3SPJA

Apo inward rectifier potassium channel kir2.2 i223l mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
330
structure length
321
Chain Sequence
NRFVKKNGQCNVEFTNMDMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
molecule keywords Inward-rectifier K+ channel Kir2.2
total genus 82
structure length 321
sequence length 330
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spjA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spjA01
2H8PC 2E4FA 5EBMC 3R65A 3SYPA 4MTFA 4MVMA 1V54C 3LDCA 3LDEA 4P2ZA 4PA9A 5KUKA 3AGWA 2A9HA 4RAIA 3SPCA 3IGAC 1OCRC 2DYRC 3OGCC 3AG1C 4HZ3A 3ATAA 2OCCC 1QLEC 4GX1A 3ZJZA 4GX2A 4PA7A 1S5HC 4X8AA 2DWDC 3AT8A 1P7BA 2DWEC 4WFFA 1K4CC 2BOBC 3ATBA 1R3JC 1ZWIC 3RVYA 2WLHA 3E8GA 4JTCB 4MS2A 3ABMC 1XL4A 5B1AC 4MVRA 1ORQC 5EBLC 1U4FA 3SYOA 2WLLB 2EINC 2ZD9A 3PJSK 2YEVA 1N9PA 3X2QC 4F4LA 3K6NA 3EFFK 2Q67A 2WLLA 5KUMA 3UM7A 2AHYA 3UKMA 2ZXWC 5CBHA 4PDMA 1M56C 3FB5C 4MW3A 4MVQA 3LUTB 4P9OA 4QE9A 3T1CA 4MSWC 2ITDC 3TETA 3ATDA 3K03A 4LCUC 3HPLC 4R6ZA 2WLKA 2JK5C 2NLJC 5EBWC 4MVSA 4JTDB 4KFMA 4WFEA 2EIKC 2WLJA 3SJQC 2Q69A 4RUEA 2HVKC 4PA6A 1OCOC 1K4DC 2QTOA 3BEHA 4EKWA 4MVOA 3T4ZA 4J9ZB 4QE7A 3STLC 4MW8A 4PA4A 3T4DA 1G4YB 4R8CA 5EC2C 5CBGA 3ABLC 4MVUA 5CBFA 5E1AC 4MTGA 5EC1C 3F7VC 3FB6C 4GX5A 3RVZA 5BZBA 1U4EA 3E89A 2IH1C 4H33A 2Y69C 5B3SC 2P7TC 3ABKC 4BW5A 2W0FC 4DXWA 4QNHB 1BL8A 3AG2C 2Q6AA 3ASNC 3K04A 4R50A 4R7CA 2HFEC 3F5WC 3STZC 3RBZA 3K0GA 4PDLA 4RUFA 2AHZA 3SPJA 2DYSC 3OR7C 2GIXA 2HJFC 2HVJC 4PDVA 4RO2A 3RW0A 3E8BA 4WFHA 2KB1A 5J9PC 3GB7C 3ATFA 2WLIA 4HYOA 5EK0A 4G27B 3SPIA 4XDKA 2X6AA 2X6BA 1R3LC 3F7YC 3AUWB 3IFXA 4JTAB 2K1EA 4UUJC 3T2MA 3WG7C 2BOCC 3OUFA 5IY5C 1XL6A 3E8FA 1V55C 4MVZA 3SPGA 3SYCA 4LP8A 2EILC 3ASOC 3FB8C 4I9WA 3TCUA 2HG5C 3ZRSA 2WLMA 1M57C 2ITCC 1KKDA 3ATEA 4PDRA 4P30A 4X89A 3E83A 4TWKA 3VSQA 1J95A 2IH3C 4LBEC 2A79B 4OXSA 4PA3A 2A0LA 4P9PA 4J9YB 3LNMB 2ATKC 2Q68A 4H37A 3SYQA 1R3KC 3FB7C 3K0DA 4ZBMA 3K06A 3SYAA 3K08A 2X6CA 3AT9A 1R3IC 2EIMC 2R9RB 3KG2A 3AG4C 4WFGA 4GX0A 4CBCA 1JVMA 3E86A 3OUSA 3AG3C 1LNQA 2WLNA 5B1BC 2EIJC 1OCCC 4X88A 4XDLA 4XDJA 1OCZC 3VOUA 2WLIB 3OR6C 4MTOA 3SPHA 3JYCA 4G28B 3LDDA 3E8HA 2QKSA
chains in the Genus database with same CATH superfamily
1IGIL 3N1GC 3VGDA 4DP7X 2PR9A 3HN8A 1OSEA 5KANG 2RQ6A 1NZ6A 1IL1B 2AJ3A 4YHMH 3C3TA 2OYQA 4L4TD 1MIMH 1VQ7V 4HZ3A 1VEPA 4J2QA 1NEZB 4GX1A 4O4HA 4PYGA 1WT5A 3ARFA 4FYQA 3V7MA 1AQKL 3EG9B 2IU0A 1JGVH 5LBSA 4OD2A 2VDLB 1AO7A 4XXDA 2O5YH 3LN4B 3NK4A 5IKCB 1E5UI 1KJMB 4FTVD 1TPXB 5K9QG 1BAWA 3MZGB 1KYAA 5DUMH 2R23A 3BCFA 2OQJA 3QQXA 1CL7I 2BNRB 1O6VA 2A7WA 3G6EV 2APWA 2QHRH 3RL2A 5KG9B 2JS3A 4Y9EA 1VZIA 1ADQL 3UBXG 4MNQD 3V6FB 2GABA 3AABA 5KWYC 5CA0A 2DD8L 3EXAA 1J0ZA 4P4KC 3RYMA 4GP8B 4RZCB 4UT6H 4YJ3A 4Y19B 2FX7H 1WVZA 3X14A 5J89A 3C8KA 1H38A 4LCWB 2FEJA 5LGHL 3CN3A 2V8LA 1YSOA 3HR5B 3VXRB 3WN5C 2EADA 4CH3A 5BVJA 1F3DH 3VM5A 3QEQA 4UYQA 4A37A 2P9RA 3E6HA 3JWNG 4PRHE 2BCCH 2B1GA 5SWZE 3E2EA 2IAMA 5HHVH 2D3LA 5JPNC 3GSNL 3WU2Z 4MNGA 4Q0XL 1F56A 4UDTA 3T0EC 1A4KB 2VXTH 1HFUA 1YNTF 1DFXA 1JFQH 3NCJH 5T1KA 2ZCLH 3RGVC 1Z9OA 1BL8A 5CFAA 2VISB 4H8UA 2FJHA 4JR9H 1HZLA 3TIDA 4O4JB 3QCTL 4A6YB 4J4PC 4ORGA 1T66D 3LJ3A 2J5WA 2VDQL 1KIQA 3L3JB 2BRRH 3ML0A 1NCOA 4GUNA 1OGTA 2WLIA 1A9EB 3QZPA 3MV7D 1F1GA 1KPUA 3UTSE 3CRQA 1QFWH 2IIJA 4LF5B 4GCZA 4RGNB 2AXGB 4GW4B 4WHCA 4WV1C 1D5AA 2YIDA 1MJJB 3KXFA 1E9PA 1DP0A 2GTZA 3A24A 4HJEA 5EC1B 3WFEH 3OKDA 5KBNC 2JCCE 2ZCHH 3MGTB 3U9PL 4APQB 2MOGA 1Y6XA 3D85D 1MNUH 2VS0A 1F97A 2YKLL 3N1MC 2J8UA 4HBQA 1THZA 2BSTB 4DP0X 4ZMTA 2NX5E 3IJ8A 2D0HA 5E6IB 3RTQB 4WFED 3TZVD 1GOFA 1N64L 4LLYA 4XP1L 5DVPA 4FQ2H 2ZD0A 3OC5A 2G9HA 1IU1A 4KPHH 1BX2A 1DVUA 3PLYA 2FUQA 1OWRM 1AJPA 4MJHA 5B1JC 1T89C 3WS3A 1W91A 3ARBD 3IKCA 4FYSA 5AUMA 4KK8C 5F1IA 4BA8A 1BXXA 2X4SB 2DBLH 2I26N 3KPSB 1KEGL 3F5WB 4KRPD 3HC4L 2BMKA 3L54A 3P77A 3TCLB 2P8PA 4HGWB 5CHNB 4JN1H 2V7NA 3RILA 2FO1A 3SBQA 1N70A 1WZLA 3PWJB 4OJAA 4KI5F 3H9HA 5EOQL 4X62O 4PIBA 4BFJA 1NMCB 2YUZA 4M61B 5IOPA 3ML8A 2DJUA 3RZWA 4JFDD 4UVBA 1P7QB 3MRMB 5BMVA 2EVGA 1T20B 5CM1A 2DQJL 4OIFA 1HNXB 3KLDA 4YQXH 1ZD6A 3HBZA 3PNWA 2BVEA 2NY3D 3CZUB 5EZYB 4XB3A 3HE7B 2WZ6A 2OSLA 2WKLA 2QGEA 3MNZA 4KPHL 5F7LB 2Q8AL 4H88H 3UACA 1AQMA 2KHAA 2G9KA 1DBBL 3QUMA 4R2GB 4YHOH 2V2TB 3HI5L 4IOFD 3VXQB 2Q3XA 1JDDA 1KF9B 4UQ9A 4CU8A 4RQQA 2R29H 2V33A 4LF6O 1L7IH 1U6AL 3SE6A 2C3HA 4YWGH 2VR7A 1CI3M 2HX7A 4M8UA 4H8WC 1R0AL 1ZHBB 3CDFA 4GAGL 2X2HA 3MREA 4O2CB 2AI0L 2YA0A 4OZ4B 3DMMB 1OHHG 1Q38A 2A73B 4X1YB 4ZMPA 5LG6A 1T1YA 1YEDA 3GSVB 1V3LA 1JPGA 3G04A 3BP5B 1G1CA 2DQIL 2XCMC 3FFOA 4ZPTB 1UQSB 4L8DA 3EHBB 3MDJA 4L29B 5DMGC 3V0JA 1T0MA 3TBBA 1U8MB 1G6RL 1S9VA 3JV0A 3QEGL 3QHTC 3VXMB 4NGHL 1MNNA 1I8UA 3RWRD 3L3KA 4MJID 3VXPB 1X7TA 3QUZA 1AIZA 1TQVA 5I75C 2K70A 3B8MA 2H9GA 5ECJE 4P2YA 1L7IL 4YBQC 3OLIA 1AFVL 1KIPA 3SZKC 5IOKA 2LT9A 1S7VA 2GJ6E 4MWFA 1A6UH 2BSEA 3FT3A 4GSDL 4QXUH 1B0GB 3EFFA 1TJXA 1MREH 3F01A 4NTXA 1SUHA 3B56A 4X5WB 5CMAA 2QMJA 3OTFA 4L4TA 4NZTH 5EBWA 4CU6A 1OP3K 5D7KE 2UX6A 4QY8B 3W7SA 4PJ8A 3IFOB 3ENEA 4X89A 1KXQE 4X4MA 1CFNA 1HSBA 3V0DA 3K71A 4DN4H 2PO6B 1HCZA 1QQCA 4MNQE 4FMKA 3X1EA 1UGKA 4PD4K 1QKZL 3TPUB 5KW9H 3CFNA 4BCXA 1SYVB 1LVEA 3WMQA 5BRPA 3ILPA 3QULA 3WTVA 3HUJA 2DQ0A 2BP5M 5ID0A 1AI1H 4MS8D 2VC2L 2IWKA 1A3RL 3L5IA 3EYUH 3T1YB 3RUGA 5KJ4A 4APXA 2XQYG 4I18C 3I6LE 3TT3L 4WUKH 4PVMA 4HGWA 3QG7L 1Q94B 5CHNA 1KXTA 1T22B 4POZD 4TN9A 5EOCH 4KMLB 5HHOB 4NRZB 4GW4A 1FE8H 1QA9A 3FS9A 2EYRA 3BUDA 1JTTA 3IDGB 5JR1L 3D05A 4K5LA 2YS8A 2BC4B 2Z31C 3KHOA 3ZRXA 2DWDC 1LDPL 5DHVB 2LFRA 2CIKA 5KAQF 4DRXA 1I3VA 5FLVA 1U8IB 2DIEA 4N9GA 4S1DD 4X6EA 4B97A 2V8MA 5HD8D 5B1AC 1W0VA 5A2KH 1SQXH 1FFQA 2PNDA 2DQGL 3BH4A 1BIHA 1A6PA 5EN2B 1OAYL 5I6PA 4D8PA 3US0A 1INEL 1MFNA 1Y0LB 1GOGA 2OTWA 4KZ0A 3OPZL 5F96H 2GC4C 4MVQA 2VLKD 3X1BA 1DL7L 1NEZA 1KPVA 1QBLL 3A67H 4HPOH 5DD3H 2FHFA 3V10A 3TBSB 2FATL 2MNWA 5I1KH 4CDHA 5B7MA 1AC0A 1R6VA 1GZPA 2YAQA 3FU9A 1FC2D 2D7OA 2NCEA 2V7NB 4OZHF 1KFAL 2O93L 4Y2DC 4MT8A 5T5FL 2EDEA 4POYA 3D3QA 1KY6A 1DJZA 1VFBB 3VB8A 1PNCA 5HHMB 1E65A 1YG9A 2HPOA 4R83A 4J5VA 4XCYA 3PJLA 1ZGLM 1F42A 4HJSA 1P4LA 2RGSA 3UTPD 4A5UB 3QQ4A 3ABKC 1FYJA 2NTSP 4TRPL 2ZT9B 5DFWH 3WKQA 1RJZA 4FFYH 3O8XA 1V3KA 3QE5A 3BIBX 1GTFA 3L2MA 1AHWA 4WQOA 5KYXB 3IGKA 2NLJB 1PG7H 2E86A 5C07D 4BKLA 1X9QA 5BVJB 4E5XG 4X65O 5FGCB 3A4FA 4LAQL 3T8MA 4HHGA 5BRZD 4XDKA 2ZPKL 2A4ZA 2OBGA 1DQKA 1YEFL 4U0QB 4G8GE 4HFWB 4GIAA 2B3IA 4M6ML 4GMTH 5IM7A 2VUYA 3QHFH 1BZOA 1S7VB 4S10A 5M94B 1CLOL 1OB1B 3G5XB 1DJSA 4I9QA 1PZ5A 3ZW3A 5TGBB 1J5EO 4OXSA 2XT1B 4YJ2B 3O6KH 1OV9A 3KHQA 2YRZA 3SDYH 5CF3A 1R3KC 1L6XA 4KMTH 5H2FZ 4I3RL 4MHHG 1JZDC 3RWCB 3DMMA 4IYHA 3SKOB 7FABH 2XHNA 2WKOA 3R7RA 4F58L 1ETJA 3VFSA 3WFCH 3WUWB 4AT6B 1U93A 3HPLB 4DV2B 1JTOA 2EDTA 4OFYA 4MB5A 1Z9MA 4I7ZC 1I9IL 2KG7B 1P9MA 5GGTL 1S5IL 1HESA 3T1HB 1U8OB 4KK8D 4NUGH 3LV3A 4XPAH 3HPJA 4PH8A 3C6SA 2EZPA 5L4IA 3I3DA 4AV5A 3S96B 1PYWB 1RKRA 1S9XA 2WOBA 3JD4A 1C16B 4CC5A 5IB3A 1JUFB 1QTYT 4JO8A 2BOBA 1ZA6A 1EDYA 2YEZA 1EQWA 5AKVA 3NH7L 1NLDH 3PJSA 1ASOA 3JWOH 4H26A 3GLEA 1Q81W 4WO4A 3S8WA 1RZQA 1F11A 2PUQT 4OVUA 1PNKA 1QHQA 5EN2A 1P1ZB 1CGUA 3OGCA 1NGZB 1OP5H 1LEGA 2ATAA 3HG0A 1IBBA 3GMQB 3UTZB 4WFBV 3PL6D 4HOWA 2E5LO 1XBRA 3C2SA 3D7PA 1FIGL 3NAAH 4N3TA 1TVKB 2IMMA 3WAJA 4OAWA 2OYMA 3DXAE 4G6KH 4TQPA 5D7EA 1KB5A 2QGBA 1GZPB 5F7NC 4HUWA 2BP8B 2F54A 3NABL 4NO0D 5D5QA 1N0LA 2A6IA 2PYEA 4AYDC 3LKQA 5JCOC 2DN9A 2X4NA 4UF7C 3FQUA 2B2XH 5AUMB 4AVJA 2BVUA 2L3BA 4YHIA 4GI8A 1A6UL 2IH1C 2DM4A 4NPJA 4ODTL 4DXWA 4QXUL 3SKUD 4WWOA 5F9JB 1KPRB 4H0LC 1HWWA 4Z7VA 4JFEB 1AILA 4YX2H 5DHVA 3WY2A 2OZ4L 1C5DB 1JYXA 4NQSB 3TEYA 5LXGL 4N9GB 4L4JA 3TFKC 3RW0A 4BR6A 3FC8A 1BECA 4TKWA 4PRPA 3BWSA 4D9RE 5AWNL 1JV5A 4HOZA 8PAZA 1FIGH 3NAAL 2A74B 1FZJB 4JTAB 3VFUA 3PHAA 4PP2A 3LPPA 3ULVD 4ZUTA 4GQPH 4F9LC 3DGDA 1DBAH 3FN0L 3SGEH 3LMJH 1TEFA 3P9LB 4LF9O 3KDMB 5E1GA 3S5LB 5AZUA 4BCZA 5IJBC 4L3EB 1PG7L 1U8HB 4XO5A 4YXLH 1QI4A 2F53D 1S3RA 3HE6A 2YQ3A 3QAZC 4E9VA 3W0WA 2EKSB 32C2B 2UXGA 2XFXA 2B59B 4UQ2A 1WJZA 2B4CH 3PHQB 1MZFA 2GSGB 3VRLE 4HH9A 1LO2L 3SDXE 2ROXA 4M03A 4X4XA 3IN0A 1EMTL 1N10A 1THCA 1D7BA 5DS8A 2VQEO 2QQNL 5EZOL 4DV6O 2VOTA 5AW4B 5HHOE 4W9ZA 4GBXA 1QO3B 3AY4C 3CX5F 4KXDA 1TYEB 1U93B 2AKRA 3B2DC 1U36A 2GJZA 2QADB 3BUPA 4HIIB 5C09A 5C7ZA 2GBUA 4B27A 3WIHL 1QLEC 4O00A 1WPCA 4Z7AA 3CX2A 2YPLE 2IGFH 4M9PA 1ADQA 1SA0B 1M1KW 1JBJA 3EO9L 1Q6HA 3AM8A 5BZDB 2ZX9A 4GYCB 3S8FB 4J3OG 3PAZA 2JELL 4B53A 2PP7A 1NFDB 2W81C 4PB0H 1QVOB 1QAWA 1PFOA 4I2XE 4L8SA 4NM8L 5KYUB 3EW3B 3HKBA 4LLQA 4PY7B 2WTOA 2RTTA 2Z92B 2EIKB 4I50B 3BN9C 1CXZB 4F5CA 2VLJD 1IJ9A 4CMMB 1RUPL 1Q0EA 2DZEA 4HK0B 5T3ZH 2XV3A 2B9AA 5A2FA 3FCSB 1MXDA 2MOVA 2YEVA 1GRWA 3P9MA 5KS9A 3GUTB 5KUMA 1J8HE 3NK3A 3LQZA 4U1HA 43C9A 4GG6B 4NIYE 4KHTL 1PL0A 3WNLA 5C08B 1UEMA 4X6DB 1SOQA 3KGUA 2M1KA 5GJTH 3RPIA 1P1ZA 1CURA 4KXCA 3S88L 1URFA 2R0LH 1HK6A 4YHHO 3PDDA 5F9DC 1CFNB 1DVSA 3WLBA 2AXFB 4I0CC 1A3ZA 2WBJD 5ABZA 1E6OL 2EVHA 3GMOB 1JD9A 3RU8L 1MCEA 4FLOA 4GRWF 3HN3A 3DX9A 2X4PA 3S3JA 4WI0A 1AACA 4QHUB 1D2PA 3IJYA 1JGEB 1E6JL 5KSAD 3T0DA 4OQTL 5FHBH 3QZLA 3FQUB 5DC2A 5GRUL 3CVHH 1ZGLA 4P2OB 2BOBB 3SN6N 3QUKA 1HEHC 1U96A 4X62B 5H94B 5EUOA 5T3XH 4JFFB 2CLVB 1BEXA 2BNQE 4KK9C 1N32B 4LCIH 3PUCA 1TO4A 1RY7B 3FO2B 3CFIC 4N8PA 3V0AC 2H2SC 4AMKL 4XCEA 2NY1D 4NBXB 2RALA 4BW9A 1J1XL 3D0LA 1ZHKA 2IPUG 1S7SA 2D31A 4UNUA 3CSXA 2EXWC 2XN9B 3ESOA 4WFFD 1FNSH 2BFGA 5E1AB 1I1AD 1UFIA 1AQKH 3SKJL 2YXLA 3H3BC 2GY5A 3ML9A 2LFSA 2CIKB 2NCMA 4LF8B 5FOJA 1PQZB 3KLHD 1E28A 4NQCE 2W92A 1G5GA 4P59L 5IV2B 1NDMB 5DFTA 2UVFA 4PJEF 4CW1A 2EX3A 1HKLH 4FQXA 3VFOA 4AUJA 4WFAV 4TT3G 3QZMA 1KTDA 5KVEL 4H0GA 5ETUB 4HH9B 3W39A 2E7BA 3RYFB 1E67A 2FZ3B 4TVSa 3Q2LA 2OYKA 2H26B 4DAGL 4EN3C 1MCRA 5IM7B 1HXMA 3JUYA 1L3NA 1PMYA 2K9PA 1DR9A 1VF5C 4QD2E 4U1LB 1NGYB 2R2CA 3VFPB 2WLYA 3ARWA 5C08E 4Z77A 4U0RC 2OX5B 4OZIF 3SQOH 4NRXA 3VI3F 5FYJU 2GJZB 4HIIA 1I1AA 2ILLA 5HDWA 4JVWA 2W9DH 4ODSH 4CDGC 3VD1A 3FSOA 1RSYA 1P5UA 4U6HA 2JSFA 4NPKA 1MCDA 4PJ7A 3AG1C 4N87A 4U4BA 4PP2B 3ZMZA 3MBED 4Z1VA 1Y74B 1S5HC 3GZOA 3NFPB 4K7PH 4DK3A 5JW3H 1FFXA 1KG0A 1XEQA 4EDXA 4NO5B 1TZIB 5JZ7D 5CA3A 2J57A 1QKZH 4AVHA 3DOSA 2UUDK 3RGHA 5E1IA 1NJ9A 3HE6B 3U0PA 4I50A 4Q74A 3O4OC 3ZRFC 3K3QA 2O72A 3DUUA 3JAKB 2NY6D 1RJCA 3A2FA 2X41A 4RA0C 5D2LA 2CKBL 3ZLQC 4DR6B 5F0LB 3TEWA 4NNXB 2COQA 1IFHH 3N42B 4R7XA 1UVQA 3KJ4B 3M8AA 3RX8A 4UWQB 1MJ7H 1S9XB 3LQZB 3HKZA 3ZYZA 2WBJA 3BVNB 3ZHNA 1LWHA 2BIPA 4LHJB 1EHKB 4UANA 1R9FA 3LQAH 2FBRA 4AW7A 4FQLL 4YSDA 3X14B 3ABGA 3ZL4H 4HJJH 1KGJA 1QFPA 2HJLB 4TVPL 5C09B 3HNVH 3R19A 4G5ZH 2H3KA 5E95B 4QE7A 1DEDA 1QFWL 3UCSC 5LP6B 1RP8A 1NGZA 4J6RH 1E27B 2WBKA 3ASNC 1G1XB 4PJ0Z 5T1LD 2WGXA 1MQKL 1HSAA 4ZD3H 2V37A 2V9UA 1BQZA 5EIBC 2HT3D 3IDYB 4O4LA 4HIXL 1JDCA 3AT0A 3S36X 5KJ7E 3ULAB 5LHDA 4A6YA 5FYJD 2YSUB 3N04A 5I24A 2QPEB 1CK0L 3SJVD 2F54B 4A7TA 4IW4C 5EIIB 4AJWA 3M07A 3UJTH 1IEAB 1I85A 1ZS8A 3IAYA 2K1EA 4I9XA 1TGOA 4EN2A 4WI6A 3ARBB 4AXWA 1MAKA 4FQHA 2PI5A 2P5ED 4OM1L 4X5LA 5H37G 2MIZA 1E5YA 2YGVA 3LEVL 1BV8A 1MFVA 3JSNA 1XNRO 1HT6A 2WZ5A 2IPUK 4MCMA 1AGFB 5H5NA 1E90A 4FCAA 2VRZA 3ESVF 3OE7G 5ITZA 3EO1B 4NPYB 4PJ5B 1TCMA 1H5BC 3FOMA 5E6ZA 5LWYL 3CFJA 1AANA 5JTWA 4UU9B 3W7TA 2DMGA 3UABA 3GSNH 1WIUA 3IK2A 1JMZA 3K4ZA 3L5JA 4Q0XH 3F00A 3VFUB 1UD3A 4NX0A 3R06B 1T6VN 3KPSD 1A4AA 2HFEB 2R0WH 2ZONA 3H7BB 4JDTL 4G6JL 1OM3L 1N34B 2ERJC 1CMOA 2ITCB 5IR1B 1BXVA 5F21B 5DC0A 1SHMA 3NIDF 4UQCA 4Z77B 1NBVL 5HGDB 4U3JB 5T1DH 4BSVB 2ZOWA 1F6AA 2Z31D 2OMBA 1LDPH 3MLPA 4LPCA 4DAGH 4MA7L 2K0RA 5A6MA 1AXTL 4G8IB 4MNHA 4PMFA 2BIOA 4NBYB 1JPSL 2CD0A 1GK9A 4MD0A 5LGYA 4TQHA 1WP8A 3ZE2E 5JA8B 3SGIA 1SY6H 4UZGA 1IQWH 1EO5A 2R2HB 2OPCA 4OGQB 3NG5A 4J39A 5IWAO 4ZMLA 1H3GA 3ISRA 3SYOA 3D48R 4B3VA 3DX3A 3ZXAC 4Y2LA 1A6VH 1U9KA 2VN6A 3N1FC 2QKIC 4GRWB 4PV1B 2BNRE 4ZQTA 2Q7NA 3P1VA 2HRHA 4QHKI 4UUJB 1XGRB 2DLHA 2Z35B 9CGTA 3BAWA 2ZOKA 4P07A 2W65B 2JGUA 1PNDA 2ARJA 4XO8A 3KPOB 1BLNA 1AHMA 3GSXB 2Y0PA 4IKNA 1B0GA 1CF8L 3EFFB 3VNYA 3CQPA 2VQTA 1KP3A 3B2UD 5C2UB 4YHNB 4PJBA 1LEKB 3QO1A 1AIFA 2XKNB 3KPPB 3D25B 1WS7A 1O9VA 3AEIA 4LLMB 1Q9LA 3GKZA 4DV7B 1PKQA 2A77L 1TR7A 4WBNA 1WFNA 4X8GA 1IBHA 3T8XA 3X3GH 3H1ZA 2WZAA 5ACZA 1UOWA 4WSGA 4O51A 2OTJV 3QS2A 1FYHB 3WJLA 4GSDH 3NBNA 1FNAA 2ITDB 1IARB 4NOBA 2CM6A 3BRDA 5D1QC 3ZDXE 1E2WA 4F3FA 4L29A 2XWRA 1BAFH 1XMEB 1IAIH 4BWUA 4ERSH 3VXTA 1J0IA 2CO7A 4RO2A 3NESA 3NQIA 2JGDB 4F7PA 1J18A 1O7SA 5ID1A 2ZUUA 3V6OC 3K6IA 5F89A 3B8SA 4KK5D 4J2XA 3Q9PA 1ACZA 3Q2NA 1I1FB 5LGHH 3QCUL 2P5PA 4PGEA 3T2MA 4P5SA 3L71H 2FX8L 4F24A 1IC1A 1HW7A 3EVKA 1GS8A 2QZ5A 3QYMA 2W0FB 4W9EC 3V0EA 1DDHA 2DV6A 4N0UE 4GRLC 3WAKA 4DQOL 2KQXA 1XI1A 1PD1A 3H9VA 5JO5B 2B9BA 5EZJA 3FFCA 4H2CA 2OI9C 5L4MA 5B1NA 1YEEH 1NIAA 3IFPB 3IU4H 2FBJL 2VDRH 2WUBL 5D1XA 5GS1C 5IROA 2VJ8A 2W59A 2AZAA 2NXYB 4KQ4H 1H3VA 5ILTL 5BQ7B 3WY1A 1T1WB 2A38A 4F93B 3QR0A 5AW9B 2EIJC 4APQA 2GBTA 2DQDL 4XDJA 3SOBH 4FQJL 4HBCH 5CLZA 1T1ZB 5K1JA 1OTSC 1WAAE 1FA4A 1KMIZ 1PKXA 2NNAB 2H8PA 3LXAA 3QQDA 3V0GA 3ZBMA 1UWYA 2LOEA 4UQAA 4APXB 5FV1L 3CDZA 5A2BA 3ZBHA 1I53A 2BVQB 5EZIH 1KJVB 1VA9A 4WI0B 4DV5O 1U92B 1S7QA 1FSKC 3MRJA 1IBMB 4PJEB 4DW1A 1ZVSB 2EO9A 4HWNA 1U8JB 1GAFL 4PJAA 5K39B 4N1CA 3G5YA 2B14A 3AREB 2DMCA 4PJGE 4TVPE 1IBKO 1QI5A 1FNFA 2RR3A 1ETZB 2PTUA 5DT1H 5EU6B 4HT1H 2EDHA 3AXLB 4LLWA 5BV7C 4JZJB 3NIFF 4IIJB 4ZOLA 2AERT 2UXVA 1LUVA 4TOYL 5JMOC 1F4WL 2H32A 5JYMA 4Q89A 3NXSA 1QHPA 5CR1A 5SWSD 5CBAB 4LKCB 2I24N 1NVPD 2ZIDA 4U3XA 2HFGL 3HS0B 1N6UA 2NQCA 4HMEA 1J12A 2Q2EB 1SRYA 1GH6A 4UUJA 4X2UA 5KHJA 2OZ4A 1BZ9B 5DC4B 2QBWA 3CFKB 5IVZB 4IU2B 3NCBB 3IXAA 3CLWA 4XVSH 3T1YO 4WNJA 3VFWA 2WXGA 2BVPB 4X50A 5FWRA 4FQ1H 5E5MB 2Y7OA 4MVBC 1FC1A 1RZKL 2JB6A 1XQ4A 1GMIA 1G4YB 1S2EA 3EGDB 4P5TD 4XZ4A 4U2YA 2VMJA 4R7LA 4ZIBA 5DO2D 4UAOB 4G9DB 1QNMA 4PJAF 4G8IA 1J9CT 4XAWL 3X1NA 4Q7DA 5ACZB 1FAKT 2Q0ZX 4JRLA 2J56A 2R4SH 1OAXH 1J9RA 3G6DH 1GR7A 1M53A 3C6LA 3GM8A 4M8QA 2H94A 3QZNA 1WCBA 4J8RA 3LPFA 4WIQA 2VW6A 3TVMC 4OR1A 3VWJC 4WAFA 2EDDA 1LGVA 2VWEE 5MERB 3F7YC 3DVNB 1UH2A 1MH5B 3EJRA 5HDOA 1OAKH 4FNUA 1T2JA 5ALBH 2IPKB 5A1AA 4AI8A 5I18L 1NCGA 3WS6C 4CU7A 4RQFA 2KZKA 2VT0A 3KYOB 3P30L 3QDGE 4X20B 4BCYA 1A6TB 4Z2WA 4PJHF 5G2NA 1CLZH 4PJBB 4DPCX 2YD3A 2FYVA 3SYQA 3Q4HA 4MAYB 5JPNA 5EEYA 4UINH 4DTGL 5D2NC 4LSSL 3L3DA 4UT6L 3QEGH 2NXYD 3CDGB 2F5BL 3NJLA 5DRZA 3FT3B 3VXSD 4PMEA 4B3RB 3WEMA 3ZO9A 1EFXD 3P2BA 4PCKA 4J4PA 3WIFA 4GBXC 4JRXD 1BQSA 1AD0B 5DSCB 5K93A 2HVKA 5ESAB 5E9DB 2OMYA 2C1PA 3AMKA 5EC1A 1RPQA 3T3PF 5FXCH 3H55A 4FF9A 1NZRA 1AR1C 9PCYA 1P6AB 4HUUB 3D1MC 3QIBC 4HF5L 5HYJA 4XCCH 5GGQH 1RJYB 3F7VA 2IH8A 5DDHA 3ASOB 1A4CA 2CDGA 3FULA 4XNZC 5BV7L 2R51A 1UOVA 3OX8B 1YVWA 1A7OL 3F84A 3TC9A 4I4WA 3G5YB 4R6UA 3ABMC 2C26A 1G9NC 1X5JA 4Y4HD 4JVUA 2G2PA 4LLWB 5HI5C 4GW1B 4JM2A 4RMSA 3F04A 5F0PB 4MVBD 1LQBC 1QUNA 2X3BA 4LIQH 3V95A 5HHOA 3QIWC 4WO4B 3KL5A 1KN2L 5I1DA 3RWHA 3GI8H 2KLSA 1TTFA 2W94A 3MRPB 4U3HA 4F8QA 3TO4A 1KN4H 5DHYA 4Z76A 3JZYA 4XP5L 3KYNB 5J1AB 4JE0A 4AKQA 3ULUH 4MDJB 5DQDL 4JMXA 3CZJA 4FADA 1I3UA 4KJYA 4X42A 1EH9A 3T1WA 1XIWD 2Y25A 4K7FB 3BCDA 3P9LA 3SD5A 1BQ0A 5D7IF 3U4BL 5KHHA 4YSOA 2YAHA 1DO5A 2B59A 4UQ2B 2DMXA 2CRMA 4JAUA 5K39A 2XNDG 1BMGA 3KLHC 3II1A 5FPIA 4MX7B 4DKEL 4XE5B 4JFEE 2DL9A 2Q20A 4EIBA 1WWAX 3GRWH 3EADA 2C9QA 2DEYX 3F7LA 1GPOH 1YTFD 2FATH 2R1WA 3CLFH 1XH3B 4HJIA 3QQ9C 1IAKB 4XOEA 4F7MB 1MCOL 2UWEF 1C9SA 1WBXA 1YY8B 2DQJH 4ZYKB 3UC2A 1E3FA 3ZL4L 4KQ4L 3DHUA 3H3PL 4NN6C 1XIWA 4UXNA 3DDFA 1GGIH 1HI6B 4HAKA 1F41A 3CD4A 4F3FB 1L9QA 5EBMA 1BQRA 2LQRA 2NY2D 4OZHA 5F0JB 5FCUL 3ZE0B 1CN4A 3SE4C 1WA8A 3HZ3A 2AMUA 4G82A 1TTAA 1SY6L 3QUGA 3M46A 1PY9A 1WAPA 4G8EA 3QQ3A 1TJIH 2RCSL 2DQHL 1MELA 4F2MA 4F91B 1UJ3C 5HVFB 4H1LB 1UZ8B 1X7QB 3HTLX 2C3XA 4AQ8A 3UCQA 4L3CA 4YDJA 4AQ8C 5I6MA 2EDLA 4B9CA 4H20H 4F20A 5D7JB 3NR7A 3GZKA 3X12B 4U7SA 3UP1A 3P4NB 1F4WH 3BZ4A 3OXSB 3DARA 5GSRB 1XTMA 3HNTL 3HAEG 5C6PB 2AJZB 4O2BB 4C7UA 3CXDL 2H6PA 4LCUB 3LRSA 3OKEA 4R3SB 4MDIA 3HC0A 3FW6A 2AVFA 4QRFA 4DW2L 5KBDA 3FF7A 3KYOA 2AEWA 4RZKA 4KQ3L 4GKKB 1DZBA 2EDYA 5F7EL 1TJIL 1YN7A 2NXZB 4XO4A 3IGLA 3UT5A 4LFHD 2APVA 4ONHA 3VQYA 3MVSA 4S1RH 1NPNA 3UXFA 2VW7A 4J3TA 5DZAA 1TQTA 4BH8B 4HU8A 4JI3O 2OCCB 1P4UA 2D31B 2C9SA 3CE2A 4B9JA 5AW3B 2K1MA 4BFOA 2W9LA 4ENZA 2P24A 4ANKA 3RPIB 3U0WH 1KELH 3LNEA 1GSKA 4JZOB 3C5SB 1BOGB 3MBXH 3PUUA 1BIIA 1N26A 4DVBA 2F1EA 4IJ3C 1RQ5A 3HI1B 3E8UH 5E8DH 5DRWA 3QRFM 4YGVB 3OKNA 1HDMA 2BTOA 4I55A 3BPCA 5C70A 1A1OB 4F33A 1YN6B 2VZTA 3I5DA 3GC3A 3QUXA 4I9WD 4QT5A 5CFHA 1T2QH 3EYQD 1WJ3A 3NEOA 5E6IA 5EUKB 1H3TA 1HINH 3NJGA 2GW5A 4WW2A 4ZX5A 1XILA 3B2PA 4QHUA 1TA8A 5J6HB 4QGTA 3B7SA 3CMOL 3K0GA 3KYMA 3CFKA 4EIGB 2RCVA 1ZHNB 3MLVH 4KNTA 2NZ1A 1HH9B 1N0XL 5CEZD 2X1WL 3H1HH 5EOCL 3Q7JA 2ZE7A 4HUXA 4JI5O 4FG6C 1N4XH 1W2BU 4QRPE 4LPWA 4QTIL 4XPTL 4A38A 2Z5UA 1WV7T 2X9ZA 3STLB 1IGTA 3CRRA 4C54A 4YDIH 4CBPA 4WRLA 1GHFL 5KVGE 3TFKD 3QP3A 2XWCA 1MCPH 2ICEC 3VI4A 4DFIA 3CVDA 1VPOL 1A7RH 3GRBA 2K7QA 4LOUC 1EUTA 5LL6Y 2XZZA 3B83A 5I1LA 1UWXK 1ET8A 1D5BA 4P3DB 3QUXD 2WXIA 2KSDA 3N91A 1FXVA 1ILSA 2IWGA 4XWOD 1HJBC 1JHTB 1S76D 2VIRA 4QTFA 4GP5B 5C0BA 1RM1C 5DQ9B 4KX8A 2IGTA 5DVMA 4EEEA 1O6SB 2BVYA 2EJRA 1MH5A 5I1KL 1IGJA 4WW2F 5ICYB 1HNYA 3AG3C 4B08A 1MCBA 1E6JH 2CA4A 4LHUG 2EC9U 1FNEB 4ANXA 5IB2B 2F08A 4IU2A 1G4MA 4Z23A 4K55A 4D6TH 1A6WH 1MPAL 2EIDA 4KROD 1KU9A 1VZGA 4DKAA 4IBQA 1A0QH 1RUQL 3PWVB 1MHHA 4G11A 4IDJH 2K4AA 2IOOA 4X6CA 4YL4A 4WGWB 3UAJA 4AGLA 4DVRH 3UM7A 5DJ0A 5TISZ 1N32O 2M83A 1AH1A 1H8NA 4CKVX 1NL0H 3LD8B 5B7FA 3OT7A 4JPWL 2I5YH 3RJOA 3WIHH 4DGYH 1S8DA 1A1MA 1UOLA 3F12B 5I73C 4U6TA 2IBZH 1A1NA 3MREB 5IBUG 1AJ7L 2VDOL 4ONFL 4PHZA 1AYOA 2AQSA 2DQCL 4AQYB 1AHKA 3NACH 4OLUL 2EEDA 3OR6A 3BAAA 4G7VH 3PV7A 2CDEA 5LP6A 4M6OL 2WLHA 1E4XH 1I4FA 5G55A 3KPTA 2ZCLL 5D7LD 4XP6L 3QG7H 3KH4A 1W72B 3N44B 2OMYB 4Y4KB 3U1QA 4B9GA 1QX1A 1UT9A 3DMMC 4ZX3A 4G5AA 3K1KC 3QUZC 3BC9A 3BAEH 5D7IB 1BWMA 3S8GB 1N8ZB 2ZJSL 1EM1A 1XGUA 1BGXL 4Y16D 1FAIH 4J27A 1KZQA 2WMPB 5EG6C 4JKMA 4MQ7A 5IROD 5E4AA 3KH3A 3MLWL 1JXDA 4YNYB 5F3FA 4CBZA 3QDMA 5HJGA 1L0PA 4YR6B 4IHJB 1JWSB 1XSKA 2XY2A 2XVLA 4O02H 5CMAB 4HNAA 3L3JA 1Z5WA 2VZOA 3ARSA 1WBYB 4U31A 4X1IA 2APBA 5GGVH 1DEEB 3B1TA 3RVVC 4WFGE 3TASA 3HBGA 5ADPL 1YI2V 4J3OC 1DGSA 5BOZG 4M7KH 1M3IA 2MK3A 5BZBA 1U4EA 3QWNA 2OZ4H 3KPQB 5FUOL 2EH8H 3MRPA 1KXVA 5ICUA 3BA9A 1EXUB 4QAWA 3KYNA 1K4CB 5CB4A 3T0BA 4PRDB 2AHZA 3Q5YA 5DCCA 1FL3A 3KR3H 2ZJSH 4IGBD 3BLPX 2ZKWA 2PO6C 4E9LA 3ZDZB 4DQAA 3OZLA 5DJZB 4KMTL 4KO6A 1CE6A 1XF2A 2VMEA 1NAMB 1E9OA 5DMJB 3MJGX 1TVKA 2X40A 3BW9A 3SPGA 1F6AB 3M17B 5AW8B 1E3XA 2CZNA 5HPOA 2VR8A 3QUKB 2FLRT 2LQTA 3VQWA 3O3AB 1FJ1B 4NSKA 2YPKB 1GXEA 5JXAL 3CB2A 4OQTH 5EO1A 3TX4A 4OLZL 1A7OH 4Q6YA 3RWGB 3LS5L 4B3TO 2JIXD 5E1AA 2VLKA 3CFJB 5I5RA 2XRAH 3L7EA 3C9NB 4JN2B 4GXFA 1L9PA 1PGRB 4Z3FA 1R19A 4GT7A 5EUOF 3ULVL 4DV4B 5F93C 1T5KA 2EE0A 2HFEA 2OL3L 2J12B 3O6FA 5ES4B 4HK3N 1G4RA 5F7EH 2H8PC 1KLGA 2H2SD 5J06A 1ZE3C 1JGDA 2Z7WA 3NOIA 4OCYH 2ZICA 3IDXL 4YXKL 3LH9A 3RIAK 1K85A 2Z1KA 4QWWD 2LTQC 1RK1A 1R34A 4EKXA 4AW4A 1WA1X 2CGRL 3V4PB 4IRJD 3L3OA 4ZFOB 5FYJE 1PKOA 1CJYA 1AG0A 3MCKB 4LT7A 3HMWH 3ATBA 1WH0A 3U0WL 1WD8A 2J6EH 3GSRB 3QQ4B 3OR6B 4CUCA 4RIRB 4PRBA 4XN1A 1ZHBA 2BWQA 2F4VB 1XL4A 3GWJA 1B4JL 3MNWB 3EFDL 1I4FB 4KHXL 4Y2DB 3X12A 4Z3HA 1U8PA 3CRAA 2EICA 4PRAA 4Q4IA 2GITB 4XZUB 3BHBA 4HUMB 1UATA 1DBAL 3FN0H 1UM4L 3GDCA 2G38A 3L4ZA 3HKDA 1U33A 1JZIA 2Z64C 4OLEA 2WMPA 3B2MA 3OTOB 2VLLB 3MRLA 3VB9A 4EMZA 1RZ7L 3I2CL 3K0YA 4KJPD 4TPRH 2X1OA 5D5MF 1TEYA 4K35A 1WHPA 4RUEA 3O9WD 3WMSA 4MMXB 5GHWH 4B6ZA 5LXGH 2QHRL 1B06A 3ECWA 5I1AA 4MB3A 4G6AC 3UT5B 1SMAA 2VE6B 5D2LB 1JVLA 3EYVB 2EACA 3BZ5A 3E22A 3W38A 2ALWA 2V5TA 3SPVA 3EGXB 3DXAB 3CVHB 4XX1E 3F7KA 2GJ6B 2HG5A 4IK7A 1WRFA 4UTCA 1SDYA 1VQOV 3GSOB 1NOLA 3FQTA 4LR3A 1N6QH 4JAAA 3SE9H 5BS0D 1VSCA 2G0KA 2YRLA 4FM2A 4OM0H 3OXSA 4XBEL 1BEYH 1T1ZA 4BFKA 1LP9E 1AQDA 2CKBA 4QIWF 1NC4B 2CU9A 4JAVA 1YF2A 1INQB 2O6EA 3B7RL 4KDVA 3ARGB 4XRCB 1SYSA 1CIDA 2JCWA 4YDVB 5BNXD 1WE5A 3MRJB 4FQXD 4P3CH 2WO3B 3RB5A 1T04A 3ECQA 4ISVB 4K3JL 4I7ZB 1NCIA 3OJ2C 1U8JA 1R3HA 4A68A 2IAMB 35C8L 3RTQA 4DUYB 3KAAA 4LBEC 4PA3A 3G9AB 4JEGB 1BZKA 4P5TA 5KSUA 1SC5B 3LS5H 5JO5A 1U2HA 2XG4B 1JI1A 4FZ8H 4RWUA 4LFCO 4IMLA 3TJEH 2K45A 5E2VH 5EZLA 4HOMA 1N36O 4CJ0A 4G9FB 5D6DA 2IH9A 3ABLB 5B4MC 5HY9A 1CXKA 1NM9A 2MQ0A 3ME0B 4UM8A 3VQLA 3SKNB 2AJSL 1LNQA 2P8PB 4JRYE 1WGOA 5D2NE 2YIBA 1FDLH 4QCIA 4G8FB 2XAGA 1KPUB 1FFPA 1EAJA 1Q8IA 2VDPB 1IGMH 1ZX3A 1SXAA 4PM1A 3SOTA 3L95B 5IQ9B 5L88H 4ZUUA 1NBVH 1JZJA 1SQ2N 4X64O 3OZ9H 4R96B 3DC0A 5D1QE 3TNMB 4UCSA 2WLZA 4JQXC 2EEFA 1FZOA 2CAZC 2OK0H 3L8QA 3ZHVA 2P06A 2UYLA 2X4QA 5D1ZI 1RUAL 1TZGH 2Z7UA 3GEFA 4HS6A 4NLAA 3ZZSA 4UV4H 3IM1A 1FIEA 4PP1D 3IJ7A 3EJQA 5FB8B 1MFBL 2RACA 3VVVA 1R73A 4YDMA 2AK1L 2VXVH 2ZNJA 5BZWA 4JYYA 3GI8L 4M62H 2NW3B 2W07A 5DFVD 2Z6FA 5IP4A 1P4IL 3TT1L 2NT1A 1C5BL 3GB7A 1XR8B 4XWGH 3CWBH 4O4YL 5KOVC 1NGYA 2IH1B 1GMEA 4WI4A 4P0DA 4AUUA 1HHJB 4F15B 3IJ4A 4UVCA 3MXWL 4PJDF 3LX9A 1WP7A 1RU9H 4G42B 2F53A 5LAPA 4LIQE 3Q44A 5FR3A 1P5UB 4U6HB 3TOPA 1NFIB 4C4UA 4X6DE 4WI9A 3VTMA 2GAZB 3NMEA 3JWOC 4FFYL 3PNWB 5ISZE 1HHKA 1YMMB 4XI5C 5HDBF 1S9VB 4Y7MA 3NFSL 3T0ED 2VJ0A 2CH7A 3HFML 1TLKA 3QUYB 2Y6SD 3QQ9D 1FBIL 4CVUA 1BMWA 4B3SO 4XVUC 4NHCL 1RL1A 3QT2A 2NQ3A 4LF3A 5GJSL 1B9KA 4PBXA 3DPDA 4AQEA 1GZHA 3ILDA 1K97A 4NQCB 4Y8DC 1RUPH 4AOFA 4JG0L 3FX7A 2BFVL 2BSCA 4MJ2A 5DWUL 3QFJA 4GO8A 2FUTA 3AUWB 5ESAA 5J5EA 3GHBL 3TA3B 4DPBX 2YK1H 2BCKB 1RH8A 3BP4B 1UGNA 4Q6IA 4Y5YB 2K8MA 1NBYB 4L0ZA 3ZKXB 2ICCA 2Q3ZA 3JAWA 2XZQH 2QWNB 3ULUC 3NA9H 5ANMA 5E08H 3BESR 4L8SB 3S37L 2IANA 3UYRL 5C3TA 4IOIA 2ATKC 2C9AA 5EEZA 3DOHA 2WNWA 2IQ9L 1TVHA 2W95A 3MMEB 4RWYH 5MEQA 2FNBA 4HFUL 2WZPA 4AGMA 4TUUA 1R3IC 2FQEA 4MB4A 4NUQA 5I1EL 4UCOA 1TJGL 4CL7A 2F23A 5TQ0H 1JVMA 2I85A 1PX8A 5EYPA 3OKOB 5HYSA 3UBGA 4ZQKB 1UYWL 1MNGA 2CQVA 2J5LC 1LEIA 5CN3A 4DK6A 3D4ZA 1RPUA 1Q94A 3NPSC 3F65A 4Y4HA 2GHWB 5E79Z 1UUSA 4UIMA 2WXHA 3MBEC 4U6YB 4DR6O 2WQXA 4WW1B 5CINH 1PZAA 5I8OL 2EC8A 4FFBA 2NX5B 4MJIA 1VDGA 4FFTA 4N68A 4OY9A 4JDEB 5I8KL 3JD0A 2F8OA 3O2DL 2FO4A 4FJYA 3EYFB 4QYAA 2PXYC 1QLEH 5EEWA 4YDVA 5DEDA 4NQTA 4EEQA 4OUOA 3NCWA 3CPUA 2ESVB 4NYLB 5JIHA 1FZOB 3FRPA 4KHPB 4WHTA 4OJCA 1RZ7H 2X7LA 3I2CH 2AZUA 1ZAGA 4Z3TA 1OARH 3VGGA 4AZUA 4I4WB 3LSUA 4KAQH 5BZXA 1Z9PA 3CC1A 1S9WB 4QXTA 4X80H 3L3OC 3DGCR 4YHIB 1UURA 3ECBB 2GJJA 3VXOA 3RL1B 4ADJA 4FX5A 5C7XL 2XTLA 3ZHQA 5J6SA 1GJIA 3TH2T 5DJCB 3ZRWB 1JE6A 4NQDD 1Z32X 3U2SA 3IFNL 2WXNA 1XIWB 1Q43A 1MJUH 3OAWA 3N50A 4JZJA 3TVMA 3VAEA 4E5XA 1O7VA 2V2WA 2ZWLT 1VFAA 4PJ9D 5GZND 2X05A 4BSWB 2W60A 1KIRA 1LMKA 4D94A 3QRGH 4UMSA 5B3JE 4ATWA 3CVIH 5A7BA 2YGOA 4DO2A 1LD9B 3PHSA 4H33A 1ZT1A 1XSJA 3JASA 2ORBL 2P47B 4OD3H 1YYML 5KYNA 3KDMA 5HYSG 1CICA 4PDLA 4JX0A 3UCRA 3VFGH 3IRZA 3UTTA 1H0DA 4MNQB 2YXWA 3K59A 4WFHA 1GGYA 1I8KB 3H9SE 4J1UB 3RYCB 3D39B 1L9OA 4L3EE 4TNGA 4WU7B 1JXFA 1NI8A 4YHKH 4ZMOA 2W80C 1DQTA 1YJ9V 2ZYRA 1VQ4V 1FH5H 3RA7H 2ARJB 4HJGB 2I9TA 1ZLSH 1G8MA 2QVFB 3O2VL 5FKPB 3KLAA 3ARFD 5D7LB 1CGWA 4PB9L 2H0EA 3ARPA 1W0JG 1HZHL 4F6EA 3P3SA 5JYLA 3ATEA 3BGFB 4LLMA 1KJ2A 5ADPH 2Y5TB 2LAGB 5I6XB 4OV5A 3W5MA 4RISH 5DTFA 4ZI7B 3LZFH 4GUOA 5IYCO 2XN9E 4KZDH 1ZHLA 3JZ7A 4IIZA 4ODWB 4IOIB 4TTDC 5EPMA 4XE0A 3VG0H 1XREA 1KJ2H 2IDSA 4L23A 4GZRB 1NIDA 4IU3B 1I94B 1OT1A 4O4IA 2BNQB 4NR1A 3NIGB 3QIUA 1I7UB 1KELL 1UHVA 1VFMA 4FNTA 5AOIA 2C9UA 3IWVA 1TZOA 4BXSV 2YO3A 1GCFA 1E50A 1WEJH 2R23B 4ALAC 4HK0A 2H4EA 2VDMB 3QFJE 5BJTB 5I71B 3SE8L 2XXMB 4FQCL 4P46C 4Y9FA 5D8JH 5F9OL 4XT1C 3ZHSA 4Y0GA 2BTQA 3IGAC 4QNPE 4QO1A 3RWFB 3TS8A 5D7SH 3VQVA 4G71B 4NNYB 2JKNA 4X8JA 2BIHA 4X5XB 4AM0B 2R2BB 3UAJC 2J6WA 1YUHB 3FSVA 3VVWA 4YDLB 2DWEC 4RWHA 3VBBA 1XMOB 1II4E 3B8YA 2NY7H 4RMVA 1SXCA 3OLDA 5IBTL 4Q56A 3VGHA 2E7MA 5D72H 4LASH 2V2XA 3HRPA 4M5TA 3RTQC 3DX9B 5EC2B 4K9EC 4DR4O 4TSCH 4GP4B 5DHVH 1MHEB 1NFDF 1WFOA 1KQSU 1MAML 2AXWA 5A7EA 2VN3A 4ONGL 4HX1A 2ZR3A 5EDXA 4P2OA 1WSST 3I50L 1ACXA 4E41E 2JFCA 4AQZA 5MEOA 2ENJA 3FFCD 5I28A 3BUTA 3MFGB 4M4RB 1WISA 4EKWA 3F85A 4TNWK 5BZWB 4F37K 1J8KA 4G3YH 4BWAA 3VSUA 1AGFA 1E4KA 3H4FA 5EU7E 2OAAA 1GN6A 3PAVA 5AOZA 4AWJC 3REWA 3IT8D 1BCIA 1NCDL 1OKEA 2BWIA 1A25A 3BVDB 4Y1AA 5EWIH 3VXRE 2QMKA 4ELKA 5C0FA 3WHXA 1UZ6F 2P48B 1OCZB 4MDJA 4PN6A 4W6XB 1K5SA 3NIGF 3WIAA 1SN2A 3V0VB 1LO3L 5MEPB 4PRPB 5BCAA 5F7BA 4TV9B 5JW4N 4BUGA 3RGBA 4XAKE 2ZDIA 3EDDA 2ITCA 4A7UA 5IR1A 4BH7A 2PLTA 4G27B 2L7JA 3G6BA 3UP6A 3N85H 2APTA 4ZUUB 3UYPB 2CO6B 1NGWB 2BSBA 1SN5A 4UTBH 5AB2A 3FT0A 3WNKA 4RQEA 3BEVA 4ZOCA 1RZJC 2RFXB 3SDXF 5KAFZ 5FM4A 3HJ0A 5LMUB 3R1GH 1IGFH 4WGVB 1PL3A 4AVIA 3DNKA 3CFBA 2XWJA 3ELAT 4PLKC 4JRXE 2ZWYA 2E4TA 3IETB 1N0LB 2WTRB 1WUNT 2JI2A 4RGNE 4W9CC 4OM1H 1J95A 4I88A 2IH3C 2QADD 1ID5I 2WNKA 3CFEA 5C0CE 3ROLB 3SDAD 3T65A 3KDPB 4HKXB 4LCCB 3GMRA 5I2IB 4M6NH 2ED9A 2ZXGA 5HSFA 4UB0H 3IDIB 5D1XD 3WL9A 2B1OA 5CBEB 3KCYA 1YY8A 3BPLB 3WJMB 1AVMA 2NN4A 1ZT7A 4JRYD 2DMHA 2N7AA 3JQOB 3KD4A 1OT2A 2BHYA 1SM3L 1HIMH 1EGJH 2X9WA 3WNIA 1N2RB 1QSFD 4ZMNA 2X9XA 4TSBH 3GTTA 3QEQB 4LHQB 3NFNB 3U0PB 3GDBA 4JI7B 2WQRA 3P4OA 4GLRH 5GRWA 3L72H 5HI3D 5LXTB 1O6TA 4LPYA 5CU9A 5I75B 1RHHA 3B2VL 3TEZA 1X5FA 4NHUA 2CMRH 4PV1C 3WXVH 3U1PA 1MJ8H 5C0ND 1CGSH 1PLCA 4O2AB 5T1KB 4JFDA 4TQIA 4YSPA 4Z5RB 4BV1A 1A1NB 3IGUA 1VFUA 1I8MA 3A0RA 3CFMA 2DWEA 2YAEA 2CLRA 4FK5C 4LKXA 3WGVB 4OIIH 5IJCC 3ULUD 2QV2A 5AW5B 1TFHA 5GGVY 3D2UD 4NKDA 4Y4HB 3ZKSD 1EZSA 5JDSB 2X5PA 4JHWH 1G6VK 4ZXBB 3QFJB 4PV9B 4PJFA 2AQ3A 1S7RB 4PCYA 4LVOB 3WIFB 1JPGB 5ID1B 1OK8A 5DQDH 1CU4L 2F93B 2Q10A 1MFEL 2EILB 2O6DA 1XF2B 4YZFE 4FL4C 2ESVA 3DX7A 1WZ1H 1OTSD 3U1SH 4MS6A 1GN4A 3QHFL 1MIEL 3T0EE 1EA9C 3FU7B 3HZYB 3EO0A 2XPGB 5A2AA 3PPEA 4H7VA 1IXBA 2R9HC 1HHGA 2YJLA 3CK0H 4ZAKA 4PA4A 3W7WA 1BD2A 2P80D 2DN7A 3K2KA 2A3QA 1TCRB 3BZDA 3C60D 3JWDL 5E8OA 1F90L 4CNIA 3BVTA 5FM8A 4X5WA 1LNUA 1OE1A 3TBVB 2W0FC 5CO1A 4DGIH 4X99B 1H2NA 1INDH 2IC2A 4AQYO 4QY8A 3STBA 4AV4A 3T6VA 2E46A 3U2IA 2FYYA 2GUOB 2O5XH 4X9HA 5KVDE 4ELDA 4PSPA 5B1AB 3F2LA 4GG6F 2GHZA 1AI5A 3BE1H 2D0FA 4PJFF 4TOIA 1MFDH 5IOPB 2JKSA 2NXYC 4GXUM 5T1LA 1L0QA 3WNMA 3F83A 1GM7A 4MSWA 3N1PC 3ERXA 4JZNA 1YCSA 5IWAB 3H7BA 3G6DL 3MKGA 2VZ1A 1DVXA 2OSLB 3ROOB 1DVZA 3SGJC 4BZYA 4X9BA 1JAEA 3ZOAA 5HHPA 5CKGA 4CH6A 1DVFA 4PJAB 4P46D 4NERA 5D1QD 4FKEA 5EEXA 5HYQB 4PUBL 4CH5A 2KT6A 3KCWA 5AAMA 1TZHA 3I3EA 1FSKB 1RZKH 1RULH 4ILDA 4QRTB 4F7EB 1HILB 3MTXA 1FO0A 4K23L 5IWLC 3AAZA 3GF8A 4RQQB 4IRSA 3ABKB 1IAOA 2VUKA 1IX2A 2ZT9C 3AREC 4NFBA 5CCJA 1D5NA 5C3LD 1YITV 1EEUA 1S72V 3RPBA 5H4ZA 1H6TA 1XGTB 3B2UC 1EERB 4KQ0A 4ZI7A 1U21A 5LBVA 3KPNA 2VLLA 4NJAL 2W5PA 2ZXQA 4Z7NF 3FYIB 2CBOA 4D8PB 5J1SC 1QI3A 3MACH 2QGNA 2CJTA 3O41B 5T3ZE 5I5MA 1JGDB 2PPDA 2XZQL 2VDKL 5F2FA 4AC2A 4ZW5A 4HD9A 1FH5L 4QRSB 1ANUA 2DTML 4AQ1C 1IGJB 1J5CA 2UVEA 4XNYH 4YY3B 1TQUA 4KVCH 5DR5H 1YEGL 4M1GH 3G5XA 2VERA 5J9PA 4QJ5B 4HC1A 3VGFA 4N28A 3ETDA 1SDDB 1T5XB 2G30A 4J1UA 3APOA 4A2LA 3GSRA 1RZPA 5EBLC 1YYMH 3IS1X 3QXAA 1IXMA 1CS6A 3TTSA 4IBLT 2H9GB 2O5NA 2NY6B 5TH2A 3VXNB 5FO9A 4ZPVA 3WD5L 3H53A 4MCYB 5IYDO 4QE9A 3VQXA 4G7QB 4AJ0A 1ES0A 3PE9A 3HPLC 2NY0D 4MMZC 3A8TA 4GRLD 1YJDH 3QRLA 4MA3B 4X6CF 3FKSG 1CL7L 1J9SA 3RFZA 3TWCH 1MCNA 2PO6A 1RZKC 4WVRA 2J8UF 2A73A 4K73A 3A6BL 5CILH 1YCIA 1S9YA 1COWG 3RIFK 4AL8L 1JFFB 1LE9A 2WA4A 4HS8H 4WZ9A 4R8CA 1J0JA 5DZVA 5D96B 1JGUH 3SDDB 3MPCA 5D7IE 5BS0E 1QSFE 2K3TA 4JHZA 4DKDC 4R8WL 1K9TA 3J7AU 3HW7A 2UXTA 2QV4A 4R90H 3T2NL 3WNPA 4K71B 5H6RA 4PWEA 3PHOB 5T5FH 1CE1L 2G2NA 4G8FA 4MAYC 1QASA 4HUKB 2XQBL 1RUMH 5C07B 5D1XB 1XF1A 1YYLL 3VXUD 1OW0A 2D7QA 4NNPH 1IBKB 1AG6A 4PJ5D 4QF1A 2WANA 3DLQR 1P4RA 4X0KA 4X6CE 2PABA 5AVQB 2BC4A 2R2EA 2AABH 1IGYB 1J0YA 4UOQA 1NA8A 3SR2C 3FAXA 5DD0H 1A3RH 3TYFA 5FGCE 2YRPA 1F2XK 3D9AL 4AK2A 4MA8L 3N2GB 2OXGA 4MJ5A 2WUBH 3ULUL 2EDNA 3NSJA 4KU1A 3QUXB 1EJ8A 4Y1AE 3L3GA 3MJ8A 4HIJB 1UASA 4I77L 5D1ZB 4HQQH 2YI9A 5FUOH 4RBPK 3TH3T 1KGIA 4BH7B 5GHWL 4Z7UA 1CFQB 4M5SA 1H3UA 1A02N 4NXMO 4XMUA 3ZTCC 4KXZH 5C0AE 4DSYA 2Q8AH 1CBVH 2VXQA 4KH9A 3QYNA 4FQQA 1B4LA 2AEIT 5CZVH 1ENVA 1HILA 2N59A 4ABUA 1UXWB 5CN2A 4CILA 1A4BA 5BW7A 4JUSA 3UEZA 3U48A 5F44A 4N2DA 2I9LA 1XR9A 2W8CA 3A6CL 4YZWA 4PVLA 3W9EA 1BYOA 2NNCA 3DHPA 2H0PA 4HBNA 2P90A 1KYOJ 4E9QA 3DIVA 1WCQA 1XGZA 1QYGL 4BGLA 3OXRA 5FDYA 1I1YB 5L8KB 3QS3A 4UIKH 3G08B 1X5MA 5HI4C 4K7FA 4BZ2A 3EDJA 5JXED 1SOXA 3C2AH 2ODHA 4HCRL 4X7DC 4Y9GA 4GKJB 4XP9L 2PWEA 5LB1A 3QJVB 1JR9A 3KPLB 4IMKC 4IBUA 1AZVA 4Y8AA 5CNHA 2UXDO 2I32A 3NJJA 1QRKA 1R3JC 4OGAC 4QRRA 4IIQA 4O9HL 1BHAA 3RLSA 5KVFE 1IGFL 3B8NA 3QC5X 3SKMA 3NJHA 4YDNA 1ZOXA 1CFMA 2Z7ZA 3KWUA 3ZHTA 4XVUD 4RESB 2FGWL 2ZOKB 5CEZE 2Q4PA 3P3NA 2H6OA 4AQEB 1Z9NA 4HCGA 3H01A 1FO0B 1TAEA 1HKFA 4HLZG 2PO6D 4YSTA 2W88A 1G7JB 1YAZA 1M6OA 4WJKB 5FIEA 1Z9SA 3NH7H 4XMVA 3QIBD 1V7NH 4XVTH 1XFPA 1YDPB 3MUZ1 5KHIA 1YEEL 4M1CC 2CWRA 3BX7C 2A9ML 3Q48A 4JHBA 4TMPA 5EIVA 4DEPB 2WYIA 2EEXA 1JF1B 3MROA 4NQVB 1AGDA 3LKPB 4MD5B 4JFVA 4K4KA 4PJFB 1MLBA 4ODXA 1EEQA 4P4KA 5H2BA 5DZJA 3ZR5A 2R70A 3P3UA 1F58H 1Z6JT 4NN6B 4WSJA 4BW5A 3HUJF 4G6FD 4P49A 2N74A 5KVDH 3ZN1A 4J41A 2DQUH 1FHNA 3NJXA 4BD4A 3WTTA 4CGUB 1THAA 2O6FA 4YC2C 4NUJB 3W0WB 1J0HA 5B39B 2YPVL 2D03H 1ZTXE 1XGUB 3FT2A 2XPZA 5E8NB 3HS9A 4TULH 3RY6C 2H3OA 2WYTA 4NP4H 3WFHA 1AI4A 1EO7A 3CSGA 3ZCCA 1N3NA 4JG1H 1BBJA 3WNOA 2AITA 5KBMA 4NENA 2AJYL 3C60A 1KCLA 1A8JH 2GFBA 3V52L 3IJEA 2HG5C 1WD9A 1N59B 2DE0X 2FYUH 4KKLC 3MLVL 4D0CB 2DI9A 4HPYH 2Q2LA 4YUEH 5GW7A 5E4EC 3UOAB 4N20A 1SLVA 3WLBB 2CLZB 3VW3L 3U83A 4X7TB 5E00B 2LW7A 3FU6A 4XCNB 2LU5A 4ZBMA 3ZYIA 5BZDA 4ASUG 2I60L 1I7ZA 4DYLA 3HAEH 5LNEA 1OP4A 3K0WA 3RI5K 5K9JH 3Q06A 4N2NA 2XQYK 3ECUA 1FL3B 2WLNA 3NRFA 3PDOA 1S9WA 2ZF8A 1MXGA 2VR4A 3TCTA 3CPLB 2Z92A 4P2OC 2X4SA 2Z91B 1YSCA 4K3DL 4DGVH 4PAZA 3FU7A 2CK0L 2JJ1G 1M7IA 4P05A 5J6GA 4IRJA 4K8RH 3UZQB 5SWSE 5BO1H 1QUNB 2YPLA 3LDEA 3AU0A 4HWBA 2HWZH 4FLZA 2HCZX 1CUOA 2WVTA 2IOIA 2A6KA 3U1SL 1RZ8B 4E5XB 2HJDA 2HSIA 4J3WA 2X0VA 3L6FB 1LJMA 3D36C 1QNZH 1UWGL 4JFEA 3AT8A 4ZFZB 3CSYB 4JI0B 3CCEV 1Y66A 3C5JA 3PJSB 4MA7H 4OSUL 5FKAA 1QRNE 1FVEB 1BFVH 2CCVA 2DQEL 1KC8W 1B0RA 2BCMA 2X4OA 4LDLB 2UUAB 2LO1A 1FN4B 4MAUH 2Z8RA 4KRPB 4HKZA 1IM3A 3OHMB 2VSDA 5KMGB 2OA9A 4PW9A 4PWFA 4Z7WA 5CLWA 3HVNA 4JGSA 4P99A 4PJ6A 4IKLA 4YO0A 1A2YA 3JWOL 5PAZA 3W0WE 2AJVH 3GJFK 2P43B 3QIUD 2FBJH 2VDRL 1A6VL 3ZYOA 1AQHA 1RAMA 3VSTA 1AJNA 4BJLA 2CXKA 2FE0A 4X0NA 4R6ZA 5L9DH 1DLHA 5D7LA 5GRVK 3ALPA 2JTDA 3L9EA 4MMYA 4UM9D 3HRZC 3R66A 3V8CA 2F7OA 3V4VA 3OMAB 2OIGA 5I1LB 4L8BA 1AZZC 1DN0B 1M05A 3QPXH 4P5RA 3STLC 2DM3A 2IEPA 3T4DA 1IBDA 3LEVH 1I1YA 5HFLA 5TH2B 3V6OE 3QDJA 3VXNA 1TTRA 5BRZA 1PZCA 5E0QA 4MCYA 1NCJA 2CH8A 4H25B 5ABDE 3ETSA 3GSVA 4Z7VE 2IANE 2YLKA 2JXMA 2KUTA 1NCAH 2I07A 2YIHA 4EFBA 2DJSA 4GLRI 1YEGH 3AS2A 1U8PB 7FABL 1G7LB 1NOAA 1ZSHA 3T6QC 1NGPL 4MLSA 1SHWA 4Z7WF 1GRJA 3O4OB 2Y22A 2CO3A 3DX8A 4F92B 2UUBO 3IDJA 2HHHB 3QXTA 4XP6H 1YPZF 1JFFA 3DUUB 1LE9B 3P0VH 4JFOB 3S35X 2JCCB 2BSRB 4BK4A 3RYFA 2FZ3A 3CFQA 4WWKA 5J57B 3B09A 1HNXO 1F6FB 5DD6A 2XN9D 5JW5A 1VKXB 4GLXA 1LWRA 4H0HB 2Z4TA 5DC9B 4JI4O 5I8EA 3GSQB 2X1PA 1VQ8V 3W56A 4WJG3 3WU1A 3GTVA 3DI3B 4XMPL 4AEIH 1LO0H 2NNXA 2Y36H 3L5WA 3L5XL 1IT9L 3VQMA 4W9HC 3EXLA 1UA7A 3FH7A 5L3BA 3GI9H 2ZX7A 3ZZLA 4NQDA 4PJGB 5E51A 4LOVA 2LGQA 1L5GA 4N5ED 5FO9B 5F9OH 1XMWA 3K06A 5DS1A 1GC1H 4HKJB 4I1RA 1AOHA 4YSCA 4GQZA 4UNVA 1SMDA 1A7QH 2L7EA 2JIXA 2ZCKH 3ASNB 1KACB 4KKRA 1FCGA 2F53E 4POUB 3RY4A 4AQAA 2IADB 4XP4L 1OCCC 5B1KA 2EE9A 4K0KB 2ZUXA 1WZKA 2DY2A 3NDZE 3PWPA 4I2XB 3OKMA 5KVEE 4PG2A 1Q90A 3EBIA 4ICWA 5DD5L 4V1DD 5B39A 1AQ8A 1S7WB 1BJ1J 1TVBB 3IPBA 4KY1H 5GGRA 5C0RL 1V54C 2ZWZA 1SHXA 2J55A 2OMVA 1EDQA 3QUZB 5J11B 5DJXA 1AR4A 1EEYA 3JYBA 5IB1A 1CXIA 4OJYA 3MHHC 3HKBB 1HL8A 3H9SD 3WS3B 1W8OA 1P9MC 3RWFA 3ARBC 2FWSA 4DPRA 1ZT4A 1BF8A 4YH6A 5CD5C 1HEZB 2BSSA 3KM2A 5IMMA 5I6OA 2X1QA 3ZDZF 2C5DC 4U3SB 3CPWU 5A6LA 1NMBH 5EBGA 1XB3A 1KCVL 4AM0Q 1E6OH 4LVHC 2APSA 1RIHL 1HDJA 2XT9A 3MLTA 4WV1B 4QXVA 4RLDA 1U3NA 3TYGH 2QVTA 4LHUD 1UKSA 3Q5OA 4N2CA 1ZVNA 4BHUA 2G3MA 3W82A 4MSWC 5H6QA 1NT2B 1KJ2L 3F6IA 2GTWA 2B1HL 4YE4H 5DUJA 3TYFB 4YFEA 3ZHFA 1KPVB 4KHTH 5E6RB 2JK5C 3FZUD 1BZ7B 1FYTB 3FB8A 3L95A 4X6BB 3BW9B 2HUHA 4LMQI 1T0PB 1JCKA 3GSUB 3MNZB 4YHZH 1O7DC 4RDBA 1GMGA 4XN8A 4I4TB 3CV5A 1VPOH 1A4JB 4OBRA 3T4ZA 1G1OA 3DJTA 2BWDA 1JGVL 3FQ2A 3W57A 1MLCB 4OFKA 2DM7A 1VFBA 1URLA 4DUXA 5FA4B 4W4OC 2BSED 1WWCA 3BPOB 5LNGA 1CPYA 3F5WC 3T71A 2J71A 4M1DH 4XPTH 5D5ME 2XN2A 1ZEAH 2VLKB 1A3LL 3ILQC 1JJ2U 5I16A 1LP9B 3JALB 5D4IA 1Q4NX 1UM5L 2R39A 3NEEA 2DEXX 1KV3A 1N36B 3H9HB 3KVPA 3O9WC 5ITZB 4GSXA 4ZS6D 2X9YA 3RKPA 4M9OA 2YD7A 4YE4L 3S37X 1NINA 3MTRA 3VFMB 1JZ7A 5L2KA 4OZFG 1FO0H 4N2MA 3VMPA 4BSJA 3Q2WA 4DP6X 2FJGB 3QNFA 3O3EA 3V5KA 1Y74A 1H8HG 1VFOA 4ABQA 1T0NA 3B4SA 1F1AA 3OTTA 3CFDB 3ESMA 3Q6GL 3S4SB 5KSBB 1OLLA 2WQSA 2GCYB 3HE7C 1SM3H 3QPQD 2Y1VA 1QSEA 2JQMA 4P2RA 1M3JA 2DIBA 2XWJB 2V6HA 4LNUB 3MRBB 2CGYA 2GQHA 1BQ5A 5D93C 5JNYB 1IFRA 3GT6A 3RNQA 3GSNA 2Z0UA 3FO9B 2XV0A 4AG4H 4E68A 5TPWL 4XODA 4KNSA 3KW8A 1SJHA 2MKWA 3GEWB 3MRGA 5DJ8A 5EU5A 3VFGL 5KVMC 3GBNL 3TGXA 4GX0A 4G3YL 5BRZB 5INCB 2C9VA 4PV9A 4A2FA 4D3CL 3DTUB 1NH2B 4OZIE 3R7QA 3ICXA 4X88A 4R9HA 1NSNL 3OR6C 4YIQA 3CCUV 4F2EA 3SEPA 1A6AB 1ZA3B 5BPPA 1SQFA 3FUHA 4FFZL 1LM8V 4QPEA 1JNNH 3S3CB 4AZ8A 3P0GB 4K2UH 4JK0D 3MV7E 4PI2A 3UTSD 4Q9QH 1HZHH 4KX7A 4NKOA 3RTLA 1HP8A 3FCTA 3LKSB 4TNEA 4MMXA 2CPCA 5AW0B 4YWGL 4NXNB 3V5HA 3B7YA 1NKGA 3H54A 1UB5A 4GKOA 5IB1B 4JG1L 4EDXB 4EUPG 1U8MA 4HHWA 3HLAB 1PYWA 4HJTA 3UO8B 3PDOB 3ARTA 4H1LH 3L5HA 1LO5B 2N3JA 5D4QA 4QHNA 4G1EB 4O5LH 2Q8BH 1H2LA 1RK7A 1BG1A 1QBZA 4Y5XC 2CBMA 2HVJA 3RI5F 2BFVH 4EE2A 5CEXA 2OI9B 5CZVL 2QL1A 4GKNA 2ENPA 2OTLV 3QZOA 4PTUB 3QEHA 4TV3A 1B9ZA 4ENED 1Y7VA 2Q67A 1UZ6E 2K9FB 4EO5A 2JH2A 3GIZL 3MRKB 3C60B 2ZZUT 2Y5EA 4H8WH 5HJ3B 3TVMD 2XIIA 4D0CA 4DEWA 4FQCH 5D8JL 5CB4B 4YHPB 2H6UA 4CVXA 4CN1A 5K1VA 2WIMA 3VWKD 4AEHL 2D73A 4XX1G 3IS0X 2OL3B 3DUHA 4BZ2H 1S9KC 1G7PB 4X6BA 1BFOB 2AK4A 1ZLVK 3SKJH 4O2BA 1B4TA 1SVBA 4PRHD 4F33B 2N01B 3EO1A 2IJHA 5DN6G 3VG9C 4UCRA 8FABA 5MP6L 3C6SB 4N3UA 3B9EA 2WY3B 4HUWB 4BRJA 4I0PD 3ARGC 3GKWH 4DV4O 2D3VA 1FFTB 5CD5D 1MHEA 1MLCA 3LSOB 4MZ3A 3M17A 4DR2B 3G5ZB 2LABA 3H7LA 2YS4A 2E9JA 1QSVA 2IAMC 2YMOA 4RAUB 2V5MA 4DW2H 3VRIB 2EIEA 3MODH 2BP0B 5E1QA 2BW5A 4XCFH 4L87A 1IEAA 2V3FA 4Z3EA 2XX1A 4PWKA 1OJHA 4MTXA 5JCOA 1CYWA 2RJMA 4ZFGH 1ZANL 2Z31A 5HI4D 5JQIB 1T7VA 5JXEC 1RULL 3B1UA 5IQ9A 1TVDA 3KWXA 5F1SA 2PW1B 4F6RB 4NO0B 3VX1A 4JZOA 3K72A 3SB3A 1L9NA 1T21A 5F88A 4MKMA 3TCUA 1K73W 3NSXA 4UFZA 4V2CB 1GZQB 1Q0XH 1GW0A 4NIKB 3DUSB 2DWXA 2Q7AA 4PWIA 1D2DA 1E2ZA 2BVPA 3CZLA 1BZQK 2XWXA 3T1FA 4FXGB 1AGCB 1SGKA 4GIOA 3LHPH 4OSUH 1LK2B 2L6LA 1U92A 1K8AW 4R26H 1JX9A 5LVEA 1ASPA 4WHYH 5JNYA 5KEZA 3CC4V 2UXBO 2X42A 5L3EA 4HFWA 2BRQA 2QVMA 3QEUB 5FO2A 5DJ8B 1C5CL 3S34H 4LEXL 2HMID 2G75B 2VH5L 3K6FA 1XR8A 3L2NA 2R8SL 1YEKL 3JV6A 3H6AA 2J1KA 3E35A 1MJUL 1RMFL 2EDWA 3W2DH 3QXWA 1LEKA 4EF3A 4HEPG 1NBMG 1WCBB 2AQPA 3FSWA 3HAEB 5D5MA 3D85B 3WXWL 4BDVA 1S5JA 4J10A 1I1CA 3CFEB 1WB8A 3N41F 3QQNA 4MJ4A 2WQAA 3DRTB 2E0PA 2X12A 2JVUA 4UB8Z 2R0KH 1G7IB 4G2AA 4QTIH 4XNXH 1KCSH 4IOFC 2BO0A 5EOCJ 2NX5D 3LKSA 3QBTB 3TONA 5B66Z 2ADIA 2CDEB 1PD6A 4QWWC 3RURA 3TA4D 4CVZB 5IVZA 2YZ8A 3F64A 3RVYA 2WHVA 3HLAA 4N2AA 4JI6O 5CLTA 3NTCH 3MCYA 1C08B 1P5UC 2EDBA 2QQKL 2XDHA 2MW2B 1AZNA 3LN4A 5CJQL 3BH8B 4M29A 5TK4A 3JWNH 4P23B 5L2JA 4AH2B 3D34A 3VXUE 4ZFFB 2AVGA 1FNEA 1R3KA 5D2NB 4I13B 4GUCA 1OGTB 1SJHB 3MRGB 5EU5B 2JI3A 3GZPA 2IBZY 3KWVA 5DS8B 3UDWC 5IT9N 3OG4B 5DYFA 1IUZA 4HNAB 1I8MB 4GBXB 1KJ3L 4JPQA 3DXRB 2R2EB 3ARED 5EZJB 4N0CD 3H3PH 3JATA 2HVKC 4L8JA 1S8DB 2ZKHL 3F12A 4BK5A 3PGDB 2GDSA 1ZWIA 2PYJA 1KTJA 3IEAA 3VXUA 3MLTB 4NJAH 4WV1A 3ZMUA 3X2QB 2GEEA 2HG0A 3FZUC 1AR1B 4W6YB 2J43A 1SYSB 1NICA 1FNGB 1Q6IA 2JJ2G 2Y69C 3OF6D 1Q5OA 4UDTB 4UOJA 3IJYB 1CFQA 4JFQA 4TUYB 1QCEA 1OAUL 4GKZA 1SVZA 1WPXA 4Q6IC 3D18B 1KB9K 1CFSB 5HHOD 4D2NA 1P4BH 1AZRA 2FJHB 5CJOH 5GGRY 1IKFH 3P3RA 2V5RA 3JD1A 4ZOEA 3ZL2A 1OAJA 3BSHA 3GXPA 4FRWA 4WK4B 3HVDA 3DROA 3ZO0A 1D9KB 4JFYA 5D2LF 5MP6H 5ACLA 5J3HC 3I85A 6CGTA 4FULA 2B9ZA 3ZMTA 3QEQE 4ODHL 1R3LC 3QUHA 4UTAH 2ZCEA 3EGSA 4D7SA 3FT4B 5LHIA 4K3JH 2FWOB 4IHJA 1JWSA 5C08A 2EO7A 2C1OA 2J5LB 5L88L 3EJUA 3SODB 2FWUA 4EFEA 2QTVA 4RCAA 3PWUA 5KSAB 1CVSC 2D9QB 3PGFH 4OGXH 4KJYB 3MBEB 4GS7B 2VSCA 4XCFL 1O9ZA 2C1PB 2J20A 2JKTM 3AY2A 3RB7A 3RWJA 1FL6A 1JHLH 1PAMA 4OCXL 2O26U 3HKFA 5DEZA 4P5MB 3UZEC 3RWGA 1PF3A 3IYLW 4PVBA 2AJSH 4LSVL 1F4XH 1YRKA 4K8ZA 1CG9A 4N23A 1JGUL 5CJ8A 2IU3A 1SXSA 2R27A 3HB3C 4OCSL 5ILTH 4U1NA 4F8PA 2ZCZA 1DANU 1K4DA 3F5WA 3TCLA 1XCTA 5GZNC 4O2FB 2ZWKA 2ZDIC 5IFHH 1E7UA 3KKYA 3P69A 4N5EC 1TUBA 1BQUA 1X6NA 3H1LH 2R9IA 1UKQA 1RK1B 3OLEA 3KG5A 4GXVL 4P2RD 4UQIM 5AOKA 5PCYA 2A9HA 3BQUC 1NEZG 2B77A 3K8MA 2NSQA 1ZHKB 2O5ZL 4LRIC 5F7MC 5IK3A 1VGKA 2FQFA 3IFLL 3ARRA 4W9KC 5EUOE 3UG3A 4MXQC 2LGNA 2OW6A 1JPXA 3B9KD 3SDCB 4A7QA 1NDTA 1P7BA 3ETQA 2WINA 5A2IH 1W9XA 2J1WA 2ADPA 2DMKA 2R1YA 3QJTB 5KA6A 5DK2B 2ADYA 2YXFA 1E4JA 3PWNB 1FAFA 3GUFA 2C9RA 3DUSA 3OC8A 4QXGH 5IHZA 4IIQB 2UZXA 3GSWB 5CWSB 4UT9A 3UH8A 2FX9H 2DWDA 2FL5B 2VLRE 3DPBB 2MEJB 2A2QT 1D5IL 3WB2A 3PY9A 3DURA 3BSGA 3MXVH 2QFRA 5C0JA 2LGWA 3HNSL 4WUUA 1CZ8L 5AVZB 1VF7A 3EG9A 1I82A 1P1VA 4GI6A 2X4TA 4P8QA 5EBWC 1YY9C 3O11B 1G7JA 1RHHB 2AW2A 1P7HL 1MQ8A 3NTCL 5A2LH 3THMH 2VL5B 2MPAH 2A9CA 5CZKA 2WW8A 4XPGL 4MYWB 4PS4H 1FG2B 4MVOA 3QC6X 5JHLH 4HH8A 4U7OA 4FFWD 4FD0A 4PTUA 4PJDE 3EOAA 2D7PA 2XASA 3L9DA 2COVD 4J3BA 4YBHA 2FSEA 1J10A 5E9NA 3ZE1F 2VM9A 3MUUA 3CBRA 3TU6A 2NR6D 5IBLD 4WF7A 4NKDB 4YS4A 1OANA 3BGFC 5TPWH 4JV5B 4O4IB 2UXDB 1SHSA 1Q86W 1VGEH 4CC4A 5L0QB 12E8H 3L74H 2WSDA 3MV8B 3N42F 1JRHL 5IF0A 1SA0A 2FGZA 1XHZA 1OTUD 1X5LA 5AKSA 1TVHB 3DGGB 3MMEA 5MEQB 3IMTA 5MENB 2X4PB 2WCGA 3FMGH 1QBML 3U4EB 3VGAB 5KW9L 2FCBA 2XQBH 3QG6B 3V2AR 3GIZH 1N8RW 5JHDD 4KQ3H 4LCYB 1UD8A 1CQYA 3V6OA 3AK3A 3O6ML 5EEVA 2WGNB 3I50H 1MAJA 5E6ID 2HVJB 4IJ3B 2J4WH 2C8NA 4N9OB 4P46B 3LQAC 2APXA 1ET5A 3QEHB 5TDPA 1A7QL 3JAMN 3OPZH 3SYAA 2R0KL 2OR9H 5C07E 4NQXB 4G6JH 1E9PB 2W0LA 4HU2A 4EZJA 2ETWA 4LBAA 1A2YB 1BGYH 4OLZH 3APCA 3FQTB 4PWGA 4CN4A 3OD3A 4OVVA 1JJOA 4DK1A 5C08D 2N56A 2AXFA 5IJ0B 4GH7B 3N2GA 2OXGB 3CCMV 4Z7OE 3TESA 1EO8H 1K4DB 2R69A 3S2CA 4N8VA 4AUYA 4LCWD 1L0NH 1NR7A 3CCVV 3BLKA 3CMEV 3B9KA 1RIVL 3BQUA 3Q3GA 4FEIA 1KTDB 4BFNA 3STLA 1BEYL 2J73A 3F7VB 3MOAL 5IDJA 3GS0A 2G3NA 2GV9A 4YOKA 5TE4H 4NT6B 3DRQA 5JXEA 1C12B 2EYRB 1OK0A 5LG1A 1ORSA 1R1CA 3HC3L 3HZVB 3UGEA 4UCFA 3L4VA 1NGPH 2AV1B 2ZG3A 5A16B 5GS0C 1H9DA 4ZFZA 5IQMA 3OR7B 1RIHH 3VD7A 1J05A 2DJ4A 5I8CB 2YUXA 4BE5A 2Y72A 1U4FA 2NYZA 3HMXL 4L3ED 3CAFA 3D8MA 3MUHL 3IMUA 4G83A 4PELA 1YN6A 3MAWA 2WLLA 3TCXA 4F2FA 3VWKA 3ZMVA 2ZXDA 2PWFA 1NWPA 5KYWB 4P9HH 2ZE5A 3NJFA 1HI6A 4J6RL 5E8EB 1FORL 3OJDA 4LL9A 1E28B 2K3HA 5I1IL 4PS4L 3BEVB 4KKCD 1HNWO 2ESVD 4WUUB 1NCNA 2X0LA 4X8XA 1NFIA 1JPTL 2ZYHA 4Z7NE 2H1XA 3OQRA 4PJHA 4TSBL 4E2LA 2VZSA 3WO4B 1XEDA 4J3OF 1E9QA 1MCCA 3BH8A 2DQMA 3GPEA 5L7XL 2RAMA 3CZGA 2CRIA 3QEUA 4M7LT 5JA9A 1VADB 1HQRB 2FSEB 1CBJA 5T33L 4Y2OB 2X3CA 2ITDA 4U0RB 2DYSC 5IB5B 4P3DA 3UO1H 4BDVB 3PWNA 1FG9C 3GI9L 5DJYB 3MQIA 3DRTA 4LCCC 4OZGE 1NC2D 1UWXH 3BD3A 1Y18A 2DYRB 1UWEH 3B9DA 3MN8A 4LAJH 2Z0AA 4CGTA 4ODXB 1VACB 1FV1A 1UKTA 5F9AC 1WTGT 2P42B 3PF2A 3JAWB 3BSZA 4GAGH 4PJIF 4QHMB 5DEGB 1ONQA 3RGVB 5FA3B 1WF5A 4AE0A 3D18A 1MREL 4PRID 1A6ZB 5EA0H 1P5VB 3RWDB 3FL7A 1JNHA 4JG9A 4PD4F 3LQAL 1KTRL 2DYPB 3NIDB 2JMRA 4FFVD 3MNDA 4XTRD 4W9LC 3QQ3B 5DUPL 5GISH 1GS7A 2LHAA 4ZOBA 5IYZB 1LILA 4N1HB 4X7SL 1UZ8A 1X7QA 4ZBJA 1S3JA 4YEFA 5I23A 4N6RB 5IW6B 1NCCL 4DKTA 4HMDA 3HBPA 4FFZH 1SQBH 1A47A 3FTUA 3DXRA 1WAAF 4JO3L 3S4SG 4JY4B 5CS7A 1Y6NR 3BABA 1DO6A 1WHOA 3K1DA 2DI8A 2MTPA 2KPNA 4I87A 4P04A 3MRRB 4HV8B 3LDCA 3TBYB 2CGNA 1DBML 3UQ8A 2YMXL 4LVOC 3Q8EA 5DJZA 1UA3A 4F1ZA 3HPJB 4K8RL 3PFQA 3MA7B 1CDUA 3UJTL 1E9OB 4F27A 3INUL 2YQBA 3HNTH 2FH8A 2P5WD 3PDGA 1YMME 1T4WA 4LASL 4DV2O 1L9SA 2HMIC 1NAMH 3BKML 1CGYA 1T4KB 3N6YA 3LDBB 5BRZE 5CSGA 5EULV 1RIVH 1T22A 3EH3B 1S7UA 5SWSB 1HL9A 3BUYB 3T0AA 4PJXF 5DHDA 4XX5A 4UZUA 4D7PA 3QI9A 3HS8A 3T6XA 4DIXA 5EU3B 5GS2D 3CP1A 2HWZL 1A7NH 4L9DA 3SJVB 5CKAA 2VKXA 1F8TH 2XA8H 1HHIA 5E7FA 2H8PB 5LA6B 3CIAA 1WB7A 1DN2A 4GKKO 4Y88A 5JHMA 4FA6A 3GK8L 3HCVA 3BAEL 2P22