYZA 3G5AA 1NI5A 3H9BA 3IUEA 1N2EA 4JXZA 1GLNA 4Q93A 4YMIA 1M1ZA 4MUNA 2RE8A 2QUKA 2EL7A 4MVYA 2GKSA 1ZH0A 3RK1A 4EGAA 1ZH6A 3DO8A 3SEQA 2JA2A 4YBRA 1ILEA 3K9WA 1PFVA 4ZT3A 1F4LA 2VTBA 2ZUFA 1FFYA 4EG4A 1K97A 1EFPA 2A1TR 2YY5A 1KORA 3D6VA 1R6XA 4I6EA 4NZPA 3FHJA 2O8VA 1O96A 2WQ7A 2AZXA 1WZ2A 3HL4A 3FNRA 3IH5A 3FIUA 4MLPA 1EFVB 2IJGX 4QREA 2RD2A 4MVWA 3OTWA 4MW4A 1OBCA 1NZJA 1H3NA 3CLRD 4DDKA 2Z3VA 1YIDA 2NSYA 1KH1A 5FNZA 4QRDA 1OBHA 4WNYA 2WB2A 1WXEA 1GAXA 2CV0A 3KT8A 3UY4A 3CLUD 3P0HA 4RPIA 1H1TA 1OWLA 2ZUEA 3VGJA 3G59A 4L2IA 2XRZA 3COVA 2E18A 1YI8A 1N2IA 1F7VA 1N75A 1KQNA 4K03A 3QTBA 1YUNA 2A84A 2OV4A 4MVCA 4ARIA 4MUFA 1V8FA 4DDHA 1J70A 2A7XA 3KT6A 1JMVA 1T9GR 4MW0A 1WKBA 1GN8A 1NYLA 3P0IA 1PFWA 5IHXA 2A88A 2X1LA 5KWVA 1O5TA 5AHWA 5F23A 1OWOA 5LFAA 3CR8A 3ZIUA 1WXHA 2QUJA 3FOCA 3CVYA 4MWCA 4H3SA 2DEUA 3LE8A 4ZT6A 3CVVA 2X0KA 5H7XA 3AG6A 1MAWA 3MLBA 3NBAA 3KT0A 1JECA 1LI5A 3LCJA 1MBZA 2PZAA 1NUUA 1J1ZA 3IOEA 1WXGA 3PNYA 3ND5A 3N8HA 3CA8A 4P2BA 2YXNA 3AG5A 4J76A 1QU2A 1ZUNA 2A1UA 4ZCRA 4G5FA 2DUMA 1O0CA 2YWCA 3UOWA 4EG7A 2QUIA 2EJCA 1GTRA 4G5YA 1MJHA 2QTNA 1K4KA 1WXIA 1NUSA 2CYBA 2X1MA 3HGMA 4MAFA 3X1KA 1OWNA 3DV2A 4R2LA 1KAMA 1KP2A 4KPUA 1A8HA 4ND6A 3PNBA 3CLTD
chains in the Genus database with same CATH superfamily
2TMDA 5KDLA 5FUMA 4GI2A 3DZHA 1MH9A 3OFKA 3N75A 1NLFA 3D6TB 2V7VA 4CRWB 5KO2A 4K26A 2FWMX 1V4VA 1COWD 1EP2B 1DS6A 1UBCA 3SZGA 4MYTA 3SF8B 4EI7A 1J0CA 2MSLA 2FKNA 4P58A 4Q1BA 3TVDA 3V8RA 1Y6RA 3WHKA 5MFZA 1M0TA 3V80A 3DPSA 4DJAA 1XRQA 2YIVX 1XQ6A 2QGZA 3BWDD 4R1QA 3AF4A 3PYLA 4B3DA 3HO8A 5JJBA 3V8MA 2XMRA 2A1TS 4CR6A 3FCOA 2YL1A 4AWXA 1LKZA 2AUTA 2JFVA 1K8ZB 2GK4A 3KVRA 2O2JA 5JSUA 5CEJA 5EKDA 2GNOA 4R1NA 4MYCA 4QTYA 1NVWQ 1BU5A 2ZSKA 5T3UA 2G1AA 3AR4A 3QBJA 4RDXA 3V4VB 2FVXA 2WFLB 4E5NA 4LJKA 5BR7A 2GJ8A 3UFBA 1KMIY 4OJQA 3G5UA 2YKZA 1OFVA 3HN2A 3H9GA 3LC7O 1MFZA 3DM5A 1CJMA 1I0IA 5C7IO 1GIAA 4R98A 1LM3B 3IBYA 1XLWA 3DOJA 3R8FA 3PGJA 2RCNA 2RHDA 3HCNA 4INJA 3KPJA 4KR7A 1I7PA 1N6LA 3OP1A 2FU5C 5GQSA 1Z37A 1DC8A 3ECSA 1AQUA 1IIBA 4FHZA 4UDVA 4LNAA 1D0IA 3EWSA 1N1EA 1FSPA 1PGJA 1TL7C 4JVSB 2WT9A 1JR4A 3NBKA 4P9NA 5HE9A 1IXZA 5DQZA 1NBHA 3HKCA 2OZLB 2BGUA 3C1TA 3N3BC 1CF2O 1DRWA 2FLVA 1H0RA 3ZLTA 3FAKA 3EJ6A 3PX2A 4MEJA 4OIRF 2P0YA 2WMDA 1FMLA 1KYZA 3TAXA 1KZ4A 4NBKA 1IWBB 4E51A 2JRCA 5C8YB 3Q2IA 3KXIA 2PP4A 5H3LA 3VU0A 2NVBA 3LPDA 4F9TA 2OAQ1 4OD5A 3AETA 3DA8A 3V5YA 3IHWA 1I3LA 1FDOA 5HW0A 3EPRA 3P27A 3EWIA 1EVLA 3DT9A 2BEVA 1BSVA 2VPWA 2CFSA 3SLKA 1QR6A 3HRHA 4XYLA 4MPRA 3U09A 3K0SA 2FZLA 2R6R1 1QRDA 3FZYA 3QX3A 1I4TD 1SY7A 1ZK3A 1G2IA 4IDBA 1IEXA 5IDXA 1FUUA 5IABA 2CMFA 1YOBA 1SCIA 3K0CA 3RAEC 3U4CA 1TADA 4DV2B 1RXUA 3K0EA 2QUHA 4MIOA 3PS9A 3HUUA 2CBXA 2XAAA 1GV1A 4JIMA 3A0RB 4TT8A 2WJ6A 4JKOA 3DDZX 4XLLA 2W2LA 3LK7A 3KYDB 3BQMB 1WG8A 3MILA 1H4SA 4JP5A 4D0GA 1C4OA 5L4LA 4AVYA 4J2HA 4IUDS 4ZT3A 5TQJA 2FOIA 1C0LA 2BGLA 1JX6A 4LOJA 1MQ8B 3REQB 2E4VA 1IUNA 1FOEB 2JGDB 2ATEA 1YRQA 4ZU1X 4BYMA 5LCXA 3RFXA 2J8ZA 1OH7A 2Q0XA 2W2NA 4ZXPA 2Z3VA 1U7PA 3H04A 1NTRA 2VP0A 4MLZA 3AY6A 5K0IA 1MV5A 1HEIA 1T3ZA 5KHOC 1J0EA 3PXGA 2CBZA 4OM7A 1N75A 3M2PA 4ZOLF 2DH5A 1U8TA 2J3JA 4LKOA 2EAUA 2RHOA 1NVBA 1KMQA 4K6GA 3H1AA 4TXJA 5JLAA 5BR8B 3HQ4O 3WZ2A 5E6SB 3NWBA 2NT3A 1L4KA 2H92A 3V1TC 3OIUA 1IN4A 2VDUE 4M1KA 2D8AA 4KAFA 4TYMA 3WYGA 5EGNA 1YE8A 3JQGA 1N1CA 3EQZA 4DLPA 4HNUA 4CDAA 3GLGB 5FO0A 5JSKA 3VX3A 1I3MA 4ARVA 2HHLA 2PXAA 5C34B 2L2QA 4CS8C 2OYRA 1U11A 3GT0A 1CQZA 4UEQA 1DTEA 1UBEA 4EYQA 2ZJ0A 4QFMA 1OGJA 3TINA 5IT5A 3RHFA 1NBIA 3LY9A 1OA1A 1O6ZA 3L0IA 3KJXA 4Z4FA 1GL3A 2VBIA 1IY9A 2BL2A 1NW7A 4XFKA 5MDHA 3C3MA 5KWJA 2IP1A 1YB7A 1ABFA 3T52A 3DYIA 5JNTA 1BG6A 1WB9A 4XRGA 3OF2A 5DM0A 2J7PD 4LC1A 1YLMA 3GFTA 1FNTc 4JC8A 2C94A 1JHVA 5DI3B 1FK8A 3TEFA 2JIZD 4QU9A 1GLGA 4XWYA 4Z5XA 2JIDA 2ZPTX 1Z7GA 3O4JA 3ESZA 3Q0EA 5GONB 3P9RA 4N9QA 1W0JA 2ZTVA 3EXFB 4RA9B 4TKMA 3AWDA 1MT3A 1USVA 4RJJA 1GT91 3K6RA 3KSBC 3IPMO 4QYXA 8ADHA 2QVLA 3UOGA 2WWTA 1K0UA 4C06A 4Z8XA 4ND1A 2H2DA 2RJOA 1UH5A 2XMBA 3JTLO 3AKZA 2DE0X 1FZTA 3SKXA 4O5OA 3WL4A 4NZOA 4PLPA 1X42A 2QLJA 3WLMA 4H60A 5NLLA 3A6ZA 1TMKA 1DINA 4A2NB 1JVBA 3T35A 1T5HX 3LPNA 4S12A 1ISFA 4MI9A 1VOMA 1D2EA 4BDSA 3L43A 4KBGA 2VSXA 4MKIA 1AJEA 1EDZA 4A2WA 3LXXA 4MEBA 4J30B 4HRAA 1RWMA 4FS8A 5EYPA 1EAMA 3RU2A 4AMVA 4ER3A 2HA7A 3NR2A 5K8CA 1HTBA 4L51A 2HEIA 2C9CA 3OZTA 2RGYA 1ECLA 5CA0F 3LAWA 1KEZA 1OIXA 2ETVA 1ZJWA 3N2KA 3PEEA 1JW9B 4L72A 2V6BA 1NJ6A 2A6EF 5AC5A 2C2WA 4YRRA 1TVEA 1J7JA 4EFKA 2XM4A 2EZTA 5EGSA 1RXSA 1U7WA 5ALVA 4JLKA 3FNGA 2XNDD 1G42A 4AKSA 4HQLA 5M04A 3FUCA 1DAEA 3A28A 3H2JA 2V6JA 3KV1A 2G3KA 3OOEA 3RVQA 1W1UA 3TR6A 3PNVA 1B0ZA 1CJKC 3W7BA 4BMZA 4JVOA 1UL1X 2XQVA 3E35A 3PJEA 3KE9A 4CW7A 5HYVA 1AK2A 1ADFA 4YO7A 2O1WA 1Z0ZA 3L93A 3TFQA 4OV6B 2MMCA 1MEEA 4ZLCA 1H65A 1OXMA 3C97A 5DT2A 4X8OA 3B0UX 4BX8A 1G8YA 1WMEA 3VOSA 1Y1KE 1X74A 3FB4A 4I8DA 3TGWA 4XEKA 4DUZB 3EG9B 1M1ZA 4AL1A 1GCAA 2QW8A 5B58T 2HJHA 1XDWA 2IXNA 5EQJB 5DSZA 5FPYA 1ZKDA 3G2PA 3WB9A 4EKYA 1K7FB 3H6KA 3NFRA 1VP9A 3MWDA 5BRJA 4Q4LA 3WO0A 3I9OA 1JQLB 4GXTA 4B46A 4YPVA 3SXMA 3DVQX 2CV0A 3U4QA 3RFUA 2P5SA 3ZWVA 1IM2A 3NKLA 3ZCSA 2P40A 2OBFA 4LEIA 4BVLA 4D81A 4KK3A 1I7DA 2C4NA 2X1LA 1WUKS 3VNAA 4IF4A 1JUDA 3V7NA 3QVXA 1DG1G 1M0EA 2PPLA 1ZO8A 1TA0A 2FWRA 3Q7GA 5EWMA 4NVRA 5ESDA 4FOPA 4G84A 3ND5A 2OB1A 4EMBA 3IT1A 5JUWA 4GP7A 3VNSA 4KUGA 4F8JA 4Z9JA 4KXXA 3QVZA 4MUYA 4AULA 1AKMA 3QKIA 2W2PA 4JOQA 1TEXA 5LKAA 2XNJA 2C1XA 3VKVA 4BLPA 3FYUA 4PSCA 1U6KA 2G82A 4HLDA 1X7WB 3PQEA 2JNWA 2X41A 3SBXA 3NNDA 3PHJA 1NVKA 4IKPA 4DEYA 3SG0A 1X3LA 2GA8A 4BY9E 3OCZA 1TO2E 1O2DA 2C5AA 1JKJB 4D3ZA 2BWJA 4ZREA 1WSDA 1OCCC 4D2IA 4EF4A 2I3BA 3WRYA 3TOLA 4GX0A 2ETXA 1SIUA 2R6HA 4M0PA 4DWVA 3M6UA 4FYYA 2JFHA 4GMXA 1JU4A 4MV5A 1K66A 2FR8A 3RUEA 1RZ3A 1TF2A 3F4KA 5JLJA 5HTOA 4I08A 4KMSA 1WB4A 2FPXA 2IXFA 3DV0B 1Q91A 4E15A 1JZQA 4FOSA 1TF5A 4YCJA 5AXAA 4LF5B 2X2FA 1B14A 1UG7A 3NDRA 1EFRD 1ZGBA 4MROA 1O1YA 5DWVA 2GTHA 2YWFA 4WNAA 2EEZA 1P4GA 1ONSA 2GSDA 2XXJA 2BFWA 2O3SA 2OHJA 1FJGB 2E4AA 2F1IA 5JXGA 2FMHA 2Q1UA 5FBZA 1NPDA 4HJXA 4RGQA 4UHFA 5DMXA 4ENPA 1VE9A 2QQ5A 2P6OA 1TCCA 1LFAA 3SZRA 2IUTA 3OPVA 3PIDA 1YBFA 1Q3TA 4BUJA 2IGTA 3F2IA 2BUBA 5JIBA 2VDPB 4O4LA 3GLHA 3W8EA 4Z7QB 4UM9D 5E3JA 2XLWA 3KD2A 3PX7A 4GOLD 2O0MA 7ADHA 4D9JA 1HMPA 5IJWA 4R1TA 3O39A 1HSOA 2C9YA 1TK9A 3QVJA 4LI0A 4XJTA 1EA5A 2CHGA 4JDUA 1QOZA 3V5NA 4N7JA 1IONA 1RCTE 4A6PA 5LP6C 5J2TF 3SE7A 2RDMA 2CZGA 3O26A 1FEZA 1QO0D 1IJFA 2PX5A 2PGXA 4LRUA 4C1BA 1Q3HA 4RESA 5HF8A 1LV7A 4I1YA 4RTOA 5CAEB 1ZR2A 1M2NA 5LL6P 3D6NB 5L7WA 3ZKAA 3IIJA 2JVJA 3EEOA 4OQDA 2GH1A 2PD4A 2DM6A 3ZHZA 1ORVA 3L8GA 1AF7A 5CX1A 2IBSA 1HM5A 4BGUA 4QNMA 1LS1A 3DDWA 3PDIA 4XZ3A 4JEIA 4L3WA 2G8LA 3DMFA 4Z9YA 3KPYA 5A7FA 1IBKB 3WX0A 1T9HA 5DDIP 2ODEA 2EARA 1SYQA 2YN2A 3L84A 2IEZA 5JJKA 4W7IA 1S5PA 3BCUA 3K1JA 4R9NA 5F4ZA 2P1AA 2NSYA 2ECPA 4YRSA 3PFHA 4CLOB 5U9CA 3P45A 3VPAA 4OAQA 4JEMA 2QIOA 1GGFA 2WE8A 2WWWA 4DJDC 3OM8A 2ZRLA 1I3OA 2DPGA 5DHQA 3LWZA 2PT5A 2FEAA 2W22A 1B3BA 1G4US 1WKBA 2C7BA 3JQAA 3FGPA 1NW3A 2JFGA 2O6LA 1LBQA 1Q1ZA 1OCEA 2HIAA 3SKVA 3D4IA 4DTCA 1KTVA 2CF6A 3P4UA 2BEJA 3LUGA 4CXMA 4A2PA 2XNDA 3R40A 2H51A 3D7RA 4ENUA 3DC2A 2HA6A 4CEIB 4Q47A 4JHLA 3OKAA 3KQHA 4Q39A 3DZCA 1YXMA 4DIEA 2B2CA 4A8JA 4L2IB 3CO5A 5FQNA 2B5WA 1RLUA 4QOIA 1U04A 2H5JA 4JXXA 1U0FA 5IAJA 3KELA 3RUIA 3QVOA 1DUVG 4PYQA 4M1QA 3L9WA 3PFFA 2NSDA 1P75A 1W4ZA 3EW7A 4EDHA 1J6UA 4HHEA 1R27A 4XPZA 3RVSA 4R8LA 4PPYA 4FWTA 4UFNA 1SKBA 5AGFA 1AZTA 4JC7A 4ZKDA 1E4VA 3QJGA 1EI7A 1NVVQ 2YW9A 2PUVA 5A7HA 4HZGA 4EX7A 5CPFA 4BFSA 2ZTHA 3WP0A 1JA9A 3G7UA 1RC8A 4MLDA 2XWBF 3HDYA 1Z25A 3FJOA 4HP8A 3CNBA 4I5GA 1A69A 1J9GA 2P6MA 4IVPA 3B51X 3D64A 3K0KA 4IZHA 3LUTB 3ROXA 5CX4A 1PCXA 4ALLA 3JYNA 1XZDA 1X0VA 2NUAB 5GOZA 2IUEA 4JYBA 1U1IA 3N07A 3L34A 3WJ1A 2ID4A 2WWIA 3NP7A 4R1OA 5HTKA 2RAVA 1MOPA 5HS6A 2V7BA 3N24A 4P2GA 4FWVA 4BRZA 2GPJA 2NUTB 5EJEA 4Z1OA 2HWUA 4KTTE 5B12A 3KK0A 1ZGCA 4WMLA 4NDAA 2JFYA 2WOJA 3EZ6A 1Z4IA 2Q4BA 1G21A 3PTZA 2W37A 5EJ8A 5DH9A 2GEDA 1R5JA 4I55A 4KO1S 1X9HA 1VMEA 4N6GA 2X3YA 4CEJB 2FPIA 5G53C 2FWPA 4A3SA 4BAZA 2JLCA 2OK8A 3Q6MA 2XUIA 4IAQA 3ZHOA 3TZ6A 4ESHA 1BGWA 3V6MA 1WXWA 2RI1A 1DG9A 2PFSA 1RCUA 4L22A 2DQSA 1N6KA 4H7DA 2M6KA 4EEXA 3QQ5A 5LLSA 3JARB 4EMUA 2WD7B 1CZHA 1AN9A 1Z15A 1R3DA 4FDLA 1WCXA 1CZOA 1PKXA 2VRCD 3U44A 2JI6A 1U0OC 3PEYA 4GVPA 4K88A 4OJKA 1QZTA 3GMSA 1KJWA 3GUYA 1V4NA 1VCHA 2ZYRA 4LXYA 3V46A 4Z9AA 3C5CA 3S44A 2YC4C 1RPJA 3MERA 4KN5A 2G88A 4PE5B 4B2LA 2GTIA 4BFWA 1PVOA 2JIQA 4QE3A 2HH9A 5FLXA 1S96A 4J7TA 5BPHA 5FDFA 1X38A 4EWLA 4ZC1A 5HDBB 1FMJA 3CTPA 3CT6A 3PSAA 2FDCA 3T15A 1Q7CA 4A16A 2OV1A 1FVXA 4NEHB 1U6HA 1YE3A 1CS4C 2K5UA 3SQOA 2EX1A 5L0IA 5DXFA 1A82A 2CK3D 1NAHA 2QTHA 3QA9A 1H66A 1RMQA 2WT8A 4KQHA 4BNDA 3QFFA 3KT8A 5FUBA 3DG9A 1P2SA 1XB2A 2EPMX 2IOYA 4F91B 4B3HA 4Y1RB 3MCTA 5DYYA 3RBZA 3T7EA 3B6EA 2XMSA 4HDMA 3LBIA 2RG1A 4R8KA 4V0LA 1W44A 4RTKA 4X1IB 5CXSA 3ZGVA 3C6YA 5INTA 3D0OA 3ABMC 4HPXB 3W8DA 5H7XA 3UUWA 2PVPA 2WHPA 3LT5A 3VTFA 2CDNA 3BWXA 4PJLA 2I2WA 1M74A 3VKFA 1P2FA 4J3JA 4NIMA 4CQLA 2H65A 3RC8A 4G7OF 1W0KA 1P33A 5HIIA 4FGWA 4PR9A 4AJPA 1QO0A 3S5UA 3ZDEA 5KWEA 1JIIA 3SIWA 2XCLA 1ILWA 2KM1A 4W9MC 1E79D 4M22A 3PNPA 4U6QA 1AY0A 4EBBA 3V2HA 4HZUB 4ZRNA 5KNCA 5KJEA 1MNEA 5K09A 1LPPA 2V74B 2HPHA 3FJYA 2A30A 3C5VA 5AJVB 2VRNA 4U00A 1T3HA 1WNTA 1P5JA 2LSEA 4RVHA 3CE9A 2JC3A 1GYQA 3ESQA 4XE5A 2KX7A 2F48A 3U81A 2ONKA 3E05A 3UHOA 3B3JA 4MUXA 4GRDA 1SVOA 1UBRS 4DCGA 2DY1A 1B74A 4RZHA 3VOTA 4WX2B 1PD0A 3BFPA 3I8SA 3ET4A 1IHXA 1Z2CA 4HJRA 1NSFA 2BAGA 1U8CB 4H1HA 4ZCIA 4DNFA 1QRSA 4DVGA 4XIIA 3TCNA 2C4MA 2XWPA 3VO2A 1RAEA 2HIMA 4AL4A 4MRRA 3D4LA 5CFLA 2YS7A 1R74A 5JJIA 1V9LA 4ZVLA 3I52A 2WTBA 1P5HA 1WTCA 1HW1A 5J2UF 3ZQ4A 5DM2A 1QLHA 1QTQA 3QUBA 1V8OA 2VSOA 4X54A 2VUUA 1JYSA 3RC2A 1H2AS 2H8GA 3QKRA 3KB8A 2AN9A 3BTSA 2HFIA 3F3YA 2WFMA 2WY2D 3OZFA 4B2IA 4ER5A 5PGMA 4PQEA 2A86A 4J3FA 4EM6A 3RM3A 4MAAA 2PRSA 3RO7A 2WSIA 5JRAA 4BZQA 2XV1A 2VJNA 3K0CC 5ALGA 2ZI4A 4L0QA 4RULA 3LNMB 4HEA1 2CFRA 2QTVB 2YCBA 4IDAA 4RM3A 3KLMX 2VJMB 4HDRB 3NWJA 1SXJB 4RTJA 3D4PA 5JRDS 2Q27A 4E1BA 5B37A 3PITA 1JFLA 5JYCA 3B7GA 4NWIA 1DUIA 2QN3A 4AT1A 1XKQA 4G9EA 3JYYA 1DHRA 3PCRB 4GMGA 3L7OA 2Q9BA 1J1IA 1ZUHA 2QP3A 5DGDA 4TKLA 1AEPA 3EZYA 2HEGA 3F4LA 2WB4A 5ILGA 1FQJA 2OXIA 221PA 5GZ1A 3PWTA 1CY8A 3CB2A 4MPPA 3T7AA 3B6JA 2PYDA 1XZCA 4MB2A 4C0QC 2R00A 4DJ9A 4ZVMA 1L7QA 2CB9A 2CXTA 1G0NA 2I54A 4E5YA 2EKDA 1GJRA 1YMQA 3VHXB 4I4LA 2D5AA 2W6IA 1AKVA 5IF3A 5ITZB 1US8A 4ZIRA 1G1AA 1BD4A 2CNKA 4RBNA 3B1JA 3QTHA 4CLRA 4TV8F 2WF6A 3D7MA 3JVDA 4U3JB 1RHUA 3ROKA 3G9QA 5JH7B 5DIFA 4P8RA 1XWFA 4MQEA 1N5OX 2JF0A 4W1QA 4KQGA 4CFYA 4OREX 2O2CA 3FIUA 3N76A 3GRUA 5GJVC 4YCAA 2PNJA 1S01A 1T5DX 2HHJA 1TIPA 4KGDA 3RASA 3ZS8A 4D6XA 4M0CA 1IATA 1WHTA 5AVOA 1E3MA 3I6BA 4KYTA 4HXEB 4ER6A 1O9GA 1Q3KA 4FFPA 3SZMA 2Q6IA 1NI4B 4RS3A 1JPJA 1KIFA 4ILEA 2HV9A 4I0WB 1G38A 3C3PA 1QB8A 1QV7A 2A0KA 2WNIA 2CFIA 5GJCA 2QUJA 2FNAA 3QF4A 4IRUB 3EVDA 1Z83A 1RHJA 3QE2A 3TZKA 1R50A 2K87A 3AG5A 4YJHA 3L6DA 1YCHA 2ROQA 4DSNA 1F4VA 1M54A 3UHJA 2VRCA 2BGNA 4TZ6A 4ABYA 1MDFA 1WKCA 2EFCB 3BSSA 3GWGA 4QICA 1C7EA 4IDDA 5BV7A 3F8WA 5K20A 4GXQA 4RJTA 3QU4A 5LIRA 4JXKA 1WUHS 2X5JO 3AERB 5AKGA 3VFDA 3K9NA 1DIHA 2L0XA 1N3IA 5HBRA 4A4DA 1OUMA 2D00A 1FRZA 1II0A 3QGMA 1RYEA 2I1VB 3G2KA 5I45A 4IZOA 4JZYA 3T61A 3WGMA 3U9JA 4LJ8A 3JV7A 4H17A 2UDPA 2XL4A 3ADCA 1EG2A 2O06A 1TKAA 2ZM5A 3AVVA 3D5EA 3CF0A 1HYEA 5KX5B 2AWNA 2C7GA 3R5FA 4Q37A 4OQXA 4TVSA 4NX2A 4D0RA 3CG0A 2IV7A 1VL6A 1KSGA 2JD1A 5JD3A 1LLUA 2AMJA 3PPXA 1Z7YA 3KQYA 4MCJA 3EHEA 5AJWA 4ZODA 1F0NA 2RGGA 3THWB 2Z09A 2R8PA 1O08A 4JS0A 2QL9A 5B2ZA 4F2PA 3L40A 1Z0SA 1R64A 2H4JA 3BTUA 2F9LA 3GJXC 3NYMA 3KWMA 1G5IA 1ATIA 4LY0A 2BSQA 1U8XX 3GLTA 1JU9A 1NMXA 1B15A 3KKPA 4LJRA 3NG1A 5BV2P 3KM0A 3Q8LA 2CJYA 1R8JA 1EVEA 1J97A 3O8QB 5ADHA 3DNFA 5IF9A 1RP7A 2X4IA 4XD7D 1G7RA 1DARA 1VJ5A 1MTOA 2TECE 1R4MA 3A6KA 4DAOA 3BGVA 1GYPA 1I4OA 1CT9A 3TFOA 1K9SA 4LYYA 1D0YA 3QE9Y 4RVUA 3PU6A 4FAPB 4QARA 1NDHA 1TZKA 2C4KA 3Q9UA 4FMCF 3JZFA 5EXXA 4RL4A 1APBA 3G89A 4AYTA 5AT1A 2AOUB 4DEXA 4JBHA 1GNVA 4MP8A 3RUFA 1UOEA 4DAEA 3H8SA 2J9XB 2ZP1A 1JPNA 4JBXA 1REQA 4NATA 1T25A 4JOCA 4CM8A 4ER9A 4P3KA 3BM5A 3HNIA 1S8OA 4FJ2A 1PG5A 2VQDA 2DOKA 1LPNA 5AOBA 1KMNA 3U4AA 3DB2A 3OQHA 3ETDA 2HADA 4Q9DA 3LUJA 1A2OA 3DVRX 4KU4A 4JGBA 4R31A 2VCHA 1YWGO 1ZCFA 4CV3A 1UXJA 4AM8A 2QX8A 4L4RA 4MVXA 5G02A 1KRWA 3A9WA 2OO5A 1A50B 2Z8ZA 1QONA 2X76A 3OFJA 1M1YE 3R3SA 3VPXA 3E27A 2JX0A 3QV1A 2QTFA 4JB2A 4KNYA 5BUZA 1R00A 4MUNA 4L9AA 3BIXA 2P69A 1JJIA 2IEBA 1XMXA 2YJ6A 4HDCA 4ANJA 4IDNA 1FIUA 2YL0A 1DFGA 3R24A 2WOOA 3CEHA 3IQXA 2ZJ8A 3D4OA 5B1BC 4X92A 3CZAA 4Q3CA 2R7UA 2JIOA 3SJUA 5HKOA 4UHHA 1C1XB 1PWEA 3NTVA 2JK1A 4EA6A 4NHEA 1TFOB 4K03A 2VT7A 5D3KA 1RYFA 3WRYC 1LDMA 3DC7A 2AWYA 3RSQA 1MP0A 3B6ZA 4G41A 4V02A 1PU2A 4FWBA 3PGKA 3MLBA 1U94A 3IEPA 4I4TA 4HDAA 2LUOA 3WLEA 4Q24A 2PZJA 3WWOA 2FR8C 1K5PA 1EA7A 2HUPA 3FPAA 1DX9A 1Y3AA 2W2LD 1QQBA 3PZRA 4GZMA 4HXYA 1G9TA 3GM3A 3R0QA 4ALIA 5MF6A 3EHMA 4A0SA 2SCUB 4YRCA 3G0IA 1CE8B 3G6KA 3VYRB 2PA0A 4HADA 5K3FA 4KYIB 1V8ZA 2EU8A 3RIYA 1ESCA 2D0DA 1YRBA 2CL0X 3SJAA 3M6WA 2P2NA 1UPUA 3NMJA 3FHCB 1XNJA 1N1MA 1TO1E 4ZYVA 4OHVA 1UOOA 4ZT5A 2GN4A 4PN7A 1UPAA 1GILA 5IDQA 1YTUA 1ISHA 2NVWA 2QR5A 2AEMA 3AOEC 3ZDBA 2R79A 1D1SA 1DAOA 1SELA 3QE0A 3WICA 1DXHA 1AX9A 1KXZA 5C3UA 3BEDA 2EWMA 4FPXA 4IF6A 2G5PA 2J5RA 3D6FA 3QXXA 2D2XA 1I4WA 2DY0A 2ZXRA 1XZIA 1ZD3A 4M1MA 2AFHA 3E5HA 1U4SA 3OMLA 4MS3A 1F5SA 1Y7TA 1WF3A 3WSVA 3GD5A 4FFSA 3FDZB 4O63O 4RFSB 4A6DA 4DGQA 3VU3A 1IE3A 4N54A 1EFAA 2O6HA 4AZSA 3QBVA 5HIKA 2RHWA 4TM7A 2K2WA 4JI4B 4DPKA 4DQLA 1PL6A 3EX7C 3OZAA 3DBHB 3HCCA 2KGOA 1JKFA 4MQFB 2IQIA 5CLGA 4C0HA 4NCKA 2CE7A 2IYTA 2PKEA 1GUAA 3K8OE 3I0ZA 4BWFB 3CISA 3WGIA 3GI1A 3W79A 1R5ID 4YCDA 3WI7A 1KMCA 3KKQA 3PQFA 1V4BA 3HSYA 5FUXA 3WLSA 3VPSA 1LLDA 3SMVA 4JKYA 4WCFA 5D5HA 4NU0A 5KDDA 3WQRA 4UNRA 3O7WA 3A06A 5DK4A 3D02A 5A3VA 1S3SA 1D1AA 3WHLA 4BN5A 1O54A 2CD9A 3GBPA 5G0UA 3DLTA 1W0JD 4IMIB 3DULA 4NBLA 4A8TA 5I7RA 3O1HB 1Z2EA 1K89A 2DWOA 2I87A 3H3JA 2GCGA 3TPFA 4TVBA 3S1AA 4KV7A 3RG8A 1YJ5A 4WUVA 3NALA 5DRTA 4E11A 3HKEB 1KHHA 2F17A 3NXKA 2CD7A 5LOVB 3WQSB 2OC4A 2H1VA 1EXVA 1AKRA 3V1NA 3EF0A 3ENQA 4IVRA 3DAHA 3VZCA 4ADSG 1IRIA 3C7CB 3INGA 4TUYB 3IVAA 1SVLA 2Z08A 4GX5A 2QRVA 3PUYA 3JD0A 5LZ5A 4DVYP 2HIHA 4C7BA 3K4HA 1B23P 2AFIA 2AVKA 3QZUA 4GP9A 3P9KA 1J2RA 1GSOA 5IBQA 4XOUA 1NNUA 4P82A 3GJRA 2CJXA 4XD7A 2RD2A 4A8JC 2QX7A 1CY0A 1Q0LA 1GZVA 2NT4A 2YV3A 4F1KA 4CMCA 1RABA 5EP3A 2W7TA 5CFRA 3TSYA 1FX0A 4ONEA 3A1UA 3SQLA 3ZHBA 2R7RA 3IAXA 3TRDA 2PBEA 4GQIA 2V4UA 3VJKA 4CX9A 2MSCB 4B82A 3IE0A 1GPBA 1EK2A 1Z4MA 2GJ9A 2YQ4A 3C6ZA 2OHXA 5FOTA 5A6SB 4QLOA 3VDXA 2JS7A 3OM1A 4OK5A 3PHF2 1NJGA 2RHJA 4K6MA 4OAPA 1E4OA 1J1ZA 2C99A 4JI0B 1SC3A 3MELA 4Y2PA 1A1SA 3NOVA 4M9RA 3I45A 2WHEA 2KB0A 1WXIA 2OLEA 4FE4A 2QR2A 2CHVA 3D8NA 1JAZA 4JXJA 3TNYA 2QSZA 4HLCA 4AX4A 1ZL0A 2QTTA 2C4HA 2ZAIA 5CPBA 2WWFA 3HE3A 1N34B 1NRWA 3HZRA 2BCGY 3I58A 4OQPA 4DNQA 3KEFA 3L7KA 3NQ41 3CIOA 2J0WA 1PS9A 1B00A 5DXAA 1PVVA 1LVHA 2E0IA 3GLUA 4OUKX 4DMLA 1RTTA 4C03A 1T8RA 1U5BA 4MXDA 3P71T 4YLGA 4I66A 4S3MA 1SZPA 4ARZA 1MABA 1H9AA 2FXIA 2XYVA 4IMJB 5EZYA 4C3EA 4P54A 1E9BA 3LLCA 4DG5A 4FILA 3OLVA 1S3GA 3FTNA 5I9TA 4AP6A 1HMDA 1F1BA 3U3FA 4CFSA 1XZMA 3MYFA 4IP0A 4V0QA 1ESEA 4EBKA 1J24A 4U7FA 1MOZA 3IXMA 5HVNA 3LTNC 5KREA 4J1TA 4M49A 3SXUA 2BISA 1LC0A 1XQVA 4GMDA 4FFVA 2HY7A 3DXFA 3DE9A 2C8JA 1ESNA 3ZDFA 2ZWIA 4L02A 2MHRA 1Q7TA 3ZIDA 2PUBA 3I32A 4BKUA 1B3RA 5KTPA 4ME6A 4UXIA 4OUDB 4OO3A 2H1IA 4Q03A 1AB5A 1LSJA 3TG2A 4CV1A 5I01A 1WDLA 2NV0A 4BKRA 2JFNA 5ES4B 4XB6B 4Z4GA 3R0JA 1SUWA 1GU1A 1N5RA 2IXTA 3A4IA 4IILA 2UYQA 1EB9A 3WK9A 3HRIA 2WVNA 4E7OA 5LQAA 4DLBA 1RKXA 3OM9A 3RLFA 1GZUA 3AHJA 3ACBA 1TVKA 4BAGA 1SUBA 1SHJA 1QNLA 4ETIA 4NQZA 1P73A 3ETHA 3RU3A 3NJ4A 2HRQA 4D4KA 2XUJA 1RZUA 4GH5A 5JVEA 4LQ4A 2ZSUA 1Y7IA 1HEYA 1P0MA 3OAAD 2EPOA 3LSYA 5AVQA 4GGMX 2DC1A 3IR5A 3F2VA 4ZJYA 4EQ6A 3ZU5A 2AE1A 4ML3A 3WJ7A 2YLGA 3I37X 4BB0A 3C45A 1M2GA 5DN9A 3BD6A 2Y4NA 1I6LA 2NU8A 4BB5A 2WUWE 2O8CA 3AOUA 2IIVA 2ZRGA 3HLKA 3NVKI 2DFTA 1G1MA 1BWQA 1M34B 5FTKA 1QHSA 1YT5A 3LY7A 2YXBA 4OLFA 4QG3A 1YL6A 2BGTA 4OXYA 4JLBA 2YXEA 1QDEA 2AZXA 4C0AC 1EFVB 1R16A 4ZAWA 3OSUA 2GCPA 4F4IA 4MMZB 2RH5A 3E22B 5LNK6 2QA5A 3HUEA 4OJNA 5EE0A 1RM3A 4KSBA 1ZIDA 4PU0A 3AOGA 1NXXA 1UANA 1CRWG 4CG2A 1VG9B 2PMKA 3TAUA 4ENSA 3R8XA 3MWJA 4CF7A 2P5UA 1VPTA 1XU7A 1Q7GA 1VKZA 1ODSA 1FXWF 4C2BA 5FWYB 3WVNA 1QIGA 1GGKA 4E21A 4IDPA 3WQHA 256BA 5DX0A 5K3SA 2AGVA 2HMSA 4OQEA 5IVKA 1QQ5A 3CA8A 4KAXA 3IMKA 1FNDA 4WVLA 5LJLA 3ML1A 4NLLA 3GEBA 4QDUA 1P2TA 4HXGA 2VAPA 1I2ZA 1WO8A 3M1IA 5CB4B 5AVRA 4HEHA 4D0LB 4PO3X 3DNMA 1WX1A 1ULTA 4Y2GA 4OGGA 4EG6A 2W2XA 2HA0A 4C89A 4HYTA 2QBYA 2ID8A 3EQ2A 3WL5A 4PQYA 4HDNA 4JKVA 4IIJF 1TDJA 5LVAA 5C52B 3USES 1NI3A 1KQPA 2R1TB 1A71A 3B5IA 2GHIA 1UBLS 3AHDA 4AI6A 3GVHA 2DLDA 1TIKA 4HB4A 2CLLB 3KDAA 1WVMA 1KJ8A 5K3OA 5AVXA 1HDYA 1GWNA 4MKFA 4QIHA 3AP2A 2XGOA 3JQAD 3O7MA 5BW6B 3I76A 4R7ZA 4F6RA 3R76A 4Q3LA 4Q4HB 1L4HA 2HU7A 2MSNA 4LKRA 2ZJ7A 4C7MA 1O4VA 1MU0A 1HZJA 1EJBA 2CZQA 1XGKA 4WCDA 1GHTA 3GLVA 5CFOA 4F46A 1JWBB 1RJWA 3NORA 4CTJA 3O6XA 2I0FA 4Q1CA 4NZYA 5KYUB 1ZITA 3KL4A 2DQ4A 3QW4B 3UT5B 1Z6PA 3NBXX 5G41A 4XEFA 3OUZA 1BCRB 1NP7A 5H9WA 1MUUA 1PWZA 2BZ1A 4KI0A 1JG7A 3RFFA 1ZUD1 3ODPA 3PQ5A 2PD3A 5CM8B 5IEJA 3A4LA 4WH0A 3G3EA 4R7GA 4CGYA 2R00C 1UJBA 2R25B 4F5EA 1MMDA 4B0OA 1K7SN 2ZK7A 3I2GA 2JD0A 3AV3A 3T5AA 5LZ2A 3H17A 2MR5A 1IN1A 1Y6ZA 3JZAA 4GPZA 1GUYA 1AS2A 1QP8A 2FMTA 2HS5A 4FGUA 4YN3A 4YRKA 3GNQA 1T24A 1OC2A 4PGFA 1KRXA 4N5LA 3OEHD 1Z2DA 3W5VA 2IPMA 3EPHA 2FFQA 3TBHA 3RS5A 4YALA 3LW7A 3T1OA 3S2UA 2V5UA 2J9RA 2YYZA 2Q21A 4DMFA 1VLSA 2RGAA 4DYHA 1OT3A 4O6YA 2GZ2A 4IBOA 1JIVA 3F96A 1S0UA 1TGVA 4RLFA 3HVRA 2JEOA 3G2JA 3AR3A 2ZQ5A 1HI9A 4DIKA 2FWIA 3Q85A 2IXGA 4RHEA 4K6OA 1ZWLA 1QVXA 2XYRA 3C3WA 3L02A 4QDKA 2VA9A 2HU8A 1LVKA 5A5DA 3LDAA 2Y1EA 4YMHA 4RO0A 3Q41A 2C7OA 1ZH8A 1B4DA 4MHOA 1GRCA 1VPLA 2PLFA 5DSXA 2XDYA 4OYRA 1QG4A 4PAOA 3BF8A 5WRFA 1RXEA 5ICSA 4QBGB 2ZXWC 4UVDA 3S2FA 4D80A 4UM7A 2NP6A 4HBGA 2W2KA 3T9FA 2FZGA 1KL7A 3E61A 4MTCA 4DOZA 3HV2A 3KHTA 1CPRA 5B64A 3LC0A 3R0IA 3C15C 3DZJA 2F4VB 3B12A 3E0QA 2AS0A 2DPXA 2AMLA 4N3AA 4Q01A 4P86A 1JQAA 4JLDA 4HUTA 5AW8A 5GP1A 3PT9A 4EBFA 4GMHA 2F55A 1ATZA 4B6OA 1TI7A 4RVNA 1M1NA 4L3OA 1WU8A 1MAHA 3EVFA 5KSZA 1U2TA 4Z0NA 2C5HA 4ND4A 5CBKA 2ZI3A 3OAAA 2VXCA 4J0GA 2XGMA 3VMFA 3OMWA 4KX3A 3RIXA 3CVWA 5DRYA 3ZW8A 3BRJA 3GG2A 1GAWA 4LCJA 2D2IA 2M2IA 3U8VA 2XLMA 3N8GA 1KEWA 2BEVB 4FZRA 4QHYA 5C7OO 3W9UA 4OYYA 4UVIA 3ME5A 4EHPA 1P1JA 5AW2A 1LSSA 2GLUA 2A0BA 2ZFUA 4G4IA 1IOZA 1L7AA 2GHTA 4LA4A 5EFZA 2AJCA 3R3XA 1ORTA 4XUEA 2EW1A 4A26A 1YHZA 1BE1A 1CWUA 2OEVA 1LWOA 1P5RA 3W4YA 4MWDA 5FTLA 1AUOA 2DHEA 2BFEA 3DZKA 5IAEA 1GQSA 5HILA 3MA0A 2KBEA 1BHQ1 1GCOA 4XSVA 4BDTA 1JHXA 2Z1NA 1NZDA 1AS0A 4C4YA 4EJ2A 3PP8A 2Y2UA 3UWPA 2BFNA 3RVLA 2ZRIA 5T41A 5IPFA 4ZOBA 1FFEA 3HM2A 2RHLA 1W0KD 1VRVA 1XHEA 1T9GS 3KQLA 4B79A 2PEZA 3W2HA 1G8FA 3WGQA 2GLXA 2VPYA 2ZBUA 1V5GA 3IL2A 2WZLA 1PZEA 1PD1A 1Z0KA 3TUJC 3AQ4A 2J9VA 1NNEA 2JGNA 4HAVA 2BKLA 4U7DA 3WWYA 4RKQA 5BOSB 3KJNA 5KNCD 2P4HX 3WV4A 1ZOLA 3A32A 4ZOEA 1XPRA 4BRSA 2XVMA 1OZGA 2XYGA 4RVCA 3H5IA 4YNBA 5K01A 1LNQA 1V3UA 4LV6A 4ZPJA 3CRW1 5BUCA 3BF7A 2QTCA 4X91A 2XLBA 1E99A 1WUJS 4KYVA 4YRZA 1Z74A 4IPTA 2YUIA 4ZDJA 4GP6A 3GVIA 5EHIA 1JA1A 1XLTA 3ZI7A 1N7GA 1UFBA 1L7BA 2OO5C 3L1IA 1BGXT 1YDEA 2MSDB 5BRNA 4IXDA 3H5NA 4PF1A 5ENZA 1QOQB 5I7OA 3NUZA 2IWHA 5JCZA 1QNFA 4TZ0A 4L5JA 2OXCA 4E13A 3IVGA 4K3UA 4MQMA 1FBTA 1IZMA 4WK0B 5B7QA 3BEHA 2NSLA 3RRXA 3MW8A 4OX9Y 3N5CA 4O0LA 5J4KA 3JPWA 4XDZA 5CEFA 3NVAA 3KEMA 2NM0A 3MCWA 4YK7A 4L6CA 1IZ7A 3L8IA 5IN4A 4WESA 5KWSA 2GPBA 3FW1A 2XYQA 4ND7A 5K6AA 4CR8A 2XYPA 4NCHA 1FFTC 3CJRA 1P60A 1GFSA 4YRFA 2BM1A 3OE7D 3WGJA 2ZUSA 4JL5A 5CIWA 4UPEA 3WISA 4AN1A 1M7GA 3E84A 4HGOA 5HJ7A 1MOQA 1JDUA 3PFNA 5DFAA 4TROA 3MN1A 3VVLA 3EZ7A 4QGAA 2J5XA 5LXTF 2LP4Y 2PQ0A 4AMZA 4S35A 1WV0A 1UMDA 3SSMA 3NVMB 3HB0A 4LXQA 1OJ7A 1QVVA 2Z4RA 4K0DA 2KW3C 3ZOZA 3K9WA 1EUCA 3LLMA 1C8KA 4MVMA 3GPCA 1Z4QA 4HDKA 3L7NA 1JTFA 4Q7LA 2QSJA 1FDWA 1SCKA 1W4AA 1LH0A 3IV6A 3OECA 3QXSA 1NMZA 1NVAA 1RXVA 3NBQA 1F8UA 3O8BA 1UWVA 1WXEA 4WT7A 3SHFA 4EBJA 1NIJA 3VAYA 4BVJA 5JEEA 2ODWA 2X23A 1P6UA 1Z8FA 4PLHA 1SIOA 1OF1A 4XX1A 1ZAKA 3VVCA 3JYQA 4MGYR 5JS6A 3FDQA 1ZHFA 1BCSA 1CJTC 3DEKA 5FA5A 2P68A 3E1KA 4IFIA 3C5WP 4O2AA 3OEHA 1T2CA 5LLDA 2Y68A 3OLQA 4IIXA 4PONA 5BQ5A 2I4LA 3UMIA 2W6ID 2JA1A 1CHNA 1E9RA 3GLRA 3PC8A 4JD5A 1DKOA 1KNYA 4DL9A 3N2KB 4Y2UA 1I2CA 1D5WA 2FPLA 1XE3A 2CLSA 2W2VA 1K8XB 3HB7A 4IDCA 3WMGA 3G82C 3RE1A 2WNSA 4RM2A 1MEOA 2A0YA 4MVJF 5ICGA 4ZI7A 5HZHA 1SCUB 1BR1A 5D92A 1KY4A 5AMXA 4AZ0A 1AKTA 3I0NA 5KOHB 1JL3A 2IDJA 2JANA 3OTQA 1E32A 4CDMA 1P7PA 3ZNQA 2ZUCA 3C4JA 4OU5A 2PQMA 2VP4A 2P6PA 2X0NA 4DV5B 2YVAA 3IP7A 3MMNA 3E48A 3C7AA 1WW8A 1C4KA 1UKYA 4WCFC 3IOYA 4JURI 1T5LA 2BLLA 1DSSG 3TW8B 1GITA 5EMNA 4HBZA 3FUWA 2GAFA 3DLAA 1R0WA 5LA6F 4B40A 1Z0FA 1ORRA 1ZNYA 1AF4A 2ZW9A 2C42A 2QM3A 4BFUA 5EIEA 5GY7A 5AW1A 1RQLA 3T3EA 1LJ8A 3GORA 5GM2A 3RABA 3U4QB 3FUXA 4BE4A 2NMVA 5EOVA 3II6X 4K1XA 2V97A 4UBKA 3FOOA 1XMSA 3RVRA 4C0XA 2FFBA 3IQEA 3U4IA 5KVCA 1N6OA 4U5GA 4P36A 6YASA 1WU7A 5BVHB 3I8OA 2Q2NA 4AJ2A 2BY4A 2CKDA 2C88A 3FSGA 5EWMB 1OYYA 3DZBA 4I7EA 2H1CA 3OX2A 2NZ8A 4G67A 3CEMA 1VE7A 1QQ7A 4B4KA 3RIHA 1RC1A 1TA4A 2BH2A 2VSQA 1UBMS 2UZAA 3THYA 4KOAA 1E9AA 1ZXXA 2XEDA 3NT4A 1LDYA 3VZRA 1YS4A 2O1XA 3V33A 1L2TA 1M2OA 4PO9A 4Q18A 4C4RA 4D74A 3QI2A 3KYBA 3TIVA 1M73E 3SP1A 2JZOA 2VF5X 2JKYA 3BSWA 2FPPB 1VRWA 3CEJA 4O3FA 4A0RA 2AMVA 3QELA 1YZHA 4X00A 3ZYCA 1YFLA 1R9NA 2ZCUA 2FZKA 1RLMA 2QU7A 5TGTA 1AUPA 4GVXA 5KNCH 2VUSA 2ZRBA 2PS9A 3FTFA 3NGLA 1SF8A 3GEIA 1XTUA 1JXMA 3A70A 1FFAA 2V6IA 2IX9A 1YVUA 3DOHA 1TTHA 2WLTA 5KQRA 2AYZA 1K1EA 1YGPA 1GGHA 2EBWA 4R2MA 2RI6A 1U99A 1SKUA 3LKBA 1T6QA 1KBZA 3O1JC 1E2QA 3OLYA 2P6RA 3G2QA 1LD3A 4O8CA 3ES9A 3KC2A 2CKMA 3L0YA 4RGBA 1RWWA 1Z4LA 4WJLA 4C7OB 1YU6A 1UAGA 2LCQA 1TAQA 4O79A 3FZQA 2OZPA 1ZD8A 3FNRA 4NSNA 3IULA 3JAWA 5CTAA 1U0HC 1XMQB 2G70A 4FLFA 4DMKA 1R4AA 2ERYA 4WNAB 3UENA 1ZUIA 3SEAA 4B45A 2OFFA 4X45A 2O8EB 1ISPA 4PSVA 2OCLA 2WFZA 2VZLA 3Q11A 1JDBC 4S2EA 1CUSA 2A5FA 3BMQB 4RTLA 2QQ0A 2COKA 3H5WA 3BMOA 3L4KA 3LBYA 2VKQA 3UGKA 2PKQO 2ZUBA 1G5QA 5F5FA 1B76A 1C8VB 2AXNA 1RLIA 3L6CA 2L69A 2P9TA 1DELA 4MV4A 2CXRA 2I71A 3FTCA 5IDWA 2I7CA 1OROA 3PKJA 5ELXA 2CYBA 4AF8A 4EVSA 4ZYTA 5B6JA 4M55A 2JAWA 2XTJA 1JEYB 3ZVKA 3U5ZB 2HIGA 4J1TC 4IXTA 2F3QA 3N2IA 4FT2A 1FE8A 1P91A 3FOWA 1EGMB 1NJ2A 3DSRA 3C3YA 1YJ8A 2JFZA 1LKXA 4YH1A 5BNWA 4MRVA 3NS7A 4JI2B 4ZP1A 2VPZA 3OE7A 3ZC4A 4CL2A 3JD4A 2OD9A 4TTIA 3UO8B 4OP3A 1DQZA 5A1TA 1MAUA 1F0PA 1Y89A 1NR7A 3FN4A 4RFVA 1RRFA 3SEFA 3N3AC 2VWHA 4DCSA 5FPTA 3BGOS 4Q48A 5JS5A 3PDCA 4X7MA 2DQKA 4M3NA 2P9HA 2IA5A 4CMAA 5BWLA 2O8DA 4BX2A 2JATA 4HUQA 4YR9A 2PBZA 1QSPA 5KSWB 5BNTA 3BAFA 5A4AA 1QTIA 5CB8A 4RPHA 4EABA 1TX4B 5GINE 5CX1B 3LFHA 3K1AB 1T5TA 3PF8A 1AV6A 1PYDA 3LOPA 4JT4A 1CQIB 1TD9A 3F5FA 2H29A 4BOYA 1SG0A 5DXJA 2OCAA 4IQGA 5H59A 3PFKA 4GS5A 2W11A 4JUAA 2G1KA 4G1MB 2R9VA 3CNEA 1NY5A 1T3SA 5B1AC 1N6NA 1F12A 1JZTA 4B4UA 3O9ZA 4O2BA 4EG0A 4HT3B 4ZAGA 3EMBA 4L16A 4LF6B 2I8CA 4I1SA 3N70A 2G9RA 3I09A 4UOZA 3OCYA 4X1YA 1D09A 1J2EA 3KPHA 1Q17A 2HQBA 3VU1A 3P2JA 4B6RA 1I2DA 1VHWA 1DTWB 1DOAA 3VRHA 3TD9A 3TQHA 1JSRA 1H2ZA 4YS6A 3HPQA 3LQ1A 3JQAB 4OA8A 2Z2JA 2RH9B 1RE1A 4HD8A 3IUSA 2NAFA 2VSYA 4IJMA 4KE8A 1P8JA 2ZU0C 4HNHA 3GBVA 3E1SA 3KYIA 2PFDA 1Q15A 3CLTC 5B53A 4I5DA 2YFQA 5MN4A 2GM4A 2EP7A 5J23A 2GXSA 4YRGA 1MMFB 4A8JB 1PFUA 1CFZA 3BJZA 1ZR4A 3H6GA 2GESA 2FJPA 4P80A 3L82B 4YRLA 2ATCA 4CLHA 5KOJA 1HYBA 3MAJA 3NHMA 4C07A 2W4BA 1F0KA 1B26A 1G8JA 1YVPA 1P9RA 1Y4CA 4F2HA 3MIZA 1Z7EA 4N1AA 3LVQE 1GZ3A 4N4AA 4DA0A 4N0EA 5A2QA 1EZ4A 4ENWA 4GPAA 4DMCA 2W8ZA 4B3CA 3TDMA 5IAKA 1L5HB 3HWX1 2HPZA 4V24A 1J22A 4GPTA 1MA0A 1QH8A 2XF2A 2YFYA 3MB8A 5T3TA 4BMVA 4ZO6A 2RGCA 2C61A 3PWSA 1LS6A 1RJDA 1E2NA 4FFRA 3ZI0A 3H9BA 4KRFA 1BC5A 1ZZEA 1GSAA 3TNLA 3NZEA 4EGAA 5FTJA 1A9SA 3F9CA 1QIFA 3AM5A 3L7BA 1PR3A 1UWLA 1T9ZA 1JFRA 3WFZA 1FSGA 4HEJA 3WNVA 2RCYA 3IHLA 4D6YA 1KK0A 3QOWA 2BR5A 2UZ3A 4FFWA 1OBHA 1PNQA 3Q1LA 2CXNA 3V55A 4BNKA 3AILA 5BV8A 1L4MA 2ZYGA 4LJ9A 3EDYA 1RPZA 4UM8B 5JQWA 4MB0A 1WIWA 3RLIA 2WG1A 1P3Y1 5JWHA 4AJ4A 3WLTA 1Y1QA 3MWLA 4W5HA 2ODBA 4WZAA 4URVR 4TV9A 4NDNE 2RMKA 3G0OA 3HUFA 4O4HA 4I55B 1GN9A 3BXOA 4G81A 3T0GA 1BS9A 1QGAA 3M0EA 4ZO9A 1G64A 1R0LA 5DOVA 1SVNA 2HSZA 2DBQA 2VOJA 4BFZA 2DUMA 4EYEA 4IOKA 2JFPA 1XHLA 1OWNA 2M6LA 1AKYA 1JR2A 4PANA 3CAXA 1GNSA 3FWYA 4QTXA 3WSTA 1XEWX 3HGTA 4K3VA 4YMLA 4RPLA 4TLDA 4AY5A 1SUAA 1JAIA 4LI3X 4JP8A 1BXZA 3EFHA 3IPXA 1MQ9A 4A0FA 5KNDA 2ZDGA 1OH5A 3BFKA 3MX3A 2PU7A 3M3DA 4QYWA 1VMDA 4QQKA 5E9JA 2YZ2A 2Z5GA 3RYIA 2PTGA 3OZVA 1I2BA 2JHAA 1YVDA 3R3WA 5G40A 2UVDA 2Q4OA 1HYQA 3H0CA 1A7UA 1KI4A 4G9BA 3UATA 4JIGA 1SURA 1XTRA 4ZCTA 3ZTWA 3ICVA 2W6QA 2C1ZA 4V1CI 1Z47A 1SH7A 3MBGA 1ZLYA 3J7TA 2LPMA 1U2PA 5H80A 1QBGA 4DIMA 4MVJM 2VHWA 1I9CA 2P5YA 4DT1B 2QZ9A 1DBVO 4BNJA 4MCHA 2BMFA 4LQCA 1TLLA 3KFLA 4CKEA 5IKOA 4PICA 2P8SA 4JENA 2GZDA 4AC9A 4Q4ZF 4JJKA 5JJCA 1YQWA 5T64A 1HETA 1YR1A 3E9VA 3CM0A 4W9RA 2FZVA 3H42B 2ZUWA 2JASA 4OHZA 4BNDB 1YCGA 5EXEA 4D46A 3QWFA 3DQZA 1KP9A 1XD2A 3MS2A 2Z98A 2DYKA 3EF1A 1YR3A 1XELA 3MJDA 4RFLA 1BD3A 3QSYA 4HDMB 3BIJA 3PLRA 1ZD2P 1ESMA 4UM9B 3ROPA 1AGYA 2N9UA 1GG2A 4B47A 5LYYA 1RJ9B 1VLLA 5EA2A 2IH4A 2WHPB 2PJUA 3SFZA 3ZCRA 4JH0A 3EEIA 1FNCA 1U8ZA 3IV7A 1NWCA 2GF9A 1T4GA 1WB6A 3ST7A 1GPAA 2VDKB 3CCFA 4KQJA 3HCOA 3FYUC 5ALQA 5FYQA 3PEVA 1SRQA 1HTTA 3AV0B 2XM0A 3P20A 4EITA 2YC2C 4E5MA 5PNTA 2AR9A 3M5CA 1S6YA 4QHSA 3PEFA 1RZRA 3O8CA 4CBEA 1S2MA 1XZEA 2Y3IA 2JW5A 4C2AA 1E83A 1JILA 3GYBA 4XPWA 3PL5A 4G0WA 1I3NA 5DCYA 3TIIA 1F8FA 3HBMA 2QRHA 2UVPB 3A04A 1PJ4A 5K7SA 3K9BA 3RTDA 4KRXA 2FK8A 2RG7A 4JY7A 1U6IA 3EPVA 4FYHA 1S8FA 3TOMA 4MGZR 2IYLD 4DUYB 1F6DA 5E4JA 4IDHA 4HGQA 2YYYA 1RLJA 4IHQA 3SN6A 2TRSB 4DXAA 1P4RA 4GUAA 3FOFC 2VZEA 3AUUA 3ZV7A 2GEJA 1PQ4A 2ISQA 3ABKC 4V0RA 2HQSA 3SEQA 4ZJPA 2Z2YA 1NJSA 1ICEA 3U48A 2YY7A 3DHWC 3KTOA 3DZIA 3P26A 1J2UA 1MO4A 2Q6VA 3ZV6A 1YIDA 1C81A 1D0ZA 1VDMA 2XQKA 4DBRA 3LRXA 1TWHA 1I1HA 3L1VA 4IGFA 2RGEA 1C3VA 1RWKA 1QC5B 3LGXA 2JEZA 3U2LA 4MVCA 4YRQA 2JD3A 4XB1A 4OGFA 4IJVA 3KPWA 1AXEA 4LISA 2PKWA 3K1ZA 3TJ5A 3UAXA 1IEVA 3B82A 3L41A 4U5XA 3B1WA 1UBHS 4MR8A 3QBDA 2HK9A 1C02A 3OZEA 1ZINA 4TL8A 1FP2A 2A9OA 4IGIA 3SF0A 4WLNA 2W45A 1W19A 2QUIA 3E23A 4IIHA 2VXBA 3M1LA 2WYHA 4YAOA 3CLTD 4IHJA 4GEKA 1FP1D 1ZNQO 3HYNA 3GM2A 1LF0A 2YINC 3INTA 5JU6A 3LUDA 4K46A 3MRXA 1PR2A 3OD5A 1NM5A 2J31A 2B82A 2H5EA 3FWKA 4LXIA 4LGYA 4J0QA 2WV7A 4JW1A 4PSUA 3GP3A 1DADA 4NEQA 1LTHR 3A2LA 5SYMA 4E4RA 1NYTA 4N6NA 4UAUA 1N9GB 4WPGA 1U02A 5F1KA 1U0GA 3KBBA 4OHOA 3RHTA 2R6AA 4ZTZB 4HX9A 1F3LA 4MRSA 4PJJA 2W2OA 5CJ2A 3CIFA 1XLTC 4WNIA 3O10A 3NHYA 3Q2OA 3PUJA 4UULA 1UP7A 3QY9A 1GUDA 5CXXA 3LCMA 4CLRB 4OXQA 1II8B 4C7KA 1II9A 2MYPA 2C83A 1JKXA 1FLVA 1L4YA 4LV5B 2UYYA 3U7GA 3I4UA 2ZS9A 2AA3A 3B0VC 1EUDA 1QIJA 4H4DA 1THZA 4PHFA 1PV2A 3IURA 4M1WA 3FI9A 3OCXA 5TJ5E 1SOMA 1TZMA 3TI7A 4DNPA 2JH9A 5TVKA 4PGHA 4Q05A 4L5AA 5K6AC 2HHCA 2XDQB 5EHQA 3J7AC 3P2IA 2FUKA 3IMCA 4PCVA 1AVTA 3ICOA 4JZAA 1JPUA 5ALIA 4J0EA 5FBHA 3FAJA 2VHUA 4MDFA 4CUKA 1J8YF 5GV8A 5BPFA 2PDAA 1H3FA 3QF4B 1ODCA 4A4AA 3I8XA 4G0VA 1P81A 6REQB 3GL9A 2GBIA 3UJNA 1KI6A 2A8YA 4XGKA 4BFYA 2WVOA 2EFJA 3UMFA 1GGNA 2VJKA 2DBZA 3W3AA 4H7IA 1UT5A 3DV9A 5HCUA 4P1ZA 1PK7A 4M86A 4BXOA 4BQPA 2Y1FA 3UMRA 5MGNA 4EAQA 2VBFA 4G37A 5L40A 3CVUA 1X8XA 4R54A 1PSZA 2CXSA 3EZNA 5AI5A 1GFIA 4KIWA 2VXOA 4KNWA 3GJ3A 2I2XB 1TUGA 3LHKA 5KSPA 2PU5A 2QT0A 2YHIB 2PFKA 3N28A 4LMAA 2IVZA 4TWRA 4XWAA 4D3FA 1UF9A 2QPLA 1JH8A 2D2VA 1OLUA 5CIYA 1WULS 3QOFA 3ET5A 3WB0A 3G79A 4TYNA 3STUA 4KKVA 3ZTTA 1ZK0A 2PT7A 3CMCO 3RIMA 5KPDA 2HF7A 3ZHUA 4YMIA 3PC8C 1JOGA 2HCTA 1G17A 3AMVA 3PDMP 2IYQA 2VLIA 3MGAA 4RSMA 4NECA 2H2FA 5J43A 3IP5A 4RJ2A 3B3QA 4JZKA 3T94A 4KL8S 3A4NA 4XYBA 5EKXA 1CNMA 4IV0A 5J3JA 1NT4A 2GLTA 1JVNA 4YL1A 1R2QA 1PLJA 1N92A 1V96A 4OBWA 2C2BA 5GM1A 4R71A 2ZPUA 2FCRA 1HDEA 2V9PA 3WLLA 3HSKA 4PNZA 4IR7A 2HDNB 3G1WA 2QP9X 4F2DA 1FFHA 4CEHB 1R4MB 5LQMA 1L5NA 4GG1A 1MR3F 2QLLA 1LU9A 3FD8A 1E2HA 2JCXA 4IY1A 3ROEA 3PC4A 2Z56A 1PUJA 1QU2A 3E9DA 4JJFA 4EG7A 1HT1E 1CVLA 2B4AA 3QUTA 1F48A 3GC6A 2A7QA 4INOA 3AF1A 3GJ5A 3LQKA 3PNBA 4ZVUA 2AT1A 4H7KA 2PYIA 5LP6B 2AZDA 3WQQA 3R5TA 1OBFO 2AW3A 4LJAA 4CU5A 2UYGA 2PS1A 1NF3A 2B5OA 5KZMB 4HGYA 2WIAA 4JFAA 3H5AA 4UUBA 3DWEX 1NU7D 1HNWB 1VE6A 3STVA 1TKCA 5THKA 5C8ZA 3O2NA 4WXEA 1IU9A 3ZY3A 5JP7A 4N5NA 2NQ8A 4WNCA 2OZVA 5JWOA 4UTRA 1SUIA 2EJVA 2RFLA 4IIDA 5FA6A 3GGPA 2G83A 1R0XA 3F98A 1ZGHA 1TJ5A 5L0CA 4CCYA 3RSHA 3SICE 4OH7A 2VNIA 3TJ6A 5FO1A 3TQOA 5F2NA 3LBFA 1EXNA 1QCZA 5I4KA 3BK7A 3OZ7A 1PZGA 3L1UA 5F12A 1M1UA 1YI1A 2LIGA 2NZUG 4LHEA 4MW6A 2R1VA 2X15A 3AZQA 4EI8A 3LKZA 4FSDA 4KHPB 1Z8DA 4H4CA 1OLXA 2H9YA 4NS4A 4A1FA 4FM9A 1Y3CE 3G2OA 5C5DA 4PO8A 4S05A 1NFFA 1FTWA 3X1XA 2L7AA 1I80A 4E2XA 1H8EA 2ZANA 1UWKA 3W9SA 1GQFA 2Q49A 4EGFA 2W6MA 2V7UA 4LK2A 3NTLA 4RD9A 1I6MA 2EQBA 1R0RE 1UWCA 2PUJA 2H11A 1EFKA 3BMNA 2XCIA 3EGIA 2X2OA 5TX7A 5K4GA 3IAS6 2WM9B 2VWQA 5AJHA 1ACJA 3IP3A 4RTMA 4IDOA 4I4TB 1XWWA 2WABA 3ZJUA 3M5DA 3QJYA 2UAGA 3EAQA 3B2NA 5EKUA 1H85A 5AI6A 4Y1EA 1A77A 3KCNA 1ZXLA 3H7IA 3GO4A 1NE7A 1T6XA 4LYHA 5IYZB 5EKSA 1MORA 5AXCA 5TSDA 1JFSA 2F43A 4R2JA 5K3FB 4L6IA 1AQ6A 3O3CA 4LHVA 4I9GA 4UOQA 3WRVA 2BDUA 4S1PA 4PWYA 3FOAA 4FBMA 1K2WA 2P2YA 1PQWA 3BUSA 4A15A 5JT1A 5DYGA 4FOTA 1CBUA 3O03A 4QL3A 1OFTA 3ZVLA 1U7XA 2GR9A 1W35A 3FUUA 1XN4A 2YWHA 1P77A 1E2MA 3TLYA 3ZWMA 4IM7A 2DZDA 3I4FA 4LSZA 1PRYA 1Z33A 2C2YA 5BQGA 4F3NA 2R6FA 5GGXA 2B0HA 3DUWA 2ZJ2A 4ETWA 3CT4A 1T2VA 4YLEA 2AFHB 5LYJA 2HA3A 2OGSA 2DQYA 4M88A 2Y1LA 4MS3B 3EZ2A 1ODLA 2IEIA 3BILA 3NJRA 4HS9A 1NXWA 4W6QA 3STTA 4G78A 1YO6A 3HDVA 1DVRA 4TYWA 3G2IA 2CN1A 1BXRB 5C1PA 3IJ5A 1DQPA 4URXR 5F77A 1H2YA 4HEQA 4OSEA 1NFNA 4K40A 1HNNA 2PH5A 2F4NA 4X64B 1UODA 2YBDA 1Y1SA 2IU0A 3NYJA 3KWFA 4P4NA 4W5WA 1NVVR 4EARA 5J5VA 2ZETA 3QXGA 3H6HA 1W5EA 4II7A 1QRRA 3TE7A 1QKRA 5A3JA 4U5DE 3TTVA 3NBAA 3GJSA 3ZE9A 1EAYA 3T5DA 4WCFB 1TNDA 4JV5B 3C24A 3JCZA 1L4EA 4MDHA 1XVIA 1D0SA 3TQSA 3ANSA 4WGYA 4RVFA 2ZIXA 1E2DA 5DB4A 2IUUA 2F8SA 3LSTA 4DNXA 4C0BA 3IKLA 3WIBA 1FR0A 3SS7X 1SXHA 2IUFA 2PUAA 4E5VA 2Y99A 1GTZA 2XOXA 3CEAA 3DE5X 5L0GA 4O4IA 5TMDA 4RLSA 3R3HA 2ZYUX 3TCKA 5UKDA 4NXMB 3HGQA 3IAM6 3A9CA 1V43A 1XVLA 1NVMB 3D5TA 3BN3A 3ZQVA 2P5TB 3LLVA 5CT8A 4IFTA 4GUDA 1CYDA 4NV1A 2EIMC 2A9QA 4HFFB 3S4YA 2CNLA 4EPVA 1RQGA 5L3SA 2Q3LA 1WJGA 4GEGA 3UOAB 1S2IA 1FUEA 2QRVB 3KSDO 4RDHA 3FMOB 5ALJA 2J3QA 1JE0A 1UK9A 4G65A 1NATA 4CJGA 4E2WA 1WEKA 1H6CA 3BQNB 2MTBA 3ROZA 2A78A 1KY5A 3E2IA 2GRAA 3QE4A 5JT4A 4KIUA 3G1TA 4RAQA 5IFKA 1JFTA 5DNVA 5DNWA 4K9QA 1FXUA 2KK1A 3DDSA 1K88A 5E8JA 2ZI7A 4J9VA 1M6NA 3I04A 2H0QA 5E4YA 2AD5A 4HPWA 5I7UA 1FX0B 4MGEA 5EHNA 3LP8A 4JQOA 3UWDA 5JE8A 1M7HA 1YF3A 4MNDA 4PNEA 2ADOA 4L0CA 3AEUA 3VOBA 3HV0A 2Z04A 1U1FA 1QZZA 3UGQA 3IOBA 4H16A 1ECGA 2LDXA 4U5CE 3IC5A 4U7TB 3AGUA 5SYNA 5EZQA 4P9TA 4BFTA 4Q5IA 4TQUS 5IXYA 4Y0VA 4XR9A 2OPHA 2J59A 2JHCA 4TSFA 2WDZA 4J0DA 2RGUA 1EMDA 3SJCA 2QDXA 1NVXQ 3RVDA 1NBEA 1CFJA 1IXSB 1ST3A 3K70C 4RVSA 1P4HA 1PYOA 2BGJA 1XZNA 3VX4A 3W2FA 2FAXA 3ZH9B 2AI3A 1UP6A 3AYZB 4YRBA 3BJMA 1J23A 4H7FA 3C2QA 1GARA 2J9GA 3D3QA 1NX6A 3WWEA 2FF7A 1DC5A 5IVDA 2EWWA 1SVIA 1JDBB 1ZONA 3HKCB 1SHKA 1VE1A 4WACA 1YASA 3PFIA 4OIFA 1Y37A 3DWFA 3FCAA 3VYSB 2IF2A 3NJ8A 3B20A 3E3AA 2DLCX 3NNSA 1Z28A 5CDSA 1VXRA 2QMZA 3NTRA 1CEYA 4EKDA 4FKMA 3FH0A 5EZYB 1YK1A 2VH3A 4U7HA 3EEBA 3FSGD 1I8TA 2HJVA 2XLCA 2Q99A 3H2BA 4EVIA 1AUXA 2XW6A 5SY9A 4YCMA 3KZCA 4ZVOA 4I99A 1ZNZA 1S2NA 3PGVA 4Q3KA 3AETB 3GT3A 3NASA 4C0JA 3SC2A 4NP6A 5DK6A 1PJSA 4TRJA 1RRPA 5AUPB 5A69A 3N2EA 3W5UA 4K9LA 2MSWA 2VJBA 3OA0A 5I6DA 1DO2A 4US2R 4BLRA 1PZMA 2ZGVA 4MW4A 4MVJI 2NNLD 1D3AA 1MNDA 2NXEA 4QRDA 4WKNA 1ST6A 2OA0A 1VZ2A 4JLNA 4BNYA 3MFNA 4GIBA 1OWLA 4MARA 1QV9A 3HKKA 3COVA 4YRMA 5EEHA 1PGNA 1AVOB 3I2IA 2BHRA 4L4SA 4AD8A 1OW8A 5FLYA 1DIGA 5JG7A 4Q7QA 4BVHA 3U5SA 1L1QA 4JUDX 1HQCA 4IWBA 2PKYX 3KDPA 3KLBA 2ORIA 3CQZA 1ZI9A 2BHNA 2QDKA 2X4LA 3ZD6A 3RVNA 1CUDA 3EE6A 3L8CA 4UVHA 1TTQB 2X1MA 4YFYA 3W04A 4TSRA 3I9FA 3SOZA 5B57C 4XJVA 1OVMA 4LQLA 4MUHA 2ERCA 5AWFC 1OV4A 1L5LA 2WLSA 3WYDA 5HQTA 1N2ZA 3OE1A 1BWRA 3WDSA 2B37A 4EPRA 3AJEA 1W96A 1YBHA 3R6DA 1RMTA 4RIGA 1KIMA 2HM7A 5ARBA 3JAKA 2DT8A 3TNDA 4C2UA 1MXFA 5FB3A 2J6CA 1SC4A 5K8VA 1GL9B 3UBTA 3EEQA 1EXMA 2FPGA 4BVAA 2RARA 2G7ZA 4HMQA 2WAYA 4FKZA 4IXWA 1A7KA 1CUCA 5TS2A 2VHQA 4C30A 4EQ6B 5KWIA 4J0IA 1KDRA 4E32A 1Y7PA 4KN9S 3UTCA 3BL5A 4N3GA 2HXGA 1QH9A 3L6OO 3DMGA 3MTQA 1XO1A 2RGRA 3AVWA 4WOCA 2BN4A 4TWIA 1TO6A 3JQGB 1YS6A 3I72A 2C0PA 4BBJA 4URHA 1G16A 2O8CB 2FFHA 4DHWA 2PY6A 2BCJQ 2QUAA 2JJ1A 3NVDA 1V8PA 1X1RA 3FFBA 1W9MA 4WLEA 4XWWA 4ZYUA 3I53A 3UJBA 4HNTA 2NG1A 4HC4A 4UBNA 4XA8A 1LVUA 4KXWA 1JAFA 4CKBA 3IEIA 4WJ0A 3VNBA 5AW5A 3L0IB 1CHDA 4DRHB 3NB0A 4L08A 4BMXA 5K0JA 2P61A 3S29A 3HMKA 4QFCA 4X62B 4OQYA 4KXMA 4DMRA 2XTAA 3GM1A 5M34A 1PZXA 1U7UA 5KTTA 3DAPA 1NLMA 4QDXA 3U3XA 3T3OA 4B8ZA 2Z43A 1UDCA 5ER6A 2P27A 3KQVA 1YMVA 1CU1A 3C6XA 2OG2A 1VL2A 1OZAA 4FN5A 2J5BA 1QQTA 1VG8A 5AQEA 4RDIA 3I62A 2FPSA 5GJBA 5T3YA 2HI0A 1QFMA 3CZ9A 1UK6A 3STYA 3Q8KA 2XB4A 5HP4A 3EMKA 5E7JA 4C3BA 4G4SO 2LKCA 1L3PA 2JFQA 1YIOA 4WA8A 4LLCA 3LA8A 2WJGA 1T4BA 1E1MA 4HX2A 2WF9A 5FHRA 4KQKA 1TF7A 1I3KA 3EXEA 4JQCA 2W6PA 4K86A 1PJBA 1GV0A 3NTUA 1VP3A 3AUJB 1FYFA 1T8WA 2VRWA 1KKUA 1JHQA 2QBYB 3A9VA 1F1MA 1QSGA 1RS0A 3HXPA 1F6BA 2WDPA 1A27A 5KOIA 821PA 4PRYA 2D62A 5EYPB 1V3TA 3ENZA 4HDSA 2BHSA 2JFUA 3WLNA 4CF5A 2XBLA 4KOEC 3FMPB 4ZALA 1TYEB 1OX4A 4YWQA 4U9IS 4QDOA 4Y1GA 1LRLA 4DDWA 4MVOA 2IYWA 3UEOA 2E89A 2XXBA 3NHBA 4Q1DA 1QYCA 3D43A 4RMJA 4F6RB 5EINA 4S1WA 1SWVA 4ZV9A 4GI1A 3G7SA 1QVAA 2GKSA 2ZJ5A 1E20A 1MA3A 2HMQA 5MN6A 4XVCA 3HBJA 1UOPA 8MHTA 1Q0GA 2F9FA 3RUCA 1NM5C 3PNLA 3V7YA 4HFNA 3TTTA 1PEKE 3ONWA 3IQTA 4KFUA 3NH9A 5G0WA 3R7BA 2Z0MA 4PJNA 4S0XA 3JSEO 4ONSA 3U3ZA 4B87A 4DVJA 2ASEA 2AC2A 2XRZA 2B6NA 1DOVA 2MJLA 1KK2A 3MJHA 2H7YA 4BCBA 1DIAA 4EGCB 2C97A 2Q4FA 3JALA 3GRVA 3KJIA 1TU4A 3E9RA 4XGRA 4GLBA 5TQVA 2Z9BA 3LE8A 4AK9A 3ROQA 3ZGXA 2AWOA 2G6TA 4KDCA 5EJAA 4CE6A 4LDQA 3NCHA 4D9HA 2Y1DA 5CLFA 3KB2A 2WJ3A 5AICA 1BQ3A 2AYXA 3DKIA 1I36A 3MWDB 1MC5A 3VQTA 3ZWYA 4RMNA 1KP2A 4YQFA 3DAFA 4J0FA 3WKDA 1YI0A 2H7XA 2KHZA 1DAFA 1XALA 4LZZA 4OGKA 1CK4A 5ES3A 3THXA 4F5ZA 1NRXA 5LMCA 3IALA 4V0NA 3K70D 2QRUA 1E6KA 3QX9A 5FAXA 1TCBA 1QGZA 1SD1A 4XYGA 4Y8VA 4X0EA 2JLQA 3Q1KA 3OPYI 1HE3A 1E5TA 3MD9A 3JRMO 1RBMA 1Z5VA 4HCJA 1H0HA 4MW9A 3QITA 3E7WA 3P9YA 3TDNA 2IDZA 1TRHA 1N33B 2HD4A 3N9IA 3NT5A 2EKZA 3KXPA 2XE8A 3Q7QA 4H0NA 1TMOA 4HTAA 5FRDA 2NPFA 2LR0A 4X8HA 4HH0A 1LS4A 4ZK2A 3QXHA 3K73O 3K6BA 3UUFA 2O23A 2RHGB 4Q6WA 3OZWA 1TEVA 1Q44A 4C5BA 2BGMA 4Q3OA 4FBGA 4FIDA 3V1YA 3B1XA 3HA2A 1GPNA 3FNQA 3OWTA 1FTSA 2VXYA 4J7AA 4MUJA 1KYYA 3ZEAA 4PR3A 1HE9A 1QLWA 3FYUB 5DCUA 3H4VA 1RNLA 4NOKA 5DULA 4XLZA 2REOA 2HMTA 1UC5B 5K0FA 1JDJA 3RJZA 3VR1A 1F60A 1Z2OX 3H9UA 3ZJ5A 3LT2A 5D6OA 4GYJA 3INRA 3EISA 3DMHA 3KQKA 3IMFA 1YZ3A 3D6MA 4MK4A 4LS3A 5DISB 3ANYB 5KNDD 1B6SA 3BREA 2O0JA 2QRGA 1CY6A 1A04A 3CNLA 5AXDA 4R1PA 4TTQA 3ZHYA 3E8MA 3WLRA 3B5EA 3MCZA 1BNCA 2I8LA 4I1VA 4WBNF 1Z4KA 3E81A 3OU2A 1WM1A 2C8LA 3NHUA 1KH3A 2Z2IA 5AH0A 4F4FA 5HM6A 3ZU6A 5B1DA 4CM1A 2IIQA 3CVOA 2PXXA 3GJ7A 1KRHA 5AESA 1EEHA 5KINB 3DBOB 2ZTSA 3UJPA 2VCCA 1AO3A 3OU7A 1CLEA 3SC6A 4QXMA 1DC6A 2OO7A 1T2EA 4WOBA 4GKBA 3R6GA 1OT5A 4ROSA 2Q0QA 3L8YA 9MHTA 4J6FA 1WL8A 4YBZA 5IAOA 3DJYA 4ZHQF 4KXYA 5DCWA 3H2YA 2C7RA 3SSNA 5TS3A 3RQIA 3LW8A 3I01A 2PZ8A 3GPIA 2PLAA 4B81A 5BMOA 5ERGB 2IXBA 4PFKA 3OTOB 1RMYA 4KR9A 1QE5A 3UMCA 2VYVA 1HE4A 5IBRA 4YV1A 2GZRA 4G8CA 1H6DA 1WSWA 4WOJA 4GZLA 4DOMA 3IDFA 4B0PA 4GSYA 1I0LA 3X1MA 5M3BA 4UATA 1SAYA 4PHGA 1NVFA 3IDAA 1E64A 2FW6A 1YKSA 3D2CA 1RWOA 2ZVQX 1TJPB 3H5VA 3HB1A 2HPVA 3KB6A 1M1YA 1AS3A 4O4LB 1GDHA 3GLHB 3Q88A 4MV8A 1XCOA 2W48A 4IHAA 5F64A 1CG6A 3HB9A 4HI0E 1NN5A 1SBCA 1FFWA 3WG9A 4HWSA 3PQDA 1BU8A 5AM0A 5BSFA 1XKTA 1CZNA 3EZGA 2O07A 2B8TA 5DS5A 4HXFB 4R2HA 1XIVA 1YDWA 4F60A 2XMPA 1T4MA 5GIPE 1GPWB 3MJVA 2OHVA 4MX8A 4KH0A 2CFTA 2HN9A 3AJ8A 5C5IA 2CUTA 2I2FA 1RZRD 2ZB3A 3HCDA 3T41A 4HB2A 3SIPA 5HRCA 2XPCA 5IT4A 2ZCVA 1OQCA 3LUBA 4L4ZA 2G72A 1N6HA 4IAOA 1X1EA 2WNHA 2R60A 3TCXB 4F6CA 1YJAA 3KWJA 2ZAOA 1P7WA 5DHFA 1PX0A 5K0ZA 2YVLA 4BEJA 2GILA 2DFDA 4YTEA 4ZRMA 1ULUA 1A8QA 1C2TA 1YZQA 3PDIB 2FX2A 2QL7A 3JWJA 4MKGA 4BB6A 3EHDA 4PC7A 2XKAA 2GAJA 4G5YA 5IMBA 2RKOA 1VGQA 3F47A 1CRQA 3JZ0A 5I9IA