3SPJA

Apo inward rectifier potassium channel kir2.2 i223l mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
330
structure length
321
Chain Sequence
b'NRFVKKNGQCNVEFTNMDMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 82
structure length 321
sequence length 330
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spjA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spjA01
4OXSA 1J95A 1R3JC 3GB7C 2E4FA 3LDEA 3SYPA 1JVMA 3K03A 1U4EA 2EIJC 1S5HC 1R3LC 2HVJC 1V55C 4RAIA 3SPGA 4QNHB 1K4DC 3OR7C 4H37A 4XDLA 3AT8A 4R6ZA 1ZWIC 2EIMC 2X6CA 1M57C 2IH3C 4JTDB 3K0DA 3OGCC 4MW3A 2A79B 4LBEC 4R8CA 1ORQC 3E8FA 4RO2A 3FB6C 3FB7C 2QKSA 3PJSK 3STLC 2WLKA 2WLLB 4MVRA 4R7CA 3F7VC 3BEHA 4PDLA 2ATKC 2KB1A 4PA7A 2Q6AA 2GIXA 3JYCA 5EC2C 4X88A 1XL6A 2ZXWC 3EFFK 5EBLC 2X6AA 4WFEA 1P7BA 4PA6A 4WFHA 2K1EA 2YEVA 3UM7A 4MVOA 5KUKA 2WLHA 3OR6C 2HVKC 3ABKC 2A9HA 3RVYA 1N9PA 4DXWA 3AGWA 3AG4C 4MVZA 4X89A 5CBFA 2OCCC 3ABMC 4MTGA 2BOCC 5BZBA 2ZD9A 4GX0A 4GX1A 4HYOA 3SYAA 2W0FC 2EIKC 2WLIB 5EBMC 3LNMB 1LNQA 2AHYA 2BOBC 4MS2A 1U4FA 3K06A 2HJFC 3AG1C 3LUTB 4R50A 3RBZA 3ZRSA 3E8GA 3FB8C 2WLJA 2Q69A 5CBGA 4WFGA 2ITDC 1K4CC 4ZBMA 3IFXA 2HG5C 3STZC 3RVZA 2ITCC 1V54C 4F4LA 3RW0A 3UKMA 2WLNA 2EINC 4XDKA 3SPCA 3T1CA 3K6NA 4P2ZA 3F5WC 2X6BA 4P9OA 4PDVA 3SPIA 3SYCA 3ATEA 5KUMA 3SYQA 1OCZC 4TWKA 3AT9A 3KG2A 5EK0A 2WLMA 4EKWA 3T4DA 3VOUA 3SPJA 4PA9A 2Q68A 3T2MA 4PA3A 2DWDC 5B3SC 3AG3C 4PA4A 3E83A 4RUFA 4JTAB 4J9ZB 1XL4A 3ATBA 2Y69C 3ATDA 3LDDA 1R3KC 3ABLC 3ATFA 4BW5A 3E8HA 3AUWB 4P30A 5EC1C 3TCUA 4XDJA 5B1BC 4CBCA 3K04A 4I9WA 4MVSA 3SPHA 4MTOA 4KFMA 2H8PC 2HFEC 2AHZA 2DYSC 3E89A 3R65A 4J9YB 4MVQA 3TETA 4P9PA 4LP8A 3SYOA 3ZJZA 4LCUC 2QTOA 3WG7C 2IH1C 3F7YC 3X2QC 4GX2A 2R9RB 4MVUA 4HZ3A 3T4ZA 3VSQA 2JK5C 1R3IC 1G4YB 4MVMA 3E86A 4QE7A 5E1AC 4MW8A 1BL8A 4WFFA 1KKDA 4GX5A 3E8BA 5EBWC 2WLIA 2DYRC 1QLEC 2P7TC 3SJQC 4PDMA 2EILC 1OCCC 1OCOC 3AG2C 2NLJC 4X8AA 3OUSA 5CBHA 4G27B 3ASNC 4G28B 2WLLA 4MTFA 2A0LA 4QE9A 4UUJC 3K08A 4PDRA 1M56C 2DWEC 1OCRC 3OUFA 5B1AC 4RUEA 4JTCB 5J9PC 3FB5C 4H33A 3ASOC 3ATAA 5IY5C 2Q67A 4MSWC 3LDCA 3IGAC 3K0GA 3HPLC
chains in the Genus database with same CATH superfamily
1SM3H 5JXEA 5KG9B 4JHZA 4PSRA 4XMTA 4RH4A 4P59L 1CQYA 4JO4H 4OPHA 3FQ1A 4R84A 3VFSB 3ZL4L 4NQCD 1T7WA 5B3JF 1TJHL 1TDQA 4GKLA 5E94A 3EZJB 4JTDB 3JV4B 3SDXB 1XF4A 3HHSA 1QR1A 1SNRA 3CU7A 1YN7B 3MCLH 1EFQA 4DZBB 5B3SB 2E9JA 3KLQA 2VC2L 3R8BB 3UJIH 4DR4O 2AP2A 1LM8V 1OSZA 3KPOA 4RQQA 5ISZE 1XF3A 5EIIA 4KV5F 4Z8FL 4D0DB 1WT5C 2ICEB 3IDMB 1H2KA 2Z9TA 4F80A 4QHLA 3WSQL 4A55A 5DJYA 4DH2A 3HFFA 3LEYL 3PP3K 1JHTB 1KBGH 3CMEV 1WA8A 1YJ9V 3B9DA 1O9WA 2OX5B 1TVHA 3KE0A 1NIEA 2FB5A 1IMHC 1Q0YL 1V7NH 2BVOA 5GRXG 3ABMC 1AO7D 4P2OB 4O58L 4F9LA 1CS6A 5J0BA 2YUVA 2WK2A 3SGKC 3GB7A 1EXUB 2IPUK 4PRHD 3TBSB 1DBML 4QRTA 4N9GB 2VZVA 4M7LL 1GM7A 4AVJA 1EGJL 1MFDL 5IHZA 2JKXA 2P7TB 4BQBA 3P2TA 5I75B 1LWJA 5F3HA 5H35A 1CFVH 1CE1L 4NUQA 1IGIL 3RQ3A 1E5AA 3M86A 3TO4D 4PJEF 3NTCL 3UYRH 2EJ7A 1UEMA 4OZ4A 3VXMA 1IEHA 2PYEA 4W9LC 4Y4HD 3BGMB 4OLXL 1H0DA 2VYRE 1VF5B 3SJVA 3WS3A 1AD0B 1OPGL 3CYOA 3OEEG 3D4YA 4K7PL 3CD4A 3HTLX 3MLYH 1XCQA 1NBYB 5DMIL 2ADIA 5IEHA 4CC4A 3G08A 3S34L 1R34A 4Z95L 5HDBF 3P77B 4KKNA 3W11D 3KPSB 1M9SA 4Q7DA 1F3DH 3OR7B 7PCYA 3JD1A 3OTTA 4QRRE 4UQAA 1P1ZB 4K71C 4ZDHA 4A66A 4LCYA 5JXEC 4Y1AA 4JYAB 2EE6A 4U3CA 1B4LA 4NQTA 4A68A 1OGAA 2JRIA 1WHOA 4LFAO 4AC4A 1M93A 2P3YA 2JK5C 3RGVA 1GY1A 1HYSD 2NNUA 2R4RH 1X4TA 1M7DA 3CH1B 4WTXA 4Q74A 2OMVA 3AK3A 5LXVA 1UA6H 3B77A 2TAAA 2OMUB 3S4SA 2F68X 5E8EB 1EDHA 2ZZUT 4FXKC 1W16A 2MHAA 4AW7A 3CFBB 4JG9A 3RAJH 1AQDB 4NNXB 4QR7A 2XG4B 4PDRA 3BKCL 1UWEH 5E2TH 5FCUL 4P5TC 3SJAC 4JRYA 1MJJA 2R27A 1PDKA 3U4KA 4QRFA 2KC0A 1U30A 4D7PA 5IFAH 5HFLA 2XA8L 2NY3B 3CCHA 3OXSB 5F7FA 3Q01A 2E6QA 3VWJB 3N5AA 4I89A 3GS4A 3MA7A 3QUMH 1AROP 3GB7C 4H0HB 4KK8C 2W9EL 3PDOB 3LSQA 1FVEB 1KTRL 2KPNA 4HV8B 3DRTB 1TMQA 2EEDA 3IBEA 4TSAL 5FYKL 1XBRA 1PD0A 3P3UA 5D1XB 3NSCA 4R5VA 1BBDL 2WUCL 2YAQA 3N43B 4JZGA 4UF7C 3ULVD 2ZX9A 3HNVL 4B9PA 2GT9B 4R5TA 5F6IC 1SESA 4AX3A 1WLHA 4FXLA 3VRJA 1TGOA 1SEQH 3DO7B 1AFVL 2IBZY 1T4KA 2K8MA 1T6WA 3JTTB 4JPIA 1NIBA 1WAEA 3EGXA 3OBAA 4X7TA 1ORQA 4OIIH 1XGRB 1CO1A 1JNLH 4AL8C 1Q1PA 3F7PC 4KVCL 4X65B 1H15B 1PLBA 4FIPC 1PM9A 5TE7H 4DPAX 1Z66A 3VFRB 1LO3L 2QM7A 1RUML 5EPMB 3V5HB 4NZ8A 1NCIA 6FABL 1BZ9A 3HE7D 2HZHA 2DM4A 4JM2C 3GBEA 2UUCB 1JDDA 1F3JB 1CBVH 3NQIA 4FJZA 4FA7B 3KZ8A 3NCJH 3BQVA 5CJBA 3T8XB 4XOAA 1G6RB 4GIOA 4NRXB 2XJLA 3O8XC 2CLZA 2ENPA 1QRND 3FX7A 4APXB 2BVPB 4OD2A 5CLXA 4DFHA 3KYKL 2ZT9B 4ZUVA 4ALAH 1IGCH 3RDTB 3M8OH 3GINA 3L3OB 4EB6A 4JFFB 4RSYA 2QPSA 4AMXA 1DJSA 2QWNB 1SXAA 4XRCA 1XGUB 5HJGA 4DGIH 3FU3A 5IV2B 4JYBA 3L3DB 4BDVA 4D8OA 1S7WB 3NIGE 5DHDA 5F7DB 3EH1A 1WWWX 2CHNA 1E79G 1Z9PA 3VVWA 1FZOB 2Z1KA 4EOWH 4BELD 4Q97A 3ATFA 1E9PA 2Q7NA 3AMLA 3X1EA 1P4IL 4UQ3A 4FFYH 3BPLB 5DVLA 4B9GA 3ILEA 5I1EH 2J8UA 1IBLB 4ZFOA 4HJGB 2J1ZA 4QXGL 3ZHFA 5H8DA 1KGIA 5GS3A 4NIYE 3RUGE 1DN0A 4YC2C 2YUZA 1UYWH 2DMHA 2FT6A 4DO6A 3APQA 1X5AA 1BBJA 1DSFL 1NT2B 4GYCB 2CGYA 2EYRB 5BRZD 2X3CA 5EO9A 4AI8A 3UYPB 2R0KL 4WTZG 5G5DB 4XP4H 4PJFA 4V1DA 2HAZA 5MEQB 3AG2C 2IPKA 1GH6A 4GMSL 1ET8A 4AIZA 5HGHA 2CHZA 1U3HA 3BAEH 3FU5A 4LNUA 1LEKB 2ZAHA 1ZHNB 1UADC 4S1DD 5DDHB 1IBGH 4WFHD 5AL0A 5I66A 2HUHA 2DMCA 4Q20A 2ENSA 4PJ7B 5IFHL 4M7LT 1UD6A 3FUNA 2VLME 4M5SA 2FIRT 1OE2A 2H1LM 3QIBA 4O2FA 1CLZL 1G1XB 4G7YH 3SCMC 3AK2A 4LEEA 2ICWB 1JZ6A 4E9QA 3A47A 2IIJA 5EORH 5FNVA 3DMMB 3A0HZ 4DKTA 1A1MB 5CUSH 4Y89A 2ZUXA 4DR6O 3LNIA 4UTBH 4HIEB 4U4IA 3U4BL 2BY0A 5JHAA 2R4SH 5DZJA 4C59B 3DX6A 4RBPH 2B9AA 3LN9A 1MHEA 4Z7VF 3MLUH 1QFHA 3D18B 2VUKA 3NZHL 4BFEA 3I9PA 4HQQL 4E36A 3CDYA 2CDYA 4QWWC 4X99B 3FUEA 3L9DA 4U6YB 3ZPDA 2XICA 2ZPKH 4I18C 1AHMA 5D8JL 3BUQA 3KLKA 5DXWA 3DK2A 2Y06L 3VFVB 3POHA 1CTOA 4NQQA 4LVOB 1WVZA 2ESVE 1QO3B 2V9UA 1TZ8A 5BO1H 1FNSL 4ELDA 1T5WA 3A22A 1G7HA 4ABUA 5IBTL 3D05A 1BM3L 1FN4B 3E3QE 1TEFA 1U3YA 3GMPB 4W4KA 5EF2A 1LO0H 4U7KA 3V5KB 2RFXA 1AYRA 2OCJA 3Q05A 3RWIB 2VSKB 1E28B 1JJOA 4IKJA 1E9QB 5FUCE 5GHWL 2UWEB 4AZUA 3BWUF 1FXHA 3B9KB 2H32A 4CH5A 3Q5OA 3T6ZA 1D5RA 3ZRVA 4GG6F 3IU3B 5EYPA 1B4JL 1OY3B 4NQSB 4X5PA 1SF5A 3U0PA 4LVNC 2VN5A 3VB8A 3HIZA 1UXSB 4I7ZB 5ANMA 2E7CA 2V4DA 1F45A 3MLTB 1L5GA 1YPZB 3WFZA 3CSFA 1KB5A 5F96H 5F7UA 3JUYA 3RL2B 3ABKB 2CCVA 2VE6B 1CD0A 3S96A 1XO8A 4WGKA 4DQOH 5IB3B 1JA8A 3S3SA 3GMNB 4X7SH 3PWNB 3JWNH 3ZIAG 3B6SB 5HHPB 2BJML 3F84A 3QIBC 4MVQA 1ZRUA 2GK2A 3OEHG 3LKSA 1I1AA 1OD9A 3TXSA 1G7PB 2VQEB 3NABL 4D0BA 3O4LB 2G9HA 1PJWA 3G6DL 4X6FB 2Z8VC 3ZTNL 4RMUA 2AAAA 2JJVA 4NQDD 3MRBA 1JPGB 5DT1L 5D2LE 1RZ7L 2VXQH 4GRLC 4EEQA 3D9AH 5CXPA 3MUJA 3SDAC 5D5PA 1UWXK 3N04A 4IOFD 4H44B 1DBKH 1M6OB 1MW2A 3E6HA 5KSAB 1BG1A 1MEXH 4XPGH 2FBOJ 2SODB 4X8GA 1MAKA 4Z7UE 4Z7VB 3WNPA 3KWWA 1EAOA 4Q4EA 2OFQA 2ZR2A 2F9BT 1OCRC 5DQDL 5C0NC 5CCKH 5INDB 3CBKB 1EEZA 1XSIA 1U21A 3SJCC 1K9MW 3S88H 1IC4L 3K0GA 4GXVH 2BNRE 5CEZE 2BWDA 4PGDB 5IBUB 1KGXA 3ZDXB 3K91A 4OSUL 4OB5L 4TLUA 4G6KL 4PW4A 2ZYRA 1U8OB 3VDCA 4ZX4A 2VIRB 4H4NA 4R8CA 2YAFA 4MW3A 3E1F1 1IGMH 2J6WA 4LHQB 5A6IA 5JCOA 4YJ2B 3C3TA 1JZDC 5C09D 2FUQA 4ZOLB 3JAWB 3CXHJ 1F4YL 2ARJQ 4DUZO 2GBOA 4MQ7A 4QIRA 2Z5UA 4IRZH 1RPQA 4F6RB 1HKLL 2EJ1A 4W9CC 2Z93A 1JWSA 4OUOA 1OARH 5MEPB 1JOYA 1YEGH 4X8XA 5TK2A 5JLZB 1EHLH 5KTEL 2XVGA 5CEZH 1ZTEA 4GBXD 4L3ED 4J3OD 2IPTH 2N56A 1QFWI 1R5WA 1A7BA 2JCCB 4HPYH 1QBZA 1BZKA 5HHXH 3K5RA 4KO5A 2V9QA 3AB0B 3QDJB 4XO9A 3SGEI 2D73A 3S8FB 2FX8L 3C8DA 4Y5XA 5EFIA 4A37A 3CFTA 5EU5B 3FO1B 4IHOA 2J1KA 1MFBL 4NI6A 4AV5A 2NXZB 1DQDL 1X9RA 4BFIB 4N2KA 4U49A 1IBYA 4R97C 2WAMA 1XH3A 1HSAB 2B14A 4PDVA 1KG0B 2YZ1A 4WF9V 5BV7L 4H0LB 4GAYA 1A9EB 4L48A 5IJ9B 2W94A 4ZXBB 2X88A 4I50B 2FK9A 3EYVA 3C75A 3QEQE 4UV4L 1LWRA 1BF2A 2FX7L 4AEHL 1SQXH 1F8TH 3O11A 2YAOA 4GAJH 2ZNXA 3H9VA 4NSKB 3VFUB 1YNLL 1K9TA 1YNKH 1BQZA 1FHNA 5B1BC 5FL7G 4LF9B 2AANA 2V7NB 1JF1B 1HT6A 3BDBA 3FOLA 3U1PA 2RHEA 4OD1H 4DKEL 2EUWA 2IFGA 4Z7WE 1KIQA 3G04A 2HFGL 3QW9A 5C0CE 1W6WA 2X3BA 4P46A 5FKPB 3F12B 1ZGLB 5F9OH 5F9WC 3B43A 4GRWE 1U36A 4Q6IB 5I6LA 3OKLA 3JV6A 5F1IA 1OCZB 3PGFL 3LEVL 4KHTH 3C60A 5DFTA 3E0GA 3GSUB 1JOIA 2X5PA 1ZJAA 2YZ8A 4PS3A 5HI4D 5IOKA 4XMPL 3F62A 3QZWA 2WO4A 1VGKA 5JNYB 4XGZA 4U2ZA 5JMRA 1GZPA 1AO7A 5HGBA 2NY0C 4JFTA 5LGHL 4NO5B 3JBG7 4ZUUB 2WLLA 2CUHA 2FLMA 3PWUB 3T2NL 3ZMEA 1KIUA 2L4OA 5ESQA 2OL3L 1K5QA 5DRXB 2QQNH 2X4UA 5JUEH 1KJ2L 2NXYD 5L9DH 1DQJA 8CGTA 2VDRL 2JQAA 2CZNA 1UASA 1LNUA 3T0EB 1A4JA 3I6KA 3IF1B 1WN7A 1IGTA 4MD5A 4Y5XC 1B0RB 2XIDA 2EE9A 3WMQA 4WZ9A 4GRWH 1A7RL 4Y4HA 4UXNA 1WC7A 4WWPA 3EXLA 1J5OH 2NPLX 2IF7A 3FQWA 4YS4A 1RP8A 3FOMA 1BM7A 4OZGF 2WLKA 5FIEA 4P23B 5KBPA 4XZUB 4BQCA 4GI6A 1GZHC 3NVQA 1I7ZB 1OEZW 4FCHA 4LIQE 4ZQTA 1F4AA 2JEUA 2UU9O 1CLOH 2B15A 2FSEB 2G75A 2XZCH 1J8HD 3H3PL 4WKZB 5F0JB 3CCUV 1J11A 3QJHA 4JQXC 2E7DA 4QXWA 4U4BA 1A4CA 3MNWA 4FQHA 1P6WA 3ZYOA 1A14L 3AGWA 2J8OA 3GTVA 3QO7A 4JAMA 4A67A 1BIIA 2DQCH 5CBAB 1D6VL 3KXFE 4JN2A 1ZLWH 1KGWA 4LLDB 1D5AA 2GCYA 2E0PA 4AVHA 1BREA 5KVEE 3SGIA 2G3ZA 2HJFA 3S97C 4ELMA 2JELH 3DECA 1ODUA 4LIQH 2MCG1 2IU3A 1A3ZA 3NAAL 1X7SA 5I16A 4XNMB 4CUCA 5EIVA 3VFPA 4WFFD 3VGFA 4XXDA 5I1LA 3ISYA 1K5NA 2MK3A 5F0PB 1JZ4A 3EYUH 1MCJA 1I7FA 1IO4C 1BGXL 1MCPL 2CR6A 2V0AA 1U8JA 4LARH 2A83B 4AIOA 2YFNA 3C09C 3A21A 3HS9A 4RAVA 3BO8B 3FAVA 3JD0A 3LNNA 1S3KL 2APTA 1J10A 1T0NB 2Z7UA 1FSKB 4F7MB 1CZ8L 4HKBB 4I55B 4MVSA 5DFVD 1FI8C 5CJOH 2DYSC 2XTAA 2UUDK 2GUOB 1FG2B 1AAJA 3EBGA 2XZZA 1QUNA 3BVNA 3AACA 1QWNA 3GLZA 3TO4C 5KVEH 3QK0A 4UB8Z 3RP1A 1E42A 4P2QE 2FYVA 4J4PA 3HZKA 4Y4HC 1P7GA 1G9MH 4RWYL 1WPBA 2C4XA 3O2DL 1TQVA 3WXVH 2IGFL 5J1AB 1NEZB 4K3GA 4K3AA 1SY6L 3PUCA 3ZR5A 3ARED 3HE7A 4FMKA 3BJLA 4XMXA 4ABQA 3W11C 2HVKB 1H2SB 4LFCO 5HBBA 2P43B 3AC0A 1YMMD 4LEOB 1A9BA 1C12A 1GHFL 1CWVA 1QX1A 3KLDA 3Q6FA 2BOBB 2GFBA 3OL2A 3KPRD 2KQNA 3QFDA 3QPXL 4WFED 3TPUB 2YD1A 4NN5C 4YHIB 2IANE 3ARZA 3MV8A 4B9YA 2CGRH 3EJQA 1I8KB 4N2BA 4WSGA 4R4FL 5JR1H 5KAQF 3W56A 1JPSH 1HNWB 5E99L 1V7MH 2W9DH 3WJJA 3OAUL 5D71H 1HYSC 2LQRA 4R90L 3O65A 4B3MB 3E9TA 3O0RH 5ESVB 1DFBL 3H0TA 5L3EA 4S2SA 1RM1C 3V52L 3CHQA 2XUWA 4YSOA 1JZJA 1KZQA 4N0YH 3UTTD 1R3LA 4YHLL 1FVCA 3BZFB 1NFDA 5BJTA 1RJYB 4Y5VA 4NFDA 5DHVH 4FLVA 3L95A 5DFAA 3LSOB 1UA7A 2BWIA 3NFPA 4NRZB 2AJSH 2BCKA 1UH2A 2BFVH 1YJNV 2Z8RA 1CXIA 3B7TA 3FC8A 4MASA 3RYCB 5E24E 1XFPA 3HI6L 1N6QH 4JKPH 3DBXB 4N22A 4PU2A 4KHXH 3BEVB 4F7PA 5I16B 5JPNC 1RSOB 1XF5A 3ULVC 1CQKA 2UVFA 5D1ZD 1QZ1A 2JI3A 2JIXB 2WUBL 4DGVH 1MREL 4HX1B 4M6MH 2R2BB 4FFKA 4KI5F 3REVB 3N9GL 4ONFH 2FBJH 1E4XI 4J12A 4ODTL 4HUWB 5D9SB 4LPCA 2OJ1A 4R8WH 3U0TB 3KHOA 2XTSA 1FNLA 4UCVA 1WB7A 3HE7C 3FCTA 5BXZA 3ZZLA 1QSVA 5SWSD 1JNNH 3KDPB 3R1GH 1JZ5A 3LPWA 3KZIZ 2CUGA 3TV3L 4IIQC 2N1TE 1GOGA 2EVIA 1R5IB 1YJDC 3GMLB 3X3GL 1F23A 5ISZB 4Y1SA 4X9FA 3Q1SL 2W80C 2I9TB 2EH8L 4ZQKA 3VXOA 2A1WL 2EP6A 1KN4L 5A9GA 4YZWA 4G6FD 5JHBA 3QPKA 4QKTA 1TTCA 3LN4B 3UZEA 1JYVA 4A2HA 3N3EA 2Q10A 3W37A 1MRFH 3I9IA 4R26L 1FH2A 4JL2A 3T3ME 3UH8A 4XWGL 1IBKO 4GOSA 3L4ZA 4LCCA 4F58H 4GEIA 1FNGA 4NS0A 3NIFE 2BFGA 4M29A 2VR7A 1FLTX 2P5EE 1EFRG 3IRPX 3MI6A 1PG7W 4L5FE 5BMFH 5CBHA 4JO2L 1ZT7B 5EBWA 5JHLH 1ACZA 1DJYA 1MH5A 1NCCH 2ZXGA 5L3FA 2Q0AA 1NUDA 5J3HD 4MGXA 3MAWA 1BQ0A 4OCXH 1IAKA 5LJYH 3CE2A 3AFLA 1J8RA 2PP9A 5AB1A 4UINH 1UB6B 4N86A 4UFZA 3VWKB 1AQKL 2DKUA 5LA6A 3EGSA 4HPOH 3D0VB 2VR3A 1JGEB 3O6KH 2FEEI 3SDCB 1P4UA 1A64A 1U93A 1NCDH 4QHMA 4KC3B 5KYUA 5CP7B 5D5MA 1F1DA 3BDYH 4AC2A 5KBMA 1HH6A 2L35A 3I6LE 4I1RA 1UM6L 1SQPH 5GTHZ 1RZKH 3QBTB 4L5FH 4S1DC 3VFRA 4GI8A 1N33B 1L9SA 1LP9A 4H26A 1J9RA 3QUMB 5KS9A 4JI8O 2X7LA 3I50H 3LPOA 4I9QA 3WTUA 1D2OA 2ZUQC 2B2XL 5LQBL 2LV4A 1IFGA 5HHQA 1QEWA 2WMPA 3B8SA 4X80H 5F7WC 3SE9H 2DQTL 5GZND 4X89A 4WI6A 5CMUA 5GRVK 1EZLA 5EBMC 1PL0A 1TQCC 2ALWA 4C7UA 1NCGA 3NSDA 4J1UA 4X98A 3RJDA 3NJKA 3QORB 4ZUWB 3HKCB 4KZ0A 2Q0ZX 1ZSHA 3FD9A 3Q5YA 3C2AL 3V4LA 2Q0OC 1JPTL 3P3RA 1Z9LA 2KI6A 3P32A 3NFSL 5HYJE 3IDXL 3UMNA 2AJUL 3PAYA 4DP6X 4WFBV 1PAZA 1VFAA 5BS0D 5BUAA 5IE9A 4JG0L 3I74A 4TSBL 4CADB 5I9QB 1MFCL 5JPMA 1KP2A 3CZGA 4QGPA 2WGNB 1BXVA 4X64O 1KPVB 4N25A 4FS0A 4L37A 4YJ3B 1KGUA 4NVPA 1HWYA 5HVGB 3EYFB 2WNWA 3GO1L 2BP0A 4TF4A 1RZGA 5D7JD 2B1AH 2ID5A 3T1YB 4G1EA 4FQ1L 3EUUA 1JDAA 5I1GH 4NP4H 4JI3O 4QCIB 4RFNB 3MR9B 5HJ3B 3BISA 4F2FA 1EUUA 4N6RA 4Z0BH 3TWCH 3LDBC 3GKZA 3D07A 3WHXB 2ZE0A 3G5YA 4G9FE 1YSCA 4PJ8D 5DRNA 4WJ5B 1FL6A 3FYEB 3I5DA 1QFPA 2QEJA 4HS8H 1JVLA 2Y0IA 2EIEA 3GK8L 4IKKA 4PRAB 2XN2A 3KYAA 4ISVA 5GJSH 5LP6B 5IMLB 5IKCB 2VO8A 1CT8B 5KLVH 4IDLA 1P9MC 3UP6A 4FADA 4ENZA 5TE6L 2G2RA 3H7BB 4BFOA 3EFOA 2MNUA 5LAXB 3NACH 5I82A 2JJSC 1LO5B 1LXMA 4Y4KB 2YD4A 3G6EV 1DDHB 1CF1A 3MREB 1NGZA 3AZUA 3JWOH 1S8DA 1I8UA 3B2PA 3S3JA 5M7QA 3ME0A 3PV6B 1B04A 2ITCB 4JAAA 5E6ZA 1S5JA 2F54B 4ZHQA 4Y4FA 3QJQB 2WTPA 1TZOA 1MFNA 3X2QB 3NIGB 3B9EA 2XXFA 4IOFC 1E43A 4KXBA 3OAZH 3BKML 1J1PL 3QHFH 3WE1A 5I8CB 3LYRA 4MLIA 5JXAH 2F74A 1I7UB 3IJ9A 2ADFH 1A02N 1VKXB 2NY2C 3KWXA 4X5LA 3QI9A 4K4KA 1MXGA 4R2GB 2Q2EB 1SA0B 4J3XA 2XU9A 1ZLSH 4DP8X 1GKOA 5IUSA 2BC4B 2L3BA 3BOVA 5EC1B 3RUGB 5L0QB 3NJNA 2B7DT 1ZSDA 3IJYA 2GJJA 3KBEA 4OF7A 5E4AA 2ATKA 5K9KA 1AJPA 5DGRA 1DVQA 4IRJB 4CMHC 7CGTA 1KLUB 5G2NA 4NIKB 3K58A 2P8MB 2HSIA 2RN9A 2Z92B 5C08E 5EN2B 1DVFD 1QW8A 1IVLA 4C4BA 3F04A 1XXFC 1S7RA 2IH1B 1OM3H 4RWHA 2YUXA 4OM1H 3QHZL 3L3JB 1MRCL 1PS3A 4ZFZB 2VM9A 3SY6A 2V2TA 5E5LA 1RFYA 2IFFL 2H0JA 4L18A 1TKWB 1BPVA 5E9NA 5T1MB 4D9RD 3B2DC 3UCSC 3CFUA 4L8DA 5I0WA 1VEWA 5GGSY 1U8PB 3W9DB 4AEEA 3CLFL 4FQIH 5DC0A 2Z31D 3I02B 2PPFA 2WLNA 2P5WB 1IM9A 1NBMG 2E7LC 4DVRL 4XP6H 5FB8B 3P11H 5KVGL 1PNKA 2YJLA 4P4KB 3FT2B 1YHQV 3GI9L 5FYLE 4XP5L 2FIKB 1VEOA 3A8TA 1B88A 2V2XB 4GBXC 4J3OC 1MDAA 1MFEH 1XHXA 2PWGA 4UBDD 5IW6B 3H9HA 4JDVB 3VXPA 2IAAC 3LPFA 1SEBA 5F70A 3ISWA 1CCZA 1KXQE 3VG0H 3H56A 5DD3L 5TJWK 2ED7A 1LDPL 1EHXA 1OP5H 4OLYL 3VJ6B 5D55A 2UX6A 2N05A 3MKGA 5KYWA 1SDDB 3FCSB 4RMWA 5LWYL 4JFSA 5DVOA 4XMLL 3L4WA 4P9PA 4YBLC 1J5HA 3SKNA 5KYXA 4LAQH 1ADQL 2PCFA 5I23A 3M6DA 3PP3H 1U2CA 3ZTDC 3B8MA 1TZAA 2PYLA 1CLCA 1R3IC 2BZDA 2DIJA 3HC3L 1K6QL 4FKKA 4L8SA 1S4IA 1I94B 1SYVB 4OGAD 2KL6A 3HI5L 3OC8A 2Q86A 4JR9L 5D70H 5GRUH 4JQVC 1KEGH 4N8CH 1OIOA 5FK9B 4P2RE 4AGQA 3IEAA 3J7AU 3WOVA 1QEXA 3FT3B 3ROLB 2YQGA 3MBEA 3EJTA 1JV5A 1N0LA 5KX5A 1HOEA 4PWKA 4PY8I 4KGJA 2UXVA 2IOMA 4CS2A 4FX5A 5DHEA 3B5TA 1LO2L 1R75A 3WO4C 2AC0A 1JJ2U 2E9IA 4E0RB 3U1SL 4FQXA 2C9XA 4MNQD 3SKMA 1QBBA 2G60L 5A3ID 3H85A 1CLOL 5HI4C 2O5YL 2A38A 4B50A 3K0DA 4B9IA 4DQAA 3VXUD 1R33A 3HBPA 3E8FA 1IILE 1P5VB 4PVBA 4L9LA 5GGUB 4BFBD 1CIUA 4JPKH 5EDXA 1XR8B 1U91A 3D3VA 3C8KB 3TBYB 3UO8B 2GUZB 2Y4SA 1KV3A 4I2XA 1I85A 1QSED 4JO3L 9CGTA 1IKNC 1FRGL 2F7QA 2ED9A 1PVHA 4BGDA 5I5MA 4PMEA 2V17L 5D2LB 3GTTA 5K1XA 3MXVH 2W1NA 2MFNA 1PQZA 1FPTH 1MPAL 2PWFA 4DV2B 3LQAH 1I5XA 1BZ7B 3SKJH 3Q06A 4NFBA 3BSZH 5FYKD 3JCZA 1KPRB 3MYJA 4FQ2L 4Z7UB 1A1OB 3OR6A 1WWBX 3HE6B 3I85A 3LS5H 5ABZA 5E8DL 5FOBA 4HCRH 3KL3A 5ENWB 2BOCA 2F18A 1UM5H 5MHSD 3AREA 3P0GB 2NYZA 5DMJB 4XMVA 1CGYA 1I7TB 1ZHLA 1A4KB 1NGPH 4U3SB 4JRXE 1YMMA 3ECBB 1WG3A 4XVTH 5A1AA 2BNRB 2GYSA 5JTWA 1ZV9A 3MVSA 1NKRA 2VDLL 5E0QA 3F85A 4ZTEA 3OKNB 4XCCH 3RKPA 4MD0B 2Z6FA 3J8F7 1I8MB 4YHNA 1NMAL 5FR3A 3QUYD 1EVTC 1AR1D 4N2MA 5DZLA 1J9CT 2PO6B 4WW2F 4FLRA 3O9OA 1FH5L 4HIIB 4IGBD 3ZKMD 4HWEL 5LYJA 2OBGA 2EIMB 5F93C 4I9WA 3OE7G 1IC5H 2J55A 1W0VB 1MDTA 3HG0A 4OCWH 3UTTA 1SUJA 1PZ5A 4WEEA 4O4LB 2CSPA 1AS7A 3T4AB 5GS0H 2K78A 3FRPB 3OPZL 3AQXA 3Q6GH 2Y7QB 4AQ8C 1UD2A 4GS7C 4F7MA 4AENB 1IE5A 1AS8A 1ZTXL 3BE1L 3CSYA 4PGBB 5HPOA 2VRZA 3WKPA 3KDMB 3MGAA 3P4MA 4ABWA 2CGNA 2R1YB 1WJZA 4HKXB 5I0VA 5I1DA 3MJWA 4E42A 2QKAA 4FFZH 5ADPH 5HTSA 4AG4L 2DJ4A 5EOCL 4ZS7H 1LVEA 3RFZC 3HBGA 3U79A 3MRPB 4HS6A 5B1JC 1G7MA 3LRGA 3E80A 3FSZA 3KGRA 2LGQA 4G27B 5DFVC 4G28B 1NVPD 1QR4A 5JIKA 3ZIMA 2N7BA 5D1ZA 2Q73A 5I1IL 3K46A 3MNZB 1A7NH 1HSBA 2NQCA 2NLJA 4XAWL 4F33A 1SN5A 1XF2B 3O6FD 4N0UA 3ZMVA 1UM4H 4AT6B 2BOLA 1DEEB 1NMCB 3S3BB 5DC9B 2E76B 1DF5A 5DK0B 1IC1A 2MTPA 5HPMB 2VQFB 1UG9A 3QEQB 3BAWA 5IREA 2GW5A 3SN6N 1G7LA 1NAML 3AREC 1IAOA 2VMCA 4GW4A 4JHAH 4WO4A 1QOKA 3PWPD 5DD5L 1SVZA 3N1FC 2ENQA 3FQXA 1U3JA 5KOVC 3TNMA 4FXGA 4X6DF 2V7QG 3RZCC 3GJEA 1YZZA 1NGQL 3GSNA 1A1NA 1QMUA 1XDTT 2G4GA 3J2PA 5IOPB 1U9KA 4XXCA 4Z7WB 3FO9B 2EECA 4F37F 4FKHA 5C0CB 3DSFH 4ATWA 4MXVF 1ET5A 3KJ6L 4GRWB 1HHJB 1T5XA 2NR6A 1INEH 4Z3JA 3QIUA 4FJ6A 3RWCA 1Y18A 2ADJB 2AK1H 3H2WA 1BAGA 1K73W 3LVEA 5D7LB 3QDGE 2R56H 2QFPA 2EIKC 4R4BA 2DOSA 1X44A 2C4FT 3ULUL 1KTLB 2XFXA 3QWNA 1H3PL 1K4DB 3O3AA 3OX8A 3W2DL 4AYBA 2LAGB 5IB5A 3QA3B 4U1GC 4J3WA 1G4RA 5AQ0A 5AYUH 1H5BA 3QH3A 4L3CB 4AJVA 3T6WA 3ZTJH 3K6DA 2BRRH 1M71B 2IMMA 1UC6A 3P73A 4QRQB 2FWLB 5DJDB 5D5QA 1AXTH 1M56B 4DR1B 5D1QD 5ANHA 1KLGA 3BUYB 3VFSA 2GPZA 3NEXA 4HBCH 5D1ZC 3JV4A 3EYQD 3SDXA 4PV1B 4RGOH 4X6BB 3AG4B 4O4IB 5IWAB 4L3FA 3WJMB 4N8UA 4DVBB 4DZBA 4YSRA 4PJBF 1RSFA 4JKKA 4L0YA 5FYJD 2GHYA 1HU8A 2K6ZA 1XBDA 2YXLA 2ICEA 4EJ1C 1LK3L 1HEJC 4XC3H 3LAFA 1F97A 1DQML 1LYQA 3ZHKA 5ITBL 1JHTA 5L7XH 4MVUA 4KTGA 4EZKA 5LMNB 5GS2H 1FNAA 1KGCE 3A2FA 1CD1B 4FXGC 3E6FA 2CJTA 4ZI8A 2E7BA 5DR5L 4P2OA 2OKMA 4BKLA 1TVBA 1EAJA 1BJ1H 1E27A 2Q6WB 1SUHA 3KXFB 3OC5A 5J12B 3QRBA 1EXUA 3TBSA 1GSMA 3AS3A 5DJXB 1MSDA 5LNEA 3CJHA 5TPWH 3FUIA 1DQKA 2D4FA 1JFFB 2HT2D 2P7TA 1SFDA 2WJ7A 4HC1H 1WZMA 3DVGB 4DGWC 2GJ6D 3L74H 1KENL 3ULUF 3ASOC 1YVWA 2OIEA 4XBPA 1D9KB 1DR9A 1R24B 1M1SA 3QIWD 1AD0A 1KJ3H 3T3PE 1XB3A 4S1SH 4RAIA 4UOQA 1K34A 2FHCA 3O41B 5BS0A 1NBYA 3R19A 5BR8O 2EQDA 2QV4A 1H5BC 4N1EA 3P3PA 3NP3A 4FPPA 3PL6B 3KPSA 3AG3B 1NLBH 3OR7A 4OJEH 4NKDB 5FA3A 1HINH 3N42F 5FF6B 5J3HC 1B2WL 4BSVA 3ARFC 4XBFA 5AB9A 3RU8H 2CE6A 4W9HC 5D7JA 1X5KA 2YD2A 1F3DJ 2AXGA 2ZE8A 4P2QB 2AEPH 1KYUA 5BZXA 4PVMA 1SMOA 1E8XA 4TUOB 4XPFL 3F7RA 4HOZA 4MAYD 3UM7A 4AH2B 3BUIA 1PZBA 2B3IA 4JDEB 4M61B 4KKRA 2IU0A 4PJHB 2B9ZA 1L9NA 5K5YA 4RFEA 1MLCA 2WN2A 4ZPTA 3TN0D 5DHVB 2FH8A 4U3JA 2ZKOA 2H0PA 4PD4F 3ETBJ 4GUOA 3GHEH 2ZIMA 3QCUL 3CFBA 4N68A 4NNXA 1CGVA 4HJTA 3K71B 2EILB 3NH7H 4JANB 2IANB 5LGJB 1XGTA 3OZ9L 2W8CA 1OO2A 2ZINA 3QNEA 2LU5A 4HKZA 4BIKA 1KYOK 1IRAY 3OXSA 4ZUTB 3TYGH 4BK5C 3VWJA 4YVNA 4YDJB 4JNXA 5BZZA 1TMCB 1JRHL 2AVGA 3PDOA 3T2MA 5GZNC 2VZTA 1FVEA 1P0SE 2ZYSA 4HV8A 3RWRD 2Q7EA 2AEQH 2ILLA 3DRTA 4U1LA 1ODAA 2AJZB 4OM0H 5CJ5A 1KZYA 5IJVB 4M3KB 1B06A 2CHDA 4ERSL 4ANWA 2GT9A 2ATPB 4QJ5B 3WLBB 2DWTA 1CGXA 5FUOL 1AQMA 4WEUD 5K9KB 1J5EB 2F1AA 3DO7A 3L3HB 4ZTPH 1BF8A 1T89A 2X9YA 1RK0B 1XEUA 4I3SH 2QLVB 2Z8WC 3KHQA 3GXDA 2ZJSL 2BIQA 4AEIL 5EPMA 5LMUB 5BQDA 3V5HA 1IM3B 3HS0C 1VA9A 5JHDD 3ENEA 5JOEA 2H7WA 2ETNA 3CRAA 3CAFA 4YXHH 3FNKA 2IBGA 5TQ2L 4LWSB 3ARQA 1BVKA 1CU4L 1JHLH 2NMSA 1F3JA 5FM5M 5T1DL 3VD3A 1VB9A 4Q0XH 1EM1A 3IDGB 3ZIYA 3K0WA 4MB4A 5D7JC 3LMJH 1KJVB 4FZEH 4HT1H 4BQ9A 2DV6A 3AQYA 5AB0A 4G8IB 1D7BA 2X9ZA 1GVIA 1VQ7V 1N6VA 2QWOB 1OAJA 4RX4A 3MV11 1I8LC 3L3OA 2UXDB 1UA3A 2WXQA 2GTZB 2QWQB 4PLJD 5BZDB 2Q67A 4YHPB 4QXTA 4PJ8C 4K5NA 4X9YA 2VR9A 2ZWKA 1JVMA 3P3YA 3L3DA 2QPDB 5B3NA 5LOVB 1NAKH 1XI1A 1S7WA 4UIKL 1U96A 4HK3J 1ZWIC 2OZNA 3OKDB 1MRDL 4M56A 1AJQA 1AGCB 1FZOA 1ZV2A 2IG2L 2QSCH 2OI9C 2D2CB 2YBRB 3GYRA 2LGWA 3ZZ1A 5KBKA 1YQ2A 2QELA 1GXEA 1IFHH 3ZBMA 1R1BA 1AI1L 1LR1A 3K4AA 3VCLA 3CTTA 2CKBH 3BA9A 3FB6A 2ZAIA 3M88A 3MJ7A 3MLWH 2FJSA 1EGJA 4M62H 4HJGA 2OR9L 3EJSA 1UJTA 3MLRL 4XMKH 4LCWA 4JFYB 4PEEA 5DHXB 4ZPVA 3K8MA 5DYFA 3RWFA 4F5CA 3HRZB 1YEKL 2GVYA 2YRPA 3VTAA 1LHZA 3T3MB 3BPOC 1MCWM 2FO8A 4LLYB 3CVHH 4PMFA 1O9ZA 2JTYA 1ZLZA 3AY4C 4L8CB 3F7YB 5IMMB 1N4CA 1RPKA 3CXCU 3MUHL 3UYPA 4XHQA 3NIFB 4AM0B 1ZV5A 3FT4B 4K5LA 4ZX5A 2XHNA 3BH4A 2P5EB 2CMRH 5LGTA 2ZD0A 3W7WA 2YC1B 4MA7L 4ESKA 1QQDB 2XOKG 2FYYB 3SPVA 3STZC 3WIAA 3LRLA 5D96C 1ZHNA 4JHWL 1FORH 4R0LB 3ZHQA 2VSDA 4JCMA 5KSUA 4TQIA 3VFMB 3V0IA 1G4MA 4FFBA 4EFEA 3C5SB 2GAZB 1DVFC 1Q4NX 3LRHA 2XBDA 3UC2A 3EH3B 1MNNA 2EO9A 3C6LA 3GSXB 2ICWA 3LZFL 3UCRA 4TOIA 4P4RB 3DMMA 3VXSD 1SF3A 1NR7A 1A1MA 1ED3B 2J5LC 4O4YL 5CU5A 3IGUA 2YPVH 3SDYL 2C3WA 4O02H 5C93A 2Y36H 1TTRA 2UVEA 4E9VA 1L0YA 5FYLL 4YSEA 3VXUA 4NQED 2Z31C 3D18A 3MPCA 4QY8B 2XT9A 1SMDA 5J6HA 4X99A 3PGDB 4MQSB 1MNUH 3CCJV 2D3LA 4U6YA 1NFIB 4FE9A 3VSVA 2AQPA 4DCQB 2P4KA 2XWBB 4TTDD 5I28A 1XCXA 4NWUL 4UM9B 4ZTOL 1AH1A 1V8HA 3HUJE 1QO3A 1FL5B 5KN5B 1EFXB 3QZBA 4I4WA 3DSQA 4TQEH 4UBDC 3SHSA 3L9EA 4GXUN 3N27A 5J1TC 1GL4B 3VI4F 4XN5A 1FN4A 4NC1C 2WW8A 3V5KA 4MMXC 3HKEA 3RWIA 1C5BL 3NFNA 3QUZD 4J3SA 4OVVA 2OJZH 2I7SA 1VFUA 1E9QA 1YEEL 4XO4A 4BH8B 5IQLA 1MIEL 2UWEA 1YY9D 5CFAA 1L1FA 3ATAA 5IY5C 1A5FL 1SBBA 2Q7HA 2KS0A 3IU3A 4NQSA 5AW7B 1HZHL 5GS1C 3ZMSA 4YHML 4JPKL 2XWDA 2DW4A 4PY8J 1YC8A 5FGSA 2VN4A 5IESH 4KI5D 1HI6B 4XODA 2A6DB 4OGAC 1J88A 1O6SA 2YMTA 2DLFL 3I6SA 4WI9A 3VFOB 2DD8H 2VITA 3APFA 5CLZA 3L1OL 4GKKB 5IWLC 4NKQB 1R3JA 2J1WA 3RL2A 1BLNB 3ROOB 4LC1A 1BHBA 3OD3A 1PX4A 1CFNB 3L8QA 5FCSH 2MJWA 3PP4H 1UWFA 5DHYB 3U10A 1VZHA 2RA1A 3GMNA 1EJOL 3CX5J 3IMUA 3MTRA 1FC2D 3TJEH 1DSYA 2UUDH 4WWKB 4XPTL 3TYFB 2Y7NA 1I3GL 4AUUA 1H6TA 2MCPH 4LXFA 1I82A 4X6FA 3VGAB 2H8PB 2VB5A 4G9FB 4PS4L 5D6CB 4EKJA 3SJBC 1CR9L 3ORJA 4GMTL 4WK4B 2BX5A 3MCKA 3SJVE 1JPGA 5A3IC 1WGOA 4JHBA 2A9HA 2NY5C 2P52A 4OJFL 5IHUL 4W4NA 1B9ZA 4C83A 3VD4A 1M6OA 4GFTB 2DQGL 4XVSL 2E9WA 3Q9PA 4HWBH 4ZFGH 1D6EB 2EICA 4Z7VA 5HYEA 1UACL 2DI7A 3HZMB 2WWNA 1UHVA 1S3JA 2ITDC 3HMXA 2GITA 4ONGL 4MKTA 3GNMH 2GK0B 3CDGA 3GEFA 1I4FA 5INDA 3H1ZA 5C0AD 1J1XH 3EZ8A 1V9PA 1TJIH 2HH0L 3KBPA 4XNDA 1OGAE 5KHJA 4UCFA 1PZDA 4PGDA 5F2FA 3SQRA 4G8FB 3W3BA 3SPJA 1YCIA 3US0A 4D7BA 3DHMA 1D5NA 1A0QL 1SFHA 3ARBC 2AXJA 2K3TA 4DTGH 4XOCA 4KZEL 4LBAA 4QGYA 3VBBA 1IUZA 4AL8H 5BOZG 4LFBB 2N74A 1BQRA 1KBKA 3SE4C 1ILSA 4Y2DB 4NOFA 2X2IA 2F7IA 1AY1L 5GW7A 1BJ8A 1TLMA 1TO5A 2CG9X 4N2NA 3AUVA 4ZOLA 4PJ9B 4NKGB 3BT0A 4LP5A 4NQUA 1A6TB 3PFUA 2E5LB 4GG6A 2XKSA 3CK0H 3INUL 3IK2A 1C16A 3KGTA 5DJ8A 2OR8A 6PCYA 2Y1VA 4IEFB 2JJWA 1I3VA 3PHAA 2K4AA 4XCFL 2RR3A 1N36O 1DE4A 3UROR 1Y76B 5MEPA 4LOVA 3FF7A 5C08B 1F4XH 5D72H 1XH0A 4MXWL 2YMOA 3L17A 1C1EL 1M53A 4A7QA 3QUYC 5GGRY 5IROA 2OPCA 1VERA 2CIIB 2JCCA 2VJ0A 2O5XL 1AZZC 3QDJA 4IGBC 2R0LH 3TCLB 3CC2V 3FO1A 2V8LA 1CPUA 3U30C 1YHPA 5J56B 1ECYA 4H20H 1BEXA 3OXRB 5HGDA 1PV0A 3FB8B 1HSAA 1KG0A 5AZUA 1DJZA 3WKQA 2YKLH 1BVOA 2YDEA 1EAPB 1PCXA 2DLIA 2NZ9D 3IM1A 3PHQA 1K3EA 1SJMA 2DBLH 4NUMA 4ZW7A 2P90A 2KZWA 4PBXA 2X89A 2YPLA 5I1CH 2XSKA 4Z3HA 5D1QA 4M6NL 4A6YL 3FJTA 3LHPH 4F57L 2XQYG 2HKHH 1TIUA 4LLMB 4RO2A 4LLAA 1CUOA 3VFUA 1IBHA 3UTZA 5IJ0B 3MX0A 4L1BA 3S98A 3KGUA 2R69L 1AZRA 1JF1A 4LU5H 3O6FC 5K9QI 3HCVB 3MJ8B 4CW1B 3QG6B 5I18H 1Y0LB 3WB0A 3O3DA 4U0RB 1IEAB 1J48A 1YQVL 3FRPG 2HKFH 2DQ3A 5T1LD 2G3XA 3ES6B 5FKPA 1ZGLA 4U1IA 4I87A 4YDMA 1CDIA 2DRUA 1Q72L 4AQOA 5F9DC 2ZIDA 4Q6IA 3EOYG 3ZE1E 5CN0A 5B8CA 5KMGA 1AG0A 3GSUA 4OD3L 5CKAA 4P2RB 1N18A 1QRKA 2P4VA 4UT7H 3K06A 5JNYA 3GSOA 4Z3TA 3M99B 1GAFH 1U8QA 3BPNB 3BXNA 5L88L 3VX1A 2JB6A 4P49A 2DEWX 2IDCA 2XRAL 5AB2A 3T1CA 1N2RA 2W38A 1GKFA 2AITA 2FGZA 4PPTA 4K7FA 3WHE0 5LBSL 3ECQA 1F6FB 3DRQB 2GJ6A 1NKOA 2CR3A 3T0EA 1DJXA 3IF1A 3VXRE 2BTQB 2W07A 4XPHL 5CCJA 2R39A 2P5PA 1NLDH 5EZOL 3QIWA 2VDML 4YSSA 1Z3GH 4ZYKB 3CG8A 3EYSH 1M3JA 3MV9D 4PJFE 4V1DE 4IU3B 1TU2B 2OYLA 4F3FB 3QEGH 1UJ3C 1JGVH 4P23A 1WFNA 3VA6A 1UZ6E 1I7ZA 4KDWA 5CBEB 4LRIC 3MDJA 3JCUZ 2DJMA 1HXMB 2VDPH 4L8BB 2FSEA 1E50A 1VENA 2QMKA 4DP9X 3SKOB 2I60H 1ROWA 3B7SA 1XEDA 2WCPA 5D1QC 3L2MA 3BFRA 2WZ5A 1ZXKA 4XOEA 3GC3A 3CRRA 3QAZB 3CN2A 4XO5A 2WIIB 1CFSA 1CYGA 5I0XA 3EYQC 1FZJB 3DX9B 1T04A 2PTVA 4XX5A 2XTJD 2YLKA 5H4ZA 1BQSA 1BMGA 2B59A 1M05A 1V3MA 3FW6A 5CHNA 3TN0A 1N0XH 2PLTA 2X53A 4I0PD 1YECH 4QXVA 3QNYB 3LQMA 3LRSB 3IDYB 43CAA 5CR8A 3EJPA 5JOFB 1IGFL 1T20B 4JRXB 1VCAA 2MNJB 2VDOL 3M7MX 3II2A 4H33A 4HJUA 4NQVB 4XNMA 2ARWA 4I1NB 1MQKL 2EEFA 2FSDA 3APMA 1MJ7H 1VPOL 5JW4R 2WWWA 3PWJB 2A83A 5FYKU 5GGTL 2DLTA 5I5JA 5I8OL 1MCFA 1IT9L 1KN2L 3D87B 3BO8A 1T0NA 5CEYB 2BS9A 3O2WL 2F5AH 1I7RB 3Q5TA 4NN7B 1SVBA 2HT2C 3EJUA 1K72A 4HKBA 3CCVV 1EJ6A 2D03L 1RUAH 4NI3A 2NSMA 1EEYB 2HJDA 4I77H 1N7MH 3LS4L 3L4XA 4X88A 1A21A 2X0WA 4A2DA 3C08H 1VCBC 4Y7OC 3E2EA 12E8H 3B9AA 1AJ7L 2E27H 3MFGB 3IT8D 2V6HA 2CHXA 5J9PB 1UUNA 4D6TH 4CBPA 5F7EL 2Q9OA 3P30L 2E8YA 5A16A 3QXUA 4QXUH 4ZD3L 5JHDA 1WJ3A 4XCEA 5C07A 2KQXA 1UURA 3TT1L 2WZAA 3G6JE 4HLZG 2HVKA 3CX2A 4JY6A 2HX7A 4WDIB 1S7SB 1JP5A 4N0FB 1ZLUK 2CO6B 4KFZC 2NY1B 3QCVL 3U7YH 2YWYA 2W0FA 2WANA 3B4NA 1IFRA 1P7QB 2WPGA 2VERA 1BSMA 5B39B 5J2TA 4YHIA 2HKOA 3BWZA 1X6NA 1BD2D 4AMKH 1I8KA 1THAA 3LJ3A 3TLRA 2JKIS 4LSDA 2NY7L 4MAYC 2B1IA 2K9UA 2VXUH 3N40F 2H32H 3KPLA 4A7TA 3GBNH 5JDJA 2PYFB 1U0QA 3GJFK 5IW3A 1C5DB 5EO1B 5DUPH 1KDIA 1UXLA 1WQVT 4N5UA 5AYTA 5ESVA 3TN0C 1ZGLP 4FLOA 2CXGA 4QNPE 1AZBA 3ZN6A 4DWHA 4LESA 1KB5H 3JVGA 5E6YA 1SVCP 1KB9F 1RJYA 5FHBH 2IH3B 3LSOA 4RFOL 4WI7A 4LEBA 2WD0A 1IE4A 4YFLF 1N6UA 3HG1D 1IAMA 4DV1B 4DAGL 4DV3O 4NRZA 4PTTB 3A0BZ 1O0VA 2Q8AL 1U92A 3X13B 1MWAH 5JQ6H 3RYCA 3AS2A 5E08L 2OT5A 1K3ZA 1E4WL 1ESOA 2BY2A 1K2DB 2OL3A 6TAAA 4JI6B 3G4SV 4HOMA 3GHBH 5E1AC 3QDGB 3IS0X 4ODSL 1KJ2A 3QUGA 3BEVA 4S1QL 4KRLB 4WV1C 1RSOA 2I69A 1JGDB 4GKZB 2F5BH 3TFBA 5L2KE 2W6IG 1TVKB 3QF7A 4PDMA 1TZHA 3KCPB 2ICCA 3D69B 2UZYA 1OT2A 1SQVH 2YD7A 4HX1A 4EI0A 3REVA 1NC4B 3H4FA 2WIMA 3FT1A 1R17A 2C26A 1Q9KA 1FFXA 5D9SA 4L1SA 1RJLA 3SGJC 3GQFA 2A73B 3CV5A 5BV7C 3QSKB 2AERT 5MERA 4DGUA 4K8RD 1W0WA 4UT6L 3RVWD 4HUUB 3TU6A 3LDEA 3BUDA 2EXYD 1T2XA 4ICGA 2XXCB 4MAUL 4GIPD 5K1VA 2E47A 1NIAA 4G43B 4FLWA 1CXFA 1EQWA 3GMLA 4GW1B 3IFLH 4FYRA 3QJTB 1AB3A 1XMQO 3BFOA 4WJKB 4MJIE 1RIHL 1GGIH 25C8H 2B0SL 4QT5B 3GT6A 4PLJC 1OB1A 2E56A 2LW3A 3LN4A 4MDRA 1HNFA 4HGMA 3VGBA 1E3FA 2VDOB 4XCYB 4NUJB 5HYSB 2Z7YA 5FPRA 2E3VA 4WY7H 3NK3A 1HNXO 1ZA3B 4BZ2L 3CFKA 4NQCE 5AW9B 3F7QA 1KCSL 4OI8A 1AGDB 1DVYA 5FYJU 4IT5A 1J18A 1CB4A 2R23A 4PRPD 2OSWA 3WTTA 1MCRA 3Q3GB 3UKMA 4XDKA 3TNNB 3AG7A 4FNLH 3D36A 4XP1H 3SYQA 2VQTA 2KLRA 3T8MA 1LE9B 1PKQB 3L73H 4OJYA 2IALB 4Z1PA 3G5VB 1W72H 3T3PB 2ITFA 1J8KA 5DURD 3VRIB 4KZDL 1UD8A 4XHJD 1SQFA 5DECA 4FYSA 1JGEA 1WO2A 5TGBA 3ZKXB 4JYCA 2IXQB 2YXFA 5T3XD 3SDCA 3ZE0F 3EH2A 1JWMB 4AGPA 3APCA 4Z3IA 2X09A 4WO0A 3BP5A 3O2DA 4G8GA 5CP7A 1R3KC 3FQYA 4LR3A 4RZKA 1AZNA 1AO7E 1FE8H 3CZEA 4QRRA 4UQBA 1CXHA 1P5UB 3VYOA 3DVIA 4EN3D 4MJ4A 4PRHE 3F01A 4AGMA 2ZOLA 2ZP8A 4H8WH 1PY4A 2YXWA 4U6VH 2CBQA 5H37H 5FM8A 3UOAB 1EANA 4PJIE 4QTIH 5BVJB 4H7VA 4BIUA 4GO6B 2R8SH 5IFJA 2APXA 1S7VA 4RISL 3U36B 5AAPA 4Y5YA 5JW5A 1HK6A 2VQ1A 4E9LA 3AM8C 1VQ4V 2YRZA 3RI5F 2AEWA 4OLZH 3SY0B 2F53D 3QORA 1CFTB 1SC5B 4JFED 3HKCA 2A6KA 4YNYB 5AW0B 1XZ0B 4Z76A 4OCLC 4JK0D 4TNWF 2X6VA 1G9HA 5E6SB 5EF3A 4LPXA 4IBYA 1NDGB 4HMDA 2FZ3B 2OXGB 4OLEA 5FGRA 4RGMB 4U6HA 2JKTM 2OTWB 4M8RA 3RPIA 5JQHC 1BAFL 2ZR3A 2PMZA 1C8QA 1MHCB 2VDQL 4HUXB 4TTDC 3ZHRA 2HXAA 3PE9A 3BABA 3BZ5A 3FO0H 4HW6A 5C0AA 5HYIA 1QBMH 1C5CL 1ULVA 1YVLA 3G9AB 4UOW1 3WFDH 2HVJC 3QRGL 3CCQV 1KPVA 3U11A 5T5NF 4DKFH 1A66A 4YJ3A 1IBMO 3FFCB 5EB9A 5EUKB 1GYCA 1XMEB 2DEXX 3EYFA 4LNRA 4WAFA 4X1YA 5CILL 3QUZC 4O9HH 2YXHA 2YSTA 3T4YB 1YY9C 1PEZA 2AI0L 32C2A 4ELME 1NBVL 4Z7AA 3SOBH 4K2UL 4J5VA 3NCXA 3E8UL 3MR9A 3MRFB 1OVZA 4GAGH 4XMWA 2P67A 5HJ3A 3RY6C 4AI7A 4LSPL 4PVNA 4KI5C 4HAFA 4WJ5A 4MQXD 5TFSH 1AVMA 1F02I 4X7FC 4J6RH 2I24N 2Z64C 4PSPA 5HYQB 5LP6A 5IKCA 2J6EL 1O7DE 1YNTB 4FFYA 4DR7B 5EZIH 4XN4A 3LUTB 2CKBB 3H7BA 5JMOC 2EZ0D 4M43H 2UZIL 2EDTA 4CNIA 3ULVE 1OGSA 3V95A 4JZJA 5CKGA 1IXBA 3V0WH 5F7HA 3CVHB 2VL4A 1H2LA 1YA5A 3A6CH 2BP8B 4I3RL 5EHFA 5IYZB 5TK4A 1WDAA 2ITCA 3QFJD 3IFPB 1XGQA 4PG2C 5HJBA 1FJGO 3PAUA 2YQ3A 3HUJF 3TJHD 1DYZA 1KDJA 5GGQH 2QTEA 3SBWA 4C56D 5GXBB 3UPRB 1Q81W 3ULUD 2R2EB 1CK0L 4OLVL 5E9DA 4C8XA 1I7UA 2YSSB 3PN1A 2Y9RT 1J5DA 1X5YA 1ZK5A 2P28B 3CFEA 4G3YL 2X4QA 2DQDH 4OCYL 1SA0A 2WJ5A 1FLRL 2DWSA 1TUEB 3FCUB 2BC4A 3MV7D 3BGFB 4IBQA 4GQQA 3RUGA 3MV8E 3ULVH 1QRNE 1RIUH 2PTTB 2AEOA 1PY0A 1OHQA 2HTLC 2RGSA 3FHEA 4MA1B 4NRYA 4WUUD 4YH6A 1IL1B 4WHYH 2HG5A 5D7IF 4FQQA 1KFGA 2DQJH 3TF4A 4UTBA 1CFQB 1KXVA 4CSZA 5J6GB 1S76D 3GDCA 4JPQA 1JGUL 1O75A 4GT7A 3FTUA 4R7NB 4JX0A 3BIBX 3B9VA 4ZFZA 3T71A 4JJHA 1CG9B 4U1NB 4LVHB 3EJCA 4X50A 2VRQA 3ABMB 1JK8B 3GRWH 1AI5A 4FI8A 4YBHA 1S0VA 1PIFA 4YIQB 4TV3A 3W9DA 3BT2H 3V4PL 4JV5O 1SXCA 4KMTH 2Y3AA 1TYRA 4Q52A 4OVUA 5BUGA 3DX8A 3K8KA 4OJAA 4P4KA 4P9ML 3LNGA 2R1WA 1YJDH 5FECB 2OCHA 3K2KA 2FIKA 3LZOA 5CZVL 1NEUA 3K3WA 3CDZB 3NCFB 4P9HL 5FHAL 3N44F 5IW6A 4JDVA 1VACB 2VOTA 3FUDA 4X5XA 1MZFA 3GSWB 4X6CE 4LBEC 3WU2Z 2ZOTA 5BRPA 5BRZE 2JGDB 2QZQA 4HCFA 3MJ6A 4NLAA 4X62O 2VDNH 3VJ6A 1ZXQA 1HXYB 1SN2A 5GISH 1ETJA 1BQHG 5HHVL 3M17B 3FCSA 3D33A 1T0OA 5EOQH 1ZOXA 2KUTA 4M6OL 2P9RA 2HHHO 4JDTL 1QHOA 1YN6B 5C3IA 1AS6A 5DJ0B 2R29L 2DOCA 3MOQA 2B3RA 2NZ9C 2G2NA 4K71B 3SBWC 2ESVA 3J80N 1OAYH 2UXBB 4WFHE 1KCRL 3EOAB 2WOBA 4D0CB 1A22B 2Q2LA 2GV9A 5E94B 1RHHA 2I5YL 2BY3A 1A6VH 3AWGA 2JK5B 5FK9A 5I6NA 1QR1B 3H8NA 1O6VA 4FNPA 1MCOH 3OM3B 1TQBC 2H3XC 3KPOB 4OQ1A 4RQQB 3THML 5ELIA 2O57A 1I1FB 3IFOA 4GSDH 5K9QG 2HG5C 3NJMA 4MLSA 5FLVA 2P1YA 1DLFH 4FXKB 4K55A 5LLIC 1O9VA 2G3NA 3DSNA 4QHLB 3SPIA 1AG6A 5DJYB 2WO3B 3VFGL 3CCEV 3QRLA 4CAGA 3T1WA 4G5ZH 1GYAA 3WY2A 4E0RA 1BMZA 1TVHB 3L6FB 4R9HA 1G1OA 4TYUA 2IPUG 3MRDB 4ODVL 4L1DA 1BVLA 4KJYB 5KJRH 1G7IB 4P2AA 1HXKA 3GB7B 3WNNA 4QRTB 4UAHA 1BF5A 5GGUA 4O51B 1IC7H 4P5RA 4NUGL 1XR8A 4KBPA 1VIWA 3C8KA 5CCHE 2AF2A 1JMZA 2GUZA 2VJ8A 3GEWB 5F6IB 1EHNA 1LO4H 2H2SD 4LOUD 4PB0H 4O2EA 3VXQA 3O2VH 2AZUA 4V33A 3IMTA 4OZ4B 2J8HA 4TUYB 1WEJH 2XC8A 1Q8IA 3MRMA 1ZVHA 3NRFA 1H0DB 3SJVB 2BP5M 3I56V 3WS3B 3V2AR 3E38A 4E2LA 3BKYH 1XCQB 1BZ7A 1JZ3A 4KHPB 4OGXH 1U6AH 3UGXA 3FT0A 3HLAB 3CWBH 4Z7UA 3BPCA 1A1OA 4JM2B 1SS3A 3HE6A 3CRQA 3QRFM 3CZFB 1EERB 1KIPB 5ENWA 1N19A 3MNVA 1VZIA 5FWQA 3N1MC 5FW6A 4I0CC 3WS6C 3S5ZA 3G6BA 5T5FH 2A0LA 4NEHB 4ZDHB 1Z9MA 4YX2H 2DWEC 1A4KA 5K33A 4UQ2B 1JGLL 4U3SA 3FTGA 3O8XB 4MMZC 5KS9E 1OGAB 2QGCA 4OT1L 2BNRA 4AHCA 4FZ1A 4M7JL 1G5GA 1HCZA 1MCBA 3RGVB 3CB2A 1MZYA 2ZOWA 4RMRA 1M7DB 5F7BA 2XQYA 3ZE1F 3QXDB 4WI0A 2IWGA 4DEPC 4NQDE 1RD6A 2XTJC 1RFDL 1MFMA 1MAMH 3OJMB 1QKZL 3S4SB 4AYFA 2DMBA 5E2WL 2MHAB 3R0NA 4HIIA 4I0PC 2JMRA 4JF3A 5A2AA 2DYRB 4D7TA 4HIPA 4YOKA 1XNRB 1OLLA 2YK1H 1W0VA 3RWEB 3JD4A 3B1TA 3WYRA 1PDKB 2ZCKL 3FRPA 4L05A 3UBGA 3CCHB 4LLQA 5EH1A 1RVFH 4YHOL 2H1PH 3ZDYE 4PGBA 4OTXH 3MA7B 2DJSA 1WD8A 4UI2A 3EDKA 3K0YA 4XBGA 4KKZA 1J12A 2LU7A 3ZKND 2EDBA 2B1GA 3K72B 4PELA 4CMMB 3ZY7A 3S6CA 1AKJD 2B4CL 4M9OA 4PGCA 4OGYH 4DR3B 2O5ZH 1KXTA 3C9NA 2C7FA 1H3TA 1R5VB 2XVLA 2E9GA 3ESMA 5F0MB 15C8L 3A6BL 4X7TB 3D25B 3B2XA 4E9RA 2IH9A 3DC0A 1XF2A 3AG2B 3ALXA 2EDOA 5C09E 3WFCL 3MA9H 1KGYE 1D5IH 1MJ8L 2Y2YA 3F7VA 2Y07H 1RV6X 4U1KB 5IVZB 2AJYH 4CU8A 1M7UA 3BKJL 3WMSA 4B7KA 1BZ9B 3QEQA 4FLZA 1D2PA 3TP4A 4XNYL 3A23A 1F1GA 5GZOD 2FWOA 4N2GA 4Q9RL 4R7VA 4JTAB 2JJTA 5ID1A 4JPWH 3SCMB 3LDDA 1WTGT 1R6TA 2CLZB 4L3EE 4CBZA 4Z7NF 2D31A 4QD2E 4MTOA 4TQHA 1TR7A 4ZUVB 3CN3A 4LASH 2X4PA 5DVKA 3FO9A 3BRDA 1S9YB 4LSSH 4LSTH 3ESPA 2OMWB 2APBA 4CC0A 1BV8A 3U0WL 4LF5O 1MI5D 1KCUL 2JH2A 2VR4A 3MHZA 3ZE1B 1I9RH 5LN8A 3GPEA 4LSVL 1XILA 5DD1L 1CFMA 3T6QC 3KYNB 2J25A 5A40E 2X4TB 3K80A 3VI3F 4ZOAA 4UVCA 4NC2B 1G6VK 3EXJA 5FGBA 1E9PB 2VDPB 1RUPL 5FW8A 5J13C 4UQ3B 4DETA 2MCMA 4BR6A 4GUPB 2NX5D 2AAVA 2F08A 1AVAA 4L3CA 4X66O 3QS2A 4MS8D 1M71A 1NEPA 3HVNA 5B39G 1KY6A 1MF2L 3NN8B 1SJXA 4QRQA 4WJG3 1URZA 4BK4A 5KVFL 3CFMA 4XAKD 1INDL 2XV2A 1BBJB 4GG8B 5IQ7H 1A3LH 4W4OA 3VXRB 3X11A 3KWTA 3ARGD 3BUYA 4JB9H 5AKTA 5EO9B 5F44A 3WIIH 4EDXB 5IEKB 3DJ9A 1XQ8A 4D94A 1SHXA 3EDEA 4GEJA 4JGMA 1IU1A 4LVNB 4PJFB 4V1DB 2LFEA 2FNWA 2IPKB 4O4IA 1S7QA 3WJMA 4AIZB 3BP7A 1U3HB 1YTFD 4JZNB 4Z7IA 5KJ7E 1R3IH 3TBTB 3F7VC 4IBZA 4P3CH 4LF3A 35C8L 4P2YA 1U8HB 3O4LD 3L48A 1OLZA 2X2UA 3P3SA 5I66B 4N2LA 2VW7A 4DUYO 4MD4A 4J3BA 4K8RC 3RVWC 3QIBB 3IMVA 1JNJA 1QVOB 2ZCLL 3BI9X 2EXYC 2E8ZA 2JKJA 4P3DB 2ZDIC 2JJ2G 1CD1A 1WV7T 1CMOA 5KSAD 5LO7A 1QQCA 5BZBA 2AEIT 5GGVH 5C0GA 3MJ9L 1WZ1L 2LAAA 2JEXA 1X5XA 2AHYA 2CBMA 2K0RA 5T33L 4C4KO 4XNBA 4PV9A 3CMOH 5DJXA 5F6HJ 3VFNA 4D3CL 3DX6B 4WVRA 3SDAB 5I71C 4TPRH 1J0JA 1BJ1J 1JFFA 1LEGB 3NZ8B 1CICA 2KZ1B 1SQ2N 5KYYA 3DVGA 3B3IB 2W65A 4YBQD 3SE8L 2G5BB 5EZJB 4HHWA 4WW2C 2NYYD 1QPXA 1RIVH 2VWEC 4EDWH 1GW6A 1UXWA 2F58L 1OCRB 2QGNA 4UV7L 4AQEB 5IK3B 3FN0H 4MX7B 3N2KA 1T2QL 1COWG 2QTSA 1J8HE 1OAUH 1E6OH 1RU9H 3O41A 3SKUD 3TEWA 1RK7A 2XETA 1T5WB 3DYOA 3VD2A 1G7HB 2A74C 1HNZO 4JPSA 3S35X 2CGZA 3PL6A 1D5BA 1AMXA 4L4TD 4NKDA 3HA0A 3WJLA 4GNKB 2WBJC 4XDJA 4NBYB 5FF6A 3MFFB 4MJ2A 3S35H 2VH5L 4OCSL 3E89A 4O2BA 2XASA 2H32B 3NYKA 3HR6A 4N9OB 4P2QA 1EMTH 5DUMH 5EYPB 1JYWA 2FEJA 1KEML 1B6DA 2L7QA 3D85D 3CXDL 2AV1A 4U3FH 3BH8B 1H6EA 2CA3A 4XHJC 5JIHA 2AZ2A 1KUMA 4AH2A 4K5MA 4M61A 4RMSA 2ZUUA 3JV5A 4RA0C 1KBBA 1N34O 1L5GB 4ETQB 1KB5B 2WSDA 4WFFE 4PJBA 3HFMH 3EG9B 1EN4A 1VF6C 3G6JB 4ZRGA 4YHKL 4CVUA 4KITB 5IDJA 3GUFA 1PD1A 2ZNIA 3QG5A 1WITA 2NXZD 1NAMA 2HR3A 4EN3C 4G59C 1WBXB 5A2IH 3K71A 1MY7A 3IDJB 1MWAB 4B9KC 1QSFD 2IANA 3GLAA 5LGJA 1E6JH 3LEXA 4D0BB 1FV1A 1XSOA 1GY2A 2G9HB 4A63A 1FCCA 2Q5BA 5I1KH 1AE6H 2VLKA 1R6NA 5DWUH 1CLYL 3G7TA 1S5HC 5AUMA 4KQ0A 4LSRH 5IJVA 1JPXA 2X2HA 3E6HB 5I1AB 4X4YB 3OGIB 3H42H 4JFVA 4IDJH 1TZGL 4FQLH 2ATPA 1VQPV 3QJRB 5HHOD 2QKSA 4C55A 2C9PA 2G4EA 5AAMC 3BW9B 4IHJB 3L3HA 4IRSD 4N28A 5I6MA 4LSQL 4DN4L 1OCCB 2ORBL 3P3TA 4HKJB 5D4HA 5AVSB 1N5AB 3Q48A 4PCTA 1YMME 3DWTA 3RA7L 1OHZA 3KPRE 5MEND 2KG7A 4OAWB 1JTOA 3UYOD 3W38A 1WHPA 4LWSA 2DQMA 5L2KB 1K8IA 4YSUA 3I9GH 2GSGB 4KK5D 3IDGA 5F9WB 2P80D 4HZLA 3RNKA 3K2UL 3TEXA 3P54A 4BKSC 3HR0A 4YY3O 2EDQA 2Y24A 2ZKYA 4KK6D 5EBLB 1HCYA 3QR1A 4TRPH 4AQZA 1HEZA 2CLVB 1JPFA 3UTTE 3W0WD 3ZYZA 2UUAB 5AVXB 1NH2D 3VX0A 1QHPA 1JS4A 2NY0B 1M3IA 4FZ8H 2Z93B 2ZKHH 2MPAH 3LIZL 4Y88A 5BZDA 4UIMA 1U3ZA 4H2AA 4G7VH 2UZXB 4KO9A 4MQXC 1OF2B 4NJAL 5C2BH 2CA4A 4M5ZH 3LNDA 4G6JH 4B7EA 1SOKA 5E8OB 1R5WB 1G1CA 2DQEL 2LABA 3U9PL 4OCMC 2AGJL 2VABB 4EI5D 1H9VA 1OAKL 5TDOA 4F1ZA 1AGCA 4KDTC 4Y5XB 4G71B 2EZ0C 4G83A 4Y2NA 5CD3A 4MJIB 4YE0A 3UZQB 1BX2B 2DMXA 1RSYA 1W72B 3OKMB 1RMFL 4ZIBA 2QHLA 2ZCHH 1A8JH 4UOW0 5HDOA 2C4FU 3HRZA 2BSED 2C9RA 1TOXA 4Z7QE 1YJWV 2EE3A 4JW3A 2F8IA 4WWID 2EULA 4NLHA 4KVNH 1IKFL 1S7TB 5KSBF 4L8CA 1QCEA 3F7YA 5IMMA 1RQ5A 4GX5A 2R0ZL 2B5UA 3VGEA 4AM0A 4DP7X 4ILDA 3O11B 3ULUC 4K07A 5SWSE 2UXFA 3KM2A 3HKDB 4W9DC 3UP1A 2YC1A 2NOYA 3L1GA 2M6YA 3NA9L 1QQDA 3FOLB 3LIUA 4IIJB 1F4NA 4LDCA 4ATTA 1KIQB 3VFMA 3G04B 1QNMA 4GH7B 1LL1A 4U33A 4AYMC 5C6TH 5AEAA 4LLUA 1JPST 3S37X 1JYNA 2XAJA 1DTUA 1GGCL 1W0YT 3JV6B 3M1CA 3W7UA 5F1IB 3JAMN 5FGCE 3FBQA 5AVTB 5C0IA 4JI4O 1ZKAA 1X6LA 3S8WA 4K94C 5C0EA 4HXBH 4XWOD 5CR1A 4FK5C 1ZE3C 4KJQD 4XX1E 4NC0B 5M95B 1AO7B 3OAYH 5HGBB 3WEAA 4DV0O 5HVHC 2WLLB 3F7LA 1SZTA 2CJUH 3C09B 1A7PH 4JL1A 4PRHB 5CINH 5HXMA 2QGEA 4GQ9L 1KIUB 1GN6A 1M90W 3GXTA 3L81A 4G7RB 4QY8A 5E2UL 3IC7A 3GSNH 2P8LB 5ESQB 5IMKA 4OIBA 4LF8B 3TASA 1NFIA 1A7QH 1FGVL 3MBXL 4PJIB 2ZXWC 1L7TL 1DBJL 2J44A 5EU4A 3WUWA 4QRSB 4BQ6A 5ACZA 4UT9L 5BO0D 4UM9A 4PA6A 1IIIA 4TVPD 4LE8A 1QATA 4WUKH 1A4JB 5GRJL 5L2JA 5KN5A 1IGTB 4MD5B 4M3HA 4ZS6D 3TO4B 3FMGL 2ZE7A 3QUXD 4KPHH 4U6TA 4Y4HB 1CE6A 1WC7B 4LLWA 5LVEA 4KUZH 5TF1L 1B6UA 2PXYD 3FOMB 2VXTH 5JORB 4IOSA 2KLSA 2WXIA 5EV7A 3FFOA 4B95C 3IE4A 3PQYD 3B56A 4AGLA 3B2EE 1CLVA 4LH7A 5HYJA 3WNKA 2G75B 1A6UH 4MRBA 3STLA 2BIOA 4PP2B 1IQWL 2MMXA 5ADOH 5KVDL 2EYSB 2XAFA 4NN5B 4CSPA 2A6DA 3VFOA 3BRFA 4YR6B 4LF6O 3CCSV 4OZIF 1BIIB 5DK3A 3ROOA 1BLNA 2OLDA 2UUBB 2BDNH 5GGSA 5K1JA 2WWKT 1YI2V 5AALA 3WBDA 4FABH 1N8ZB 4GKOA 4ZMOA 2OCFD 3EFDL 3PF2A 3VW3H 3O3EB 2LO1A 2KDYA 1HL9A 3K04A 1RM1B 4N2CA 1M2VA 4MA8L 3VQYA 3GMOB 4ELMB 4N8PA 3HN3A 1B4RA 2V33A 3SYOA 2VR8A 4F9PA 3KR3L 5IT2L 2NSQA 1CL7H 4LFHD 2ALAA 2LFRA 1G7JA 4M48H 1OJHA 1UKTA 2H8PA 4G9FA 3QQ4B 5E95B 5I1LB 2AXTZ 1K5NB 1X5ZA 3HG2A 4PCSA 5D1XC 4QE7A 2ZUYA 2Y3NA 4DK5A 1CF8L 5BS0E 4DV6O 1JQ0A 2IJHA 1CDGA 3IGFA 2DQHL 1FAIL 2F7PA 4M1DL 1QLEC 1ANUA 1SDAB 1ZLUH 3FAVB 1D6EA 4F92B 4UDTB 4ZX6A 1JZIA 1FKAO 5JPNB 3UEQA 1FD9A 1MY5A 2XZQH 1W91A 1AZVA 3D2TA 1T66C 1VQOV 1HAUA 3BVXA 2H2SC 4LOUC 4OZHE 3BVNB 2ZWNA 1RURL 2DQIH 2ZSWB 3VO0A 3BYYA 4Q8BA 4UB6Z 3ZMZA 1NWOA 3LKRB 4LSUH 1J0KA 2J88L 1NBZA 3QJSB 3OB8A 1L0PA 2YUWA 2E7HA 4G8FA 3CFCH 4QRUB 5B1OA 4XNZC 5B3JE 1P1VA 3GJFH 1O9GA 3B40A 2FECL 4H40A 1YMHA 3VQMA 3N85H 2HA1A 3HE7B 4WGVB 5ISZD 1REIA 1YY8A 3FB7C 4HK0B 4JM4H 4K3JH 1BQHA 4KV5E 1KYAA 3STLC 5D4IA 3RDTC 1XR9B 1A9BB 2VKWA 3I3BA 3Q6FB 4IIQB 2AJXL 1A6TA 3QFDB 1SXNA 1MSPA 5F1NB 1P4BL 5ECJE 3MV8B 1QRNB 1E5ZA 1NCUA 4YXKL 1JFQL 5J5EA 3RY5A 1GTOA 2FBRA 5CSGA 5C08A 3CZUB 2F19L 5HFMA 4KY2A 4JUSA 2GIMA 4DERA 1KCVH 1XIWA 2CLRB 3OG4B 2VMEA 3UJTH 4YLCA 3K4ZA 3H0TB 1MI5A 4GQPH 3S2CA 1JUFA 3QVNA 3G3LA 3T77A 1FVCB 4ZOCA 4NJ9L 4EMZA 4PJDF 4Y5VB 3PHOB 4ZMXA 4DW2L 2GEEA 1NC2D 3X17A 2DTMH 2EBOA 2ZX5A 3GIZL 3OXRA 5AOZA 3E35A 4PJEE 3FB8A 2BCKB 1RZIA 3VWKD 5C6WH 5I6PA 4BAYA 2EC9T 4ACTA 3T4DA 1JXFA 2V5MA 3ZGHA 5C0RH 3ZKNC 2RACA 3HNTH 4F7PB 1XF5B 3DTXB 5HDBE 2JS5A 4LEXL 1PPIA 1T5KA 4N8VG 1KXQA 4X6CB 4BZYA 4KXCA 2RCSL 2W95A 3T1HB 3L5XL 5BRZB 3ARGA 4JKNA 5I6XC 1UCBL 1URFA 1H2NA 1K5SA 5E2VH 3EHBB 2DJVA 4JYAO 1UZGA 2CO4A 1TPXB 3UDWA 3WN5C 3S3XA 2LVEA 4YUEL 3MJ8A 4CW1A 3QG6A 1EJFA 1Y0LA 3H2PA 1NCHA 1URIA 3C8HA 1D7DA 4D9RE 3TF7C 1IEAA 3NIDF 4JE4B 5LHHA 3FCTB 1U3NA 4NZRH 5GZOC 1S46A 1N5YH 3DOIA 2KYIA 3EBHA 5B1NA 1KYFA 1SKVA 1NGWA 1NL0L 4MB5A 4HLEA 4NM4H 1J0IA 1KELL 2XYCA 5L4IA 3SBRA 4IL6Z 1WIUA 3CLEL 4QPKA 2CH7A 1J05B 5AAWA 3AVEA 1LJMA 1RL1A 1YUHA 2NUPB 1TQCB 4P59H 4MJJA 1E30A 2QE7G 3ZL4H 1GGBL 1TJHH 2N01B 5C0BD 4AZ8A 4WKXA 4NC1E 5PAZA 1LMKA 3EF7A 4K9EC 4LCWE 5FDYA 5ICUA 4PREB 1G0YR 3IGAC 4F5CE 1TQTA 3DPBB 5L3CA 2VC2H 3DDFA 4WI5A 5JYLA 1MHHB 3HVDA 4NO0D 1WIOA 3RRQA 5KBLA 3RYFB 3ZR6A 3LXAA 5CN3A 4Z8FH 2G5UA 5JQGB 3L2LA 5IJCC 3ZHSA 1FNGB 2VZUA 3WSQH 4ZYKA 1DDTA 3LEYH 3WDJA 4FLQA 3P3NA 4NB7A 5CN1A 1TU2A 1F6LL 4F3FA 2IWKA 4X65O 5EBWB 4CN6A 4MQTB 3B9KC 1X4YA 3TWYA 1AILA 5CBEA 3SZKC 4HUVB 2H45A 1Q0YH 1Y1UA 1MZZA 4MS8C 4S1RL 4O58H 5FOJA 1HXMA 4BZ1L 4L8BA 1MHPL 1R46A 2K45A 4R83A 3M46A 4I7ZC 3IXAB 1DBMH 5DUBA 2UUCO 4M7LH 5BUPA 4Z1VA 1EGJH 1GS8A 2H6PA 1MFDH 1I9IL 3ARGC 4Q9CA 3UAJD 3WNIA 1RPUA 3ABKC 3DJTA 1F6AA 2Z0BA 3D85A 3HMWL 1CE1H 1IGIH 1U93B 3LDBB 1T2JA 4K23L 3NJVA 5CZXC 5I15L 4N0CD 4MNQE 2ZSVB 4G6ML 1LNQA 3NTCH 4ODHL 3RBZA 2OP4L 3AXIA 5E4OA 1WFOA 1HH6B 3QGVA 4OLXH 2YAHA 1OPGH 1DLHB 4K7PH 5ACLA 4JQIL 2QKIC 1CGSL 4J3OF 4P5KA 3VXUE 4GRMA 1MKFA 2HFTA 1T83C 1UD5A 3BAKA 3C5ZD 2R72A 1LP9B 3QHTC 3KPMB 1A7OL 2EACA 4H26B 5DMIH 1QNZL 2X7LB 4GXFA 5KS9B 3S34H 2ZX6A 4Z95H 1BMFG 2F54D 4FFZA 4NQVA 1MG3C 4EEEA 4PTUA 4X9BA 4J42A 1CYWA 5HHQB 2P26A 5KSAC 1B90A 3WFVA 1QSEE 1X7TA 5DA4A 3G5XB 4J1UB 1OAXL 3ZDZB 4FP8L 3MXWL 3I9AA 1NU1H 1IBLO 3EOTL 1II4E 4UDUB 4BUGA 2Y48A 5FYKE 4Y9EA 5JW3L 4FXTA 4RSVA 3TH4T 2EIZA 1EEYA 3IC9A 1ZA6A 2HRPL 4YBQC 4ZOEA 5E51A 3RIFF 4IRJD 1RKRA 2NYYC 5MHSE 3ZDYB 1VFAB 1CN4A 2HCZX 4QHUB 1VFMA 1KCBA 1SYSA 3EOBB 3SDDD 3VNYA 2C9QA 3BKCH 4LCUA 2OV0A 5FCUH 1QVGU 1XWVA 4L37B 3QXVA 4GKSB 4PIBA 1WFUA 4CMHB 3KLLA 1CJYA 2FDBP 5LGKA 5CA3A 2XA8H 2BP0B 1S7SA 2MIZA 3UBXG 4RAUB 3PY9A 4DP1X 4G1EB 2P80A 2W9EH 4A6YA 1P7QA 2P5WD 2APWA 4YSCA 3OLGA 4TSAH 5FYKH 5B39A 3QR2A 5C09B 5HVFB 2CCWA 1EO7A 4JTCB 5EZYA 2FB4L 1BBDH 2WUCH 4HUKB 5E7BA 4F37K 2Z8SA 4YZFF 3TJPA 3NJIA 3HNVH 3CDFA 5IMOB 1V3LA 2R69A 1OTUD 1L6ZA 3G5YB 3W0WA 4AUJA 4WEMB 1AFVH 1NANH 5DRNB 1AYOA 1KCLA 1HEHC 5A7BA 1C5DA 1QUPA 5EO1A 1WISA 2PGGA 3D39D 4XH2B 3U4AA 4KVCH 4YQXL 2I9LB 3AT8A 3HPLA 1MG1A 1M57C 4LCCC 1LO3H 2ED6A 2NXZC 4L3EB 1RUMH 5TF0A 2GI7A 4NCDA 4ZAKD 1BWMA 5A6MA 4JREC 3UGEA 6FABH 2IH3A 4EI5A 5EEZA 1FP5A 1GA2A 2VZ1A 3RIAF 2N3JA 3DOSB 1N70A 1KF9B 3LTVA 2MEJB 5T3ZL 3L16A 1NGZB 2PYJA 1S8DB 1PLGL 1PZAA 4OKVA 3X13A 3ME0B 3ZQXA 3CVIL 1BCCH 1GZQB 5AZ2L 5FFLA 1K2DA 2ZOOA 4JCWA 3KYKH 5EBLA 4EUPH 2Y72A 3DTUB 4I48A 5LBSA 2DI8A 3D50A 1JGDA 4Q6KA 4YDLC 1J0HA 2YFOA 5HVWA 3UO2A 4YXLL 3C5JA 2J20A 1TYJA 2QJDA 3D69A 4IRSC 2EO7A 3CSGA 3WNJA 2CPCA 3QI9B 2VTFA 5FA4B 2A4ZA 3BHPA 3P02A 4FM1A 1YYML 2QVIA 3X1NA 4GG6E 5ES4B 2HPOA 4FD0A 2A73A 3DXAA 4H25B 1ZSDB 4Z3EA 5IGXL 5K9JL 1U2YA 2ATKB 1OCZC 2ROXA 1F13A 1YITV 1QR9A 1ACYL 4HUUA 1P4IH 2IV8A 3UADA 1S7RB 5DYOB 1CDHA 1US6A 4KK5C 4YMPA 1TCRA 4WHTA 3WO4B 4M8VA 1DANT 4HUNB 4G43A 4QXGH 1VAHA 1TQWA 5HGGS 4GW1A 2DL9A 4KK6C 4EPSA 5A2QN 4HGKC 2NY4D 5EULV 1DSFH 1I75A 4L8DB 4JPVL 5DQ9B 3EDFA 1H8NA 2AQQA 4QRPD 3UG5A 1IM9B 2R0KH 3KCYA 4QT5A 3LNHA