3SPJA

Apo inward rectifier potassium channel kir2.2 i223l mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
330
structure length
321
Chain Sequence
NRFVKKNGQCNVEFTNMDMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
molecule keywords Inward-rectifier K+ channel Kir2.2
total genus 82
structure length 321
sequence length 330
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spjA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spjA01
1N9PA 3ASOC 2BOBC 2AHYA 4MTFA 4LP8A 3X2QC 4MTOA 2WLLA 4MVUA 1U4EA 3AGWA 1R3JC 3K6NA 3K0DA 4XDKA 1V54C 4P9PA 4WFFA 5EK0A 2WLHA 3LDDA 5J9PC 1QLEC 3SYPA 2HJFC 3LNMB 3RBZA 1V55C 2QTOA 3STZC 3SYQA 2WLMA 4UUJC 4GX5A 2AHZA 3EFFK 5BZBA 4MVRA 3UKMA 4MSWC 1OCZC 2A79B 3SJQC 2WLLB 4MVZA 2DYSC 2ZD9A 4PA9A 4WFHA 3K0GA 2HVKC 2Q6AA 3AT9A 5EC2C 3AG2C 4P9OA 3T4ZA 2IH3C 2QKSA 4MTGA 3AG1C 3K08A 4PA6A 3ATBA 4RO2A 4PA3A 3SPHA 3ABKC 3K04A 3OR7C 4JTDB 4GX2A 2X6BA 2WLIB 4CBCA 1R3LC 3K06A 2OCCC 4OXSA 4PDMA 2HFEC 1OCCC 4XDLA 4RAIA 2EINC 3VOUA 4DXWA 2E4FA 3AUWB 4MVQA 1LNQA 4HYOA 2X6CA 3GB7C 4MVOA 4LCUC 3RVYA 1K4CC 1ZWIC 2EILC 4PDVA 4X88A 3T2MA 3ASNC 5EBMC 4LBEC 4MW8A 2GIXA 1BL8A 3E8GA 5EBWC 4BW5A 1P7BA 4P2ZA 1S5HC 4XDJA 4G27B 4QNHB 3F7VC 4GX0A 4MVSA 4R6ZA 2Q67A 3T4DA 3HPLC 1XL4A 5EC1C 5KUKA 2A9HA 3ATEA 1U4FA 3FB7C 3LUTB 4MW3A 3RW0A 1J95A 4PA4A 4G28B 4QE7A 3TETA 5EBLC 2ZXWC 2EIMC 4R8CA 3SYOA 3UM7A 4KFMA 2KB1A 2P7TC 3OGCC 2YEVA 2ITDC 2ITCC 3FB8C 3F7YC 2WLNA 4P30A 1M57C 3F5WC 2Q69A 5CBGA 3SPCA 4H33A 4F4LA 2Y69C 3AG3C 4MVMA 4R50A 4HZ3A 3E83A 3E8FA 2DYRC 2A0LA 2HG5C 4X8AA 4EKWA 3FB5C 3SYAA 3ABMC 3KG2A 1G4YB 3E89A 2DWDC 4ZBMA 3R65A 4WFEA 2WLIA 3ATAA 4I9WA 4PDRA 3SPGA 5CBHA 3ZJZA 2WLJA 3LDEA 1OCRC 3SPJA 2DWEC 3FB6C 3STLC 3E86A 4R7CA 4J9ZB 4PA7A 1R3IC 4JTAB 2R9RB 3SYCA 3TCUA 3E8HA 3BEHA 3JYCA 3OUFA 2K1EA 1OCOC 4PDLA 1ORQC 2EIKC 3WG7C 5IY5C 2BOCC 3K03A 1M56C 4JTCB 3IGAC 2NLJC 2HVJC 4TWKA 3SPIA 3ATFA 5KUMA 3ATDA 5B1AC 1K4DC 4RUEA 3LDCA 3AT8A 3OR6C 4QE9A 3ZRSA 3VSQA 1JVMA 2EIJC 3ABLC 2Q68A 3E8BA 4X89A 3RVZA 3T1CA 2WLKA 3AG4C 2H8PC 4MS2A 2JK5C 2IH1C 4GX1A 1XL6A 5B3SC 4H37A 5E1AC 3IFXA 5CBFA 1R3KC 3OUSA 3PJSK 4J9YB 2W0FC 2X6AA 4RUFA 5B1BC 4WFGA 2ATKC 1KKDA
chains in the Genus database with same CATH superfamily
3Q9QA 4LF7O 3ESMA 2DIBA 4IKJA 4BIUA 3VQ1C 2XQYK 3MLUL 1BD2A 4PP1C 3V52L 5GTIZ 2UZYB 4BSVB 1PLGH 2VDMB 4ZSOA 4GKJO 5B4MD 4Z7OE 1WPCA 5FDWA 3MBWB 1V55C 5EFIA 1S4IA 4APQA 4XCEB 5IJVA 3JV6B 4OFDA 4HPYH 5IFAH 4EIBA 4LSRL 4PGDA 2XY1A 5JIHA 4AT6B 1PZ3A 4A2LA 4LF8B 2VJ0A 1WAAF 1Y6KR 3EKCA 4EN3C 1YY8A 3ALPA 4LK4A 1N2RB 4NRYA 2V37A 1ONQA 5IQ9A 2IJHA 2G3MA 2Q5BA 2CLVA 3HZVB 4UNVA 5FO9B 1F11A 5J8OA 2E4FA 5GQBA 4DGIH 4RFEA 3P3PA 5BMFL 1U3HA 4LSQL 1FDLL 1F18A 4M6NL 1IBKO 1IC4H 1Y18B 2E59A 4HF5H 3VFNA 3X13B 1WBXA 1H3VA 1MQKH 3BHBA 3ABZA 2RQ6A 5GGRA 1YYLL 4OCYL 4Q6GA 1QUPA 1YPZF 3FFCA 4P3CL 3LEYH 4PRBB 4BFRA 4JHUA 3M8AA 1NGXA 5HHNA 2C9AA 4C47A 5K1JA 1NC4B 2ENQA 3EADA 4OJYA 3FB7C 3ROOA 3WIHA 1IBFA 4FQHB 3EFOA 4XBEH 4N2MA 4MNQA 2WAMA 1OSZB 2NNXA 4Y5YC 2AI0H 5GSRB 4Z9KB 3KXFE 4N9OB 4IT5A 1EHXA 2OMYA 1FUNA 4P2OB 5TE7H 5KTEL 5DD5L 3AG3C 4C4KO 4CC4C 5CD3B 2QJDA 5I66A 4P5KB 1I82A 1MFUA 3IE9A 4MMZC 1Y7VA 1QR8A 2HJLB 1UH2A 2A5UA 1CU4H 1R6KA 3WNNA 2CQVA 1CU4L 2P4AB 1MI5B 4YLBA 4CDHA 1UA3A 3OKLA 2Q86A 2EDEA 1AQ8A 1RSOB 2R0ZH 3BP5A 4NJ9H 1E27A 2EADA 2OKMA 4IHBA 4W70A 4UM9D 5KYYA 3CFEB 1NCNA 3C08L 4R5XA 2OTJV 4RISH 5HXMA 5DJ8B 3H2QA 5C9JB 1N8RW 3PWUA 5AW2B 3TNNB 1S7TB 4Q6IA 3RYCA 4J42A 4L8SC 1PX3A 4XC3L 2VXSL 4NKDA 4YHOL 4FRWA 3CFKB 4FCAA 3K0YA 4FQPA 2MH4A 2PP7A 1SOXA 1WTGT 1FFPA 1DJZA 2EULA 1CN4A 3WNLA 1NLBL 3AG4C 1OLZA 4G5AA 2UUAB 1FIGH 3ECQA 1P53A 1A5FH 5GS1C 5BS0A 1WWBX 2MJWA 4D9QD 4IMKC 2JKWA 1S7UA 3P0YL 2EZ0D 1AC0A 2ARHA 2JK5A 1KENL 4BFNA 2VW7A 1R1BA 2OXGB 1X7SA 4MTFA 2DQ6A 3V7MA 1DJIA 2YI8A 1S8DB 5D2LE 1EAPA 2WD0A 3FB5A 2QSTA 3Q2CA 1C1EH 4NKQB 5L0QC 3B6SB 1XTMA 1CFVL 2YD7A 4AUUA 3EDJA 4PRHA 5ERWA 4U31A 3EOBA 3MLWL 2CD0A 4I0PD 2F53B 3PQYD 1FJ1A 3U4EB 3ARBB 3ZLQC 3SYQA 1M71B 2AEQL 1SHXA 2D4DA 5EC2B 3FTWA 1FKAO 4TUJA 4BCZA 1KCRL 2DQIL 3MV9D 1HKLL 1MXDA 4MB1A 4B3SO 1B06A 2ZE6A 3P30A 1CD1B 1GOGA 3W0WA 3ZDXB 3ZQWA 2YD9A 2H0PA 4HJJL 5D6DC 5ADOL 1GCFA 5GS2H 1K92A 1DO6A 3EO9L 5J1AB 2V2TA 1SDAB 5CD5D 2OI9B 4M7KL 2GJ6B 2HAZA 5C0GA 1R6NA 4NQXB 3VSTA 1YAIA 1EERB 3O3AA 4N23A 5T3XE 3GHBH 5JW4Q 3BP7A 4GKKB 1WFMA 1DQDL 3BGMA 4J2XA 4DH2A 2NR6D 3ME0B 2VDPB 4X6CA 2WMPB 1T03L 4FFBB 1JZJA 2KHAA 1AIZA 2XZCH 3Q2WA 2WGNB 2VQFB 4D8PA 1K85A 1KJVB 1S78C 2A6IA 2IJ0C 2IG2H 3QPKA 4X0KB 5IJKC 2VR9A 5AB2A 3QJHB 4K23L 5DUBB 25C8L 3P9MA 1GHFL 1LQSR 4PSPA 3JD3A 1XR9B 5TJWK 3RY4A 1EZVY 2IXQB 1TITA 4MB3A 2BNQA 3KG5A 1JIBA 3QI9A 4PCSA 1X6NA 5TDNA 2G60H 3DRQB 3MLZH 1IXBA 4KH9A 3U10A 4XPFL 2NY2C 1AO7E 4OIAA 5KSVB 4U6YB 1W72B 4JPIA 1JDDA 3GSNB 3V0FA 3QG5A 1JTTA 4L2LA 3FRUB 1O7SA 2QTSA 4NXKA 3G80A 2J6EL 5FYJH 4JRWA 4R90L 1E4KA 4GMSH 3GI9L 3QZPA 5ES4B 4J6RL 4QHKI 2AW2A 4AQ8C 3IJEA 3M1OA 1HWHB 3ZZ1A 1TG8A 5GRJH 1MAML 1Q0XH 4PJ9D 5JIKA 3RGVA 1N6QL 4EIUA 1BVLB 1OW0A 3U1QA 2PLTA 4MAYD 2FEEI 4GFTB 4ABWA 2VN6A 1S5JA 3BP6B 2BSED 3LKOA 4QRTB 3PJLA 3QUZD 5I6LA 3O2WL 2YPKB 1A1MA 2J3SA 2WXJA 3EFDH 4KTDH 5I71B 2NLJC 3L4YA 2FGZA 3HE7D 2XKUA 4L8DB 3DXRB 4JAVA 1GOFA 1MFAH 2R0LH 4QJ3B 3US1A 1NM4A 4PJIE 3TA3B 3TJHD 4CSSA 2EIJC 2AAAA 2PPDA 5C0RH 1KACB 1T1ZB 2VLJD 3EH4B 3U82B 5F6IB 1MABG 1U3HC 3QFDA 4UTBH 3R4RA 5HI5D 1QFWI 1XAUA 3DX1A 4M93C 1RZ7H 2YK1H 3KXFA 3B37A 1NCTA 2VUYA 3FUMA 3LQAL 2RJMA 3L9RA 2DB8A 4NP4L 4P5TC 5GRUL 5F9OH 4EXPX 1NMAH 3GSNA 5AVQB 2FQGA 1MCIA 3LRSA 1Y18A 4B9JA 2EDOA 4XP9H 3L1FA 4XN4A 5BZWA 1UC6A 3VXUB 3FO9B 1FZMB 2VQ4A 2OTWA 3JWOL 3OKYA 4ODXB 4K0OA 1HNWB 3GK8L 3QB7C 1MHPL 2D7NA 3M1BB 2CLZB 4YVNA 5T3ZH 4Q6KA 5EOCJ 5DD6B 1BIHA 5F6HJ 3LNMB 2APBA 3RYHB 3FT0A 4NR1A 4R7XA 3VGGA 4HD5A 1ZS8B 2AGJH 1J5EB 2ZXAA 4LE8A 3BAXA 5EMYA 1LEGB 2KC0A 5EYPA 1HE7A 1TJGH 4CADB 5GTHZ 5DD3L 4YOKA 1HE8A 1IBMO 4YFLI 4PVLA 4WI4A 1OVZA 5BPPA 1T03H 3BEVA 2GC7C 1N18A 4MQ7B 2QWNB 1DANU 3KBFA 4I50A 5MEND 3DO7B 2FBRA 2Z91B 2YK1L 5JORB 2P28B 3KJ4B 2HT3D 5CA3A 1DE4B 3E8VA 4LCUC 3UXFA 1HHJA 2DYSB 3GYRA 5LYJB 4X7SL 1V05A 2WVVB 4MB4A 2NW3A 3T6QC 1PX4A 3BKYH 1O6SB 2DBLH 5I16B 3O3DB 4OLVH 4P23B 4FLXA 5F9WB 5TF1H 1Z3RA 5I0WA 1HEJC 4B9ZA 1KF9B 3V5HA 2Y06H 3Q1SH 1T0MB 4FQJL 2DEYX 3BUBA 3LKPB 1ZTEA 4GXUM 4YHLH 4Z7VA 1OAKH 3ULSB 4IRJA 3GXMA 1F6LL 3HUJA 4F7PB 2OV0A 3P0VL 2WXOA 3SOBH 2WLNA 4JO3L 2WZPD 2RCVA 2MPAL 3UAEA 5LAXB 2BW4A 3DMMA 4K55A 1CZ8H 3S36X 2NXYC 4HXAH 2LGQA 1I85A 4JPKH 4GG6F 3N2GA 3T1YB 3NGBB 4MXQD 3GMMA 2M26A 2FJFB 2NTFB 1COBA 1RK0A 2QR0A 4WKZB 2ZNIA 1SY6L 4L5FE 4RMRA 2B9AA 4XP5L 3WLWD 2IBZX 1NBYB 4FQ1H 3NQIA 5LCVH 2DQCH 5F9AC 4L23A 4NB7A 3WSQL 3RGVD 2G0LA 2IBZH 1OL0A 1QFUL 3T2LA 2ATAA 4K7PL 5HGAB 5ID0B 5C0AD 1ZGLB 4U1KB 1H8OA 1Y1DA 1KXVA 5CA0A 2YAOA 3C5ZA 5HHMD 2E9GA 4JI0B 1DJXA 3MNVA 3ORJA 4WSKA 1QCEA 2ZP0T 2IV8A 3Q3GA 5AZEL 1MCRA 4WI6A 1MW1A 2QKIA 2ZCLH 5EHFA 2HT4C 1CG9B 3EYVA 2IM9A 3BD4A 5KLVH 4U1LA 2VZ1A 3DX9A 32C2A 3GIZH 4PTUA 4RMBA 3QZWA 1WCQA 4JI5O 5LMUB 3ZHUA 1EFXA 2NW2B 3IPFA 3AITA 2AI0L 4J11A 5B3JE 2CDGA 4YFDB 5JJNB 5A2LH 4LF9B 1EN5A 4WW1A 5I73C 2HTLC 5CEYB 4XTRD 3P77B 3H9HA 1EXHA 3HN3A 3KYNA 4LNVA 2ZINA 2WTOA 3JWOH 1NBQA 2CPUA 2HG5A 4OKVB 3WSQH 1CTOA 4DZ8B 2H5UA 1ZLWK 4LVNB 2XLLA 2ADQB 5F1NA 3B83A 3UGUA 1KWGA 4GLRH 2GV9A 5IVXF 4ZW5A 2OCCB 5L88L 4IS6A 3VXMA 1C16B 2X4RB 4M8QA 5D1ZB 2BRQA 4WW2B 3ZYOA 1G1XB 4AVKA 2FX9L 1KYDA 3LNGA 4LHUA 3AWEA 2WLIB 1R3LC 3IDJA 3NDZE 2B1HH 4FE9A 1ROWA 4ALAC 3OAZK 3VMNA 1KWKA 1UXLA 1MCPL 3D85B 3IBEA 4OI7A 1FXKA 3CRQA 2CO6A 3AT0A 4XMXA 3V0HA 4LPUA 2X89A 5ESAB 3J27A 3M7OA 5DJXB 4JI6O 5DMKB 1NCAH 2KKQA 1A4AA 1XUQA 1CURA 2Q67A 3ML8A 4IBYA 3HTLX 5CZVL 3X12A 3QUXD 4ICXA 2IPKA 2P5WE 2DWDB 4IOSD 4Z7VE 3UTTD 3MV9B 4BQ9A 5CEZL 5IT2L 2I07A 4HMDA 3GBLA 3W11D 1HNXO 3ZKXB 3BUQA 3D4CA 1F2QA 4PV9A 5D2NA 3U9WA 4D0CB 4KXDA 2BMKB 2Z0UA 4NKMB 5E95B 2WB1A 4POZC 4YHZL 3LRMA 2HSIA 2GTQA 4Q4EA 5EUKA 3O6FD 3VD1A 3HZMA 3GMOA 2N74A 3WB2A 2ITCA 6TAAA 5AW7B 3FN3A 1OAUL 1M57B 2VXUL 4PI0A 4LCCA 3FQ1A 4S1RH 1KLGA 4OCWL 5ITZB 4UI2A 3U0WL 4AGMA 5EC2A 5F72S 4ODVL 5IB3A 3NESA 1UXSB 2BY2A 3BZFA 2PYEB 3B4SA 2HYMA 4TS6A 4KY1H 1HI6B 4KDTA 3LNFA 1L9RA 4YFLF 3BDXA 4IIJA 1NMBL 2K1EA 2JXMB 5PAZA 3AWGA 4IU2B 4NHCH 5F0MB 3MLXL 1IJNA 3FO0L 4PRNB 5AVTB 4PJ8A 2AZ2A 4U6VL 3FFCD 2AHIA 1OGTA 4J27A 5KSBA 2CA3A 4LF6B 5D8JH 2VIRB 2YOCA 1TGOA 2GJZB 3DKHA 3KH4A 4G83A 1MRDL 4DCQB 1ACXA 2YD0A 4X9GA 5I6KA 1SXSA 3ZX1A 43CAB 3P9MB 5IYDO 4HA1A 2ZP9A 4HJ0D 3GMOB 4RWYL 2WQUA 2V7QG 3RY5A 3VXSE 3QZMA 3AAZB 3NAAH 4IBTA 4NLAA 3G5VA 1I9RH 2ADIB 5I1LA 4P46A 3ME0A 2DI8A 3KPSE 2QQLL 4K3AA 1PJ9A 2WCSA 5I76B 3QG7H 4PR5B 2E7CA 2YA1A 4W9JC 1Q1PA 2FL4A 5IHBA 2RD0A 2H41A 2QTEA 1U8NB 2DLEA 3UROR 4MD4B 4TV8B 4MNGE 1G9HA 1Q9OA 1DSYA 1ZV2A 4J8QA 4E41E 2VUOA 2YPVL 2BY1A 4JRXE 3D2UB 1U8LA 1T4KB 4KQ4H 1FZOB 2D2OA 4RH4A 4DV2O 1SN5A 5DZNA 1FNHA 3GJFA 5E1GA 2GYSA 4AGLA 3K59A 4GW1B 4W81A 1W15A 3R7RA 2Z31C 4X65O 1HYSC 1HNYA 1OOWA 4GQ9H 1W0VA 5CSGA 3VW3L 3CHRA 3IJ9A 3L48A 1G7QB 3DJZA 2XA8H 4LSTL 4MJ5A 2XTLA 5H94B 1EIBA 1WIPA 1MIML 2WKGA 1VEMA 2X5PA 5T3ZD 2VQ1A 4EZMA 5KJRL 5KS9B 1XZ0B 1J0JA 2JQAA 5DGQA 1KXTB 3WGUB 2XG4A 1KYFA 4QJFB 2G9HA 5T1DL 3WY4A 5T1DH 4B0MM 4MVSA 3KLLA 2IPTL 1T04A 2CHWA 2ADYA 1ESOA 1QG3A 3CZEA 1NCBH 2ZF9A 4HC1L 1FZJB 1H8SA 1N10A 3VM5A 4AQ1B 4D94A 3APQA 4QHMA 2DQFB 4IMKA 1YMMB 4I18C 1OSPL 4X1YA 1TKWB 3P0YH 2GHWB 2CUHA 3QPQC 3CP1A 4F1SA 1A9BB 1GS7A 4XX1E 3LN5B 4R8WL 4WFEA 2QM7A 3JWNE 5ANHA 3G6DL 4DP1X 3S9DB 4DP6X 4LFAB 3U83A 4NIYE 1OOAA 3WNJA 1ZE3H 3TS8A 3SZ6A 5J4MA 1L3NA 3MFFB 2RGSA 4EEEA 5T1KA 5LP6C 3F83A 4X4XB 2IAMA 4JG1H 4WWKD 3KWWA 4NYLA 4JI1O 3X3FL 4MVBD 1L8DA 3ZSSA 5HYEA 1KCRH 2DQIH 4BKSC 3WG7C 2ESVB 4QTFA 4WO4D 4YXKH 4S1QL 3NT0A 1SRDA 4I0PB 5C08B 4Z2WA 1R5IA 3MRPA 3LQMA 5TQ2H 1FORL 3H0TA 4M9OA 3CZJA 4JFYA 4XGZB 4P9HC 3ASOB 1ZT7B 5E9NA 4JPRA 5C0CB 2QL1A 3DI2B 2HKHL 4GRWF 4PJAF 2XXMB 4WFHD 2BE3A 4AQ1A 4IW4C 4JHWH 1OARL 3U79A 3QJTB 4LIQL 2OT5A 3BWAB 4GRWE 2FAUA 1NGXB 4Z0XB 3HCVA 3G7TA 5DYOA 3RY6A 4JUSA 2YXVA 1CD9B 2X2YA 3GMQB 5E99L 5M94B 2CMRH 3FCTA 4UDTB 5DMGC 1JTOA 3S3JA 3E3QE 3H1ZA 4DV0B 3ULSA 3IPEA 3CIQA 5L6YH 3B6SA 3SE8H 5JXEA 2Z92A 1MIEL 4P04A 1A0QH 1QEWA 2V9TA 2KPWA 3F7QA 4FS0A 5A7EA 2HJFC 2CK0L 2YN5A 5DEGB 1I8UA 4HJTA 4XAKD 3VFSB 1CUOA 1P7QD 4MVRA 1QASA 3UGXA 1VSCA 3C3SA 3FYIB 1BQLH 4GRMB 2FCBA 2Z8SA 4X20B 1A22B 1U58B 5IMMB 3T0ED 4HWBH 1YEKH 4LB8A 3KWUA 4JFDA 3IU4H 5AOMA 3IU4L 2YMTA 4GX2A 4OXSA 1BOGA 5DJCB 1WJ3A 3QEUB 5EBMA 5IEHA 2AC0A 2VAAA 4ZUVB 5CILL 2D3LA 2F18A 5LGJA 4N0CD 3T2NH 3T2MA 4OGQC 1X9QA 2OR9H 4DP8X 2J21A 3EH3B 5E8PB 2CRYA 1JZ2A 1WCBB 1RPKA 3C75A 3BDYL 1QSVA 2H32A 3F7VC 3QDHA 1LEGA 1ULVA 4OCSL 1JQ0A 1MG3C 4JO1L 4A2FA 2CGYA 4DEPC 3FTZA 4FFTA 5FYKH 3W9DB 1BX2A 3BESR 1XF5B 1A7QH 4OQ1A 2OTWB 3JT0A 1RJZA 4F7PA 1RKRA 1VQMV 2JTYA 4HK0A 2ITDC 4UXNA 5JJJB 4U7SA 5BUGA 1MFBL 3DYPA 1NH2B 4FIPC 2V6HA 4IIZA 4PTTB 3ZTJG 4C55A 3CU7A 4GS7B 5DVMA 1M56B 3L5IA 3QRFM 4XB7A 3F5WB 4CC0A 3QDJD 3R19A 3RVVC 3RVXC 1DANT 3GS0A 5AW9B 5I30L 4EN2A 1KTDB 4IYIA 3DIVA 4DP7X 4DPBX 3J81N 4K8RD 4P0DA 1JJ2U 3A6CL 4H88H 3NJVA 1MCNA 4KJWC 2F4VO 2AKRB 4NZJA 3KKYA 1IAOB 3Q43A 2R0WL 3UTTB 3ECWA 3RAJL 5E5RB 1G7MB 5E8EB 4NLHA 2OW7A 3H3KA 4G6AC 4ABUA 4HEPA 1DBKL 2E5LB 3GJFK 1G7JB 3V6BR 4HBCL 3BAYA 4LGSB 4HHGA 3O8XA 4BSWA 4YJ3A 3K72A 1VEPA 3ZX6A 2QBWA 3HC4H 4BINA 5D2NB 4D0CA 1CDBA 4L37A 5EU6E 1DVFB 2B5UA 5TH2B 1N7MH 1AZZC 4AEHL 1G9NL 3GEFA 3HC0B 4BKTC 1CDGA 1QI3A 2XZQH 3JD1A 2NYKA 5DS1A 1AE6H 5I1KH 2NQ3A 2FB4L 3D48R 1RULH 3I6GA 2A0LC 4MBOA 3WD5L 2JH2A 5T1LD 4NT6B 2W0FB 3BI9X 1NH6A 3F58H 2EE6A 3FT1A 5IB3B 2D3OW 1C5DA 4IRJC 2QJ1A 2WM0A 3CHOA 3HRZB 4L0PB 2A1WH 4LGPB 1SHWA 5KN5A 4OF5A 1AGEA 1LD9B 5CGTA 5EZLB 3POCA 4LLQB 2XACC 2VB5A 3TBVA 1AQKH 1OO2A 1QSEA 4TV3A 1RZIA 4E4EA 3LXUX 4X0KA 4NHCL 4XMUA 4AITA 3UJJH 1K5QA 3SJBC 3MBXL 5FKPA 2QPSA 4X64B 3T65A 3LSSA 2YEQA 4EE2A 3JTTB 3SQBB 3II3A 1HH9A 2XAQA 3T4ZA 3ZMZA 3LN9A 2JSFA 4LLYA 3EDDA 3SQOL 1RLBA 3LKSA 4FQXB 1HR0O 4LLVB 4WF7A 4JZGA 3NEOA 3DGCR 3QSKB 5GXBB 1D5MA 1Y07A 4DGVL 2WXMA 4A63A 1YNTF 2PN5A 3K4AA 3SDCA 2VLME 3RVYA 3CC2V 2GFBB 3MRLA 4M7LL 2K3HA 2X42A 4M6MH 3I3DA 4BH7B 3QHZL 2BY0A 3FUEA 5E94B 1VB9A 1DGSA 5JYMA 1LGVA 1GZPB 2W91A 4GJTB 3B8YA 1JGIA 5EBLA 2QQLH 3RWIB 3RZCA 3KPLA 2R29A 1QLRA 5CWSA 3SY0A 3B56A 4IS6B 5CBAA 2YXYA 4YXWG 3SCMA 5FK9A 5D7LB 4U3SB 5SWZB 1NS1A 3WAKA 2YUAA 4Z78A 1BP3B 5I1HL 3FB7B 2YD2A 3T0EB 2CBTA 4TV8A 3KS0J 3H7BA 5D6CA 5F7DA 15C8H 1RJYB 2EIKB 2EH8L 4RQFA 4DUYO 1XDCA 1NANI 1ZSDB 4P2OC 3CDCA 5J3HD 5DS8A 1PDKB 3RA7H 5DC2A 3QHFH 1UZGA 5BOJA 4M48H 1BFTA 5DUMH 1NUGA 3MNZA 1TU2A 4UAOC 5IFJA 4PA7A 2ZX9A 1K8IA 4UT6L 5D1ZA 3JATA 1V7NH 5HHXL 3T71A 3V4LA 4XT1C 1BXUA 1F41A 2BNQD 2G3XA 5DJZA 5FECB 3EGDB 4ENED 3UDWA 1PSKH 4BUHA 1GKOA 5EU6A 3H01A 5IMKB 4AY0A 4QD2E 5FAAA 2AXJA 1IO4C 3ZRCC 2ATPB 3E8UL 3BD5A 5F8QC 3G5ZB 3IDYB 1X5JA 3RNKA 4IU3A 4LCYA 4LPCA 4DUXA 5CBFA 3FMGL 3QDJB 3CX2A 1B4RA 1INEH 3L9EA 3G5XB 1MJJB 4RA3A 5C0NC 1XGPA 3SGJA 3PWPA 4M9PA 4FABL 4JRYB 4NHUA 3MV8B 4LP8A 3DPBB 4LCWB 5GS1B 1UENA 1UZ8B 2ZIOA 4RBPK 3COOA 4RMSA 1FE8H 1XV8A 1HSAB 2IH9A 2GEEA 2HX9A 3FSAA 3M07A 3ZZLA 1UCTA 4FJYA 4JI4O 1WISA 4HUUB 4LSPL 2UVEA 2P5OA 3CVBA 3APOA 2G9HB 4FMFA 1MLCB 3EYOA 4GO9A 4FFKA 1KJ2B 4E5XA 1U8IA 3TGXA 4OCRL 1S5IL 2EJ1A 2AJYH 2JF1A 1SEQH 1A1OA 1T22B 1WAEA 3BSZL 5EC2C 2M1KA 1AJNA 3LPFA 4ONGL 5FW8A 2B77A 4WVRA 3RWCA 2QSAA 4CDGC 2XWXA 4NJAL 4JY6B 4ALAH 2FUQA 4PA3A 3O6FB 4HEPG 4YBHA 4LKXB 4P2QA 2PXYA 3I6LE 3KGTA 4JGJA 1P6AB 1XH1A 1N3NB 3R8QA 1S77D 3EF7A 1WC7B 5ESQA 5FO8B 2OMUA 3F12B 5TF1L 4CMMA 3S5YA 2BJMH 5GZOA 4JI3O 5C0CA 1KBWA 3MXWL 4PYHA 2XZCL 2X0VA 1U6AL 1OCWL 2B3IA 1GM9A 1GYCA 3ARXA 4QYOB 3B9KD 1RZGA 3HE7C 4V1DB 3UTZB 3VXPA 3ABMB 1WBZA 4F7CB 3O41A 3KWWB 5CNHA 3WHE0 1TT6A 2O4EA 4FLQA 3LUTB 1HHKA 3O3BA 1E28B 5B3NA 4X83A 3S5LB 5H9CA 2AJ3B 5IHLB 5BZDB 4UM8A 1WPXA 2W8CA 2NSMA 3QFDB 4GAGH 5I1LB 4ZT1A 4QPEA 4M03A 1FQ9C 2VR5A 2DZEA 2EDTA 4ODTL 1TEFA 1WO2A 4GRMA 3OMNB 4OCRH 4W68A 1S5HB 2A0LA 1YECH 3HMWL 5AW3B 3VO0A 2XY2A 3RVUD 3D9AL 4HIPA 5DD1L 1G4YB 2AK1H 2QZ5A 3FOMA 4HIEA 4D9RD 4FI7A 1G6VK 3BA9A 4DR3O 2IBBA 1FNLA 2A4EA 2YGPA 5E4IA 1TQWA 4A6YA 4WEBL 2JLLA 4DV5O 5D7SH 1QLEL 4PJ0Z 1SQXH 1QSFB 5BQDA 3MXWH 2O26U 1E5CA 1MNNA 2PYJA 2LLLA 4QHNA 1FDLH 2EEXA 4M6NH 5H94A 2YA0A 1NZRA 3D6GA 3GKWH 3H85A 2VQ1B 4FN0A 4P2AA 2NSXA 5B39G 1IDSA 2NLJB 4UIMB 2AZUA 2BWIA 5F9JB 4BK5A 3HVDA 2F1EA 1XNQB 4YHKL 4PIRF 3SGKA 1W8EA 1MH5B 3TPUA 4OM1H 1B6QA 4J9YB 5F6IC 4IMLB 5MENB 1OT1A 3IWVA 4X9QA 2ZKOA 3UQ8A 4NB5A 4UQBA 1BECA 1EO8H 1RFDL 3V0EA 2OR7A 1NPNA 1PD0A 3HS0C 3VD7A 5B8CA 4KH2A 5D1QC 1Q82W 5FW7A 4J7JA 5DRXB 4UF7C 2DPKA 5I76A 5BRZE 1UWXK 4NUPA 4LLYB 1O6TA 2FSDA 1VMGA 4RAVA 3EVKA 4OPAA 4HKZB 5DFVC 1A1NB 1AKJD 1E5AA 3FU7B 1XBLA 1TQVA 3FN9A 5DMKA 2E7LA 2VZVA 4HS3B 5F7UA 5SWZE 5FO2A 3BH9A 4TYUA 2FNWA 3N43F 2Q6AA 3S48A 2MSPA 1YNKH 4HGWA 5FGBC 1SVBA 3BP4A 4K0KB 1TZHA 3QI9B 3AS2A 5AAMA 3REWA 5K1NA 2UYLB 7PCYA 1JHLH 4N8CH 4GKKO 4X98A 1BBJA 3RWGA 1XF1A 5EO1A 4JRYD 4D7BA 4YBLB 4UU9B 4G42A 1NFIB 4HYOA 1BGXH 1N59B 5E2VH 4E41D 1WB7A 3OD3A 5DJYB 3WEBA 1DVQA 3ARBD 4UINH 4LCUB 5EZIL 3IJYA 1GGCL 1ZIBA 3C6LA 4OV6F 4AIXA 5BUPA 3S34H 4JI2B 3QF7A 1N7ML 2V2WA 3OGCB 5DRWA 5CLYA 4Y1AE 3L95B 4FABH 2X0WA 2UXCO 4BQBA 3EJYC 3W56A 4Z7NE 1B3QA 1NLDL 1J1XL 3HUJF 2D7PA 3PPEA 4O5LL 3GINA 5AOZA 4AYSA 4LPXA 1CIUA 4U3XA 1AGCB 5C09D 1KY6A 3ARFC 2YHGA 3MXVH 3H55A 4EKWA 2FIKA 4YHPA 3SYAA 2CKNA 1ZE3C 5JXEC 1X5YA 1QA9A 4RRPM 4U33A 4A55A 2NX5A 3BMWA 3BQVA 3T3MB 2P8PB 4WNQB 1CB4A 4OV5A 2ZUQB 1QQCA 4B3RO 4HPYL 2R8SL 3SO3B 5BNXD 3TYGL 3BWUC 4IHJB 3HHRB 3A0OA 3SDXE 4HIXH 4W9LC 3X1EA 5AYUL 1O7DE 4KKRA 2G9KA 4M6ML 4AGPA 3MV11 3RIFF 4GUPB 4QAMB 1CXEA 3OKDB 1S76D 1ZSHA 5T33H 3D3VB 4P2RA 3TJEL 2I7OA 1IX2A 3CVHH 2BCKA 1MCOH 1XGQA 1CLYL 1DSFH 3P2DA 3SY0B 3AXLA 1CE6A 2Z1KA 4B60A 1RJLA 1T7WA 2H32B 3W7SA 4CS3A 2IH1C 3I3BA 3WNOA 3B2UD 1KTDA 5CA1A 2NUPB 1YZBA 3PHQA 3WO4C 4DZBB 4YC2B 2N05A 1O7VA 3GTTA 2A77H 1DUYB 3CDGB 4P4KB 3WHE1 3E3QC 5BV7B 3C5SB 3T8MA 4X62O 3GXUB 4IHOA 1BAGA 1EJFA 2K78A 5CM1A 2C7UB 1TZGH 4UT7L 5E5LA 4XBPA 3U30C 4MJ4A 4R0LC 4DP0X 3ZHTA 4YPJA 3DBSA 1H5BB 1XGRB 4G6KL 3BA8A 1P49A 4LRNL 5KOMC 5EU4A 2FR4A 1Z6JT 2HFFA 4A68A 4TN9A 4XAWL 5TE4L 4ORGA 5D6DA 3I75A 3DI3B 3KR3H 4O4IA 2F19L 1IVSA 5ESVB 5HVWA 3H3PL 5HHQB 5I73B 2ZNWA 5IVNA 1YMME 3OHXC 1E43A 1IRAY 1IB5A 2AKRA 3CSBA 3H2WA 4AENA 1COWG 1R73A 1N19A 2JJVA 1P7KB 2XWCA 4NJ9L 3VFGH 5I0DA 4Z8FH 2DN9A 3E22A 4LVNC 1K97A 2FGWL 5SWQA 3HPLB 4XAKE 4UV4H 2X6BA 2QT6A 2QEJA 4XBGA 2OCCC 3QEUA 3O6LH 3OB8A 1MVFA 1F3DJ 3CCMV 1JNLH 4JG0L 1NVPB 5B38G 3MO1B 4WW2C 4ZX4A 4I9WE 1JZHA 4PJ9A 1N5AB 1QNIA 4OJFL 3HG0A 3GBMH 3VBBA 4ZMXA 2JKNA 2BIQA 1AI1L 2W07A 1HWYA 4WUUA 1BJMA 2NNFA 4RLDA 5KVEE 1OB0A 2IPUG 4PW3A 3NCEB 3U0ZA 1IAMA 1KTCA 3P9LA 2N7BA 5GGVL 1K8IB 2IC2A 3TTYA 2K6ZA 4JI1B 3KJ6H 1J11A 4JQIL 3QCUH 4UNTA 1BZKA 2DMHA 1H2MA 2ENSA 3Q5YA 2A06H 3VTAA 4WHDA 4BR6A 5B3JF 1Q4NX 4HKBB 2FJSA 1GGCH 2P48B 4MDIB 3WS6C 2I85A 4ABMA 1T83A 3ZKXC 4D9LH 4R50A 4DAGL 2GJPA 3W0WE 3WKNA 2E75B 2IBZY 2X2JA 4FL4C 2WY3B 4RX4D 3BAKA 4I3RL 4Y4HD 1KFGA 3VGAB 4FKHA 3EGSB 4NTYA 3VB8A 4OF3A 1SZNA 4HW6A 5I1GL 4LVOC 4C56E 3A4EA 3FB6C 4ETQB 2CH7A 1IEBB 4J9ZB 3V6ZB 4H26A 3KYOB 2ZYSA 2ZXDA 2WQVA 4J2QA 4B3EA 4R4BB 2UWEA 4XCNA 3MCLL 5BRZB 4R84A 1XDTT 2QQQA 3ZMNA 2X38A 2H26B 3D33A 1ZTMA 4JAAA 5FNVA 2ZOUA 4ANKA 2COVD 3O0RH 2P45B 3H9SB 4IRSD 1DDTA 4N90D 1T0OA 1JMKC 2COQA 2UXVA 1T3FA 4GRLC 2JJSA 1JUFB 1LEKA 1W6LA 4NAMA 4TSBL 5HDBF 1BXXA 4L3FA 1CO1A 1NGWA 1ZLVK 4O9HL 3OR6A 2OK0L 3F2LA 4FGMA 5I24A 1OHHG 2N7SA 5A43C 1XBRA 4PCTA 5AWNH 1KCWA 2ZJSL 1XF4A 2C1PA 5E8NB 5F6HI 4K8XA 3L2LA 1OE3A 1Z2KA 4K7PY 4F2EA 2B59B 2J44A 2K0RA 4PLJD 2B14A 4DKAA 5CEXA 1P5VA 2J1KA 3IDMA 5FLVA 5ESQB 5FO8A 5KHIA 4N6RA 2Q6WA 5I6OA 3QG7L 1PLGL 1SQPH 4Y4KA 1TVDA 2VDMH 4HWZB 5KAQF 5F0JB 4O02B 2JJWA 3CH1A 3VRJA 2B4CC 1QFHA 2YEZA 4Y2DC 4XNUL 2QPUA 3VU1A 4O58L 5KG9B 3OC5A 2XNDG 3D3VE 4E42A 1F3DH 1I9IH 1AOHA 1GS6X 3WEXB 3IGKA 1ZMYA 5DFTA 3O4LD 2HR3A 1IAIH 2LO1A 2BZDA 3JWDC 3LNEA 3MJ9H 4JDZB 5FV1L 5L2JB 4E2OA 3A8TA 1GKEA 1A6TB 1NTMH 2CR0A 5B1NA 3SPHA 1YJNV 1SN2A 5IWLC 1ZV9A 3O0LA 5EZJB 4WNQA 2QE7G 4GAYA 5AVZB 1T0NB 4PRPE 4G3YH 1G7PB 1G7JA 1XR8B 5E0FA 1IARB 1JWSA 1RCYA 1SXZA 2DLFL 3DV4B 2EYSB 3ZE2F 1X5AA 4UTAH 4RESB 3CRCA 5EORH 2B1IA 3ULUH 4Y2OB 1JFFA 4QXVA 1JNLL 4JG0H 4ZO6A 1E3ZA 2A9HA 3IAGC 5E1HB 1DL7H 4OM1L 1C5CH 1L7IL 4I8DA 1T5XA 4QHUA 5DMIL 2Y6SC 4G9FD 5IV2A 3TXQA 3BWZA 1UB6A 2IOMA 1AGBA 5TF0A 4XVJL 4G1EA 3U2IA 1GOHA 4PV8A 4CADA 1Q5OA 2XTJB 2XXGA 1N32O 1LQBC 3QYNA 1NCCL 3GBNH 2MQ3A 4OD1H 2YO3A 3BSHA 3ZUNC 3O4LA 1MA1A 1AGEB 3DX7B 5EZLA 5GGUB 5GISH 3QXDB 4WAFA 4FJCC 1ZLUK 4JO4H 1TVKA 4P9HH 3QDGD 2MKWA 1YJ9V 3CFUA 1IKNA 1T21A 4K07A 1M7IB 3HB3B 3MRGA 1ROCA 1Q8MA 2CGRH 4M7JH 5AAWA 1HHHA 3FCGA 4JE0A 4ADIA 1U42A 3OT7A 3UO2A 1KB5L 5IW1B 2MWCA 5JHLH 4QRUB 3EGXB 4NQDE 2H8PA 5EIIB 5ISZB 2Q7NA 4HCFA 4XNZC 1OPOA 4QO1B 4MCYA 2Z65C 3ZTCC 5IT9N 1JDCA 1MFDH 4TSCH 2VH5H 3VWKA 1UB6B 2APXA 2OJEB 2R69L 3O3AB 3VXQA 4KXAA 1U33A 3BP7B 3HBPA 2MK3A 3S88H 1A65A 5TGBA 4W1TA 2EC9U 4XNYH 2QVTA 3D12B 1TZHB 3KEDA 4KVCH 4PBVC 5JQGB 5K9OA 3N2KB 5H8DA 2JGUA 3GPSA 1BFVL 5DHXB 4GMTH 3VXTB 4YHZH 1MFCL 1KJ2L 4CZZA 1HSAA 1F1GA 4YHYB 2D9CA 3WXVH 4Z3IA 3F64A 4KPHL 3OJ2C 2R8SH 4NZTL 2F53A 1H8EG 3H2PA 1FG2B 4N3UA 3ILEA 1FF5A 1T89A 1W0JG 5IHHA 1YUHB 35C8H 3EJZD 4QUOA 2GSGA 3MMEB 2I69A 1B0IA 1XIWC 4EI0A 2HJFB 4N0UB 3O8XD 4XP1L 4PTTA 3STZA 1FFOB 1AY1L 4QTIL 4U6YA 3TJPA 1MW0A 1SF9A 1UOVA 4BE6A 2CPCA 5T1JA 3O2DH 2EINB 1A47A 1NGZA 5I75B 5CZXC 5C07B 2WW8A 2ZWSA 5M7QA 4AVHA 1KLGB 1JFQL 1N34B 2N4IA 4HKJA 4L4TD 4U6VH 3P73B 4NERA 1V9PA 3P4LA 4NQDD 3TBCA 1K4CC 5J2TB 1FFPB 1P4UA 4NZRL 1IBBA 1KJVA 4JPVL 5HVGB 5MERB 2ZZUT 2Y7NA 1ZVHA 1G9EA 1DBAH 1THCA 3PNRB 4PD4J 5ITFA 5JNYB 2XAJA 1NCUA 4K8RL 1DVXA 3RWJA 5KHKA 5GS0C 2WAQA 4M4PA 4QCIA 3US9A 2ED8A 5DCCA 3ZL4H 4X4XA 4X1IA 4JHAL 5EIVA 1TZAA 3LZLA 3HRPA 2JELH 3OKKA 4YSCA 3FU3A 4H20H 3W5MA 4H20L 1IURA 2DLHA 1NTKH 2Y5TB 3IK2A 3IDNB 3NEEA 3APDA 4DV7B 5EEUA 4JJHA 4NDMB 3VQYA 1FBIH 1DVFD 4NQCE 4Y7OC 2YRBA 1MFEH 1N59A 5EOQL 3DUUA 2GSIA 4LAQL 3OTOO 4PW4A 2W5PA 5DJAA 2VLLB 5I8EA 1EXUA 4MQXD 3TVMA 2E9BA 1URIA 3GSUA 3A6BH 4GS7C 3G4SV 4JB9H 5IY5B 4PJIB 5GRJL 1JXKA 1A4CA 4UTCA 5C0EA 4R96B 2AABL 4L4VE 3EFOB 2DTSA 4L4TA 3FONA 4TQIA 2WXKA 1IIKA 3MNVB 1TZOA 5K69A 5F7FA 5T5NF 3HNTL 1RUPH 3ALWA 3EJSA 2MOVA 3PQYA 4L9LC 3UJIL 3LSUA 1WAAE 1M05A 4DSYA 1KCSL 1PNLA 3L3IA 4BV1A 1TJHH 5CHNB 3L3KB 4JN2A 1UFGA 3RPIA 2GUYA 2CZNA 3OQRA 4IBVA 1KEML 4YHHO 2B0SH 2I07B 3LKSB 4FQXA 5I1CL 5GSVB 5CCHE 2P5WA 1J0ZA 2VITA 3FBKA 4KVNH 5LKNA 4KVNL 2NW2A 4UTBL 4O4YL 2DQ0A 4FQ2L 3V4PA 3DC6A 3MCG1 1JD9A 1VFAA 5JPNA 2AXWA 3DROA 3P9LB 4KPHH 3CFDB 3ZZSA 4LLAA 5TK4A 3PWUB 3QDGB 2BDNH 1W72L 4MD4A 4PJGE 2LW1A 1S9XA 2CXGA 3N27A 3AS0A 4ABVA 1NEPA 5F2VO 3MRDA 3CTTA 5C92A 1LP9A 5EEXA 1RZPA 4OH2A 4PJHB 2GVYA 2QGBA 5BQ7A 2EXWD 5KJ7E 3IKCB 4M7KH 2AK1L 3QP3A 2P8PA 3DMMC 3K4ZA 3OKMB 1TVBA 4OJDH 4PV1C 3UC0H 5EYPB 3D52A 3B4NA 2QGNA 1I85C 3ESPA 3KPPA 3HRZC 4XMPH 3ZHDA 4XMPL 1CZ8L 1TJGL 4JANA 2Z34A 3LKQB 4LFCO 2B1AH 1TKWA 2NNRA 1AJ7H 1AQMA 1RUML 4OFQA 3CSFA 2QDOA 3X3GL 1QLNA 4I7ZC 2GI0A 2ZG2A 4ZDHB 4TV9A 5FA3A 5JHDE 2BVPB 3U7WL 2W0XA 3L3JA 3O6ML 2C4XA 4NAQA 1DFBL 3U7YH 4B3TO 2DYPA 1T04B 4PJBE 2FD6H 2F0CA 2GKIA 1N4XL 3EJCA 3G6JE 4YGVA 3VQ2C 1H5BA 4QTHB 1JP5A 2QKCA 2X4TA 3DV6A 3RFZC 3KPRA 3ZHSA 1QEXA 1CQKA 1ZK9A 1AZVA 4OVUA 4YHNB 4J7KA 2O61B 4MHHI 4OCXH 2JWYA 5FECA 5D5QA 2Z31D 3DHUA 3TZVD 4I9QA 4LBEA 4Z3FA 1LO5A 1EH9A 2WQRA 4OGXH 1G7LA 1OZTG 1K73W 4L48A 4CMHC 5LMUO 2R4SH 5CZXD 5D7IE 5D1XC 2NUTA 1K3EA 5GGTH 4S2SA 1RUAH 2ALWA 1I3GH 4M1GL 1EZUA 4TLTA 4M1GH 5IEKB 2ZONA 4MXWL 4GIOA 5J6GB 4I3SL 3QUXC 1TO5A 1IE4A 4MNGA 1YG9A 4JASA 2XZAH 4F6RB 3GWOA 4POYA 5MENE 1PQZB 1W0YT 5IJ9A 3ATAA 4I9WA 3NSYA 4IGBD 1A1NA 4Y19D 3C2AH 4R3SB 5KVDH 2BXZA 1BQKA 4O02L 1EZSA 2ZX7A 3OEEG 2P42B 3DSQA 2EH7H 3DARA 3OKNA 2P7TB 4ZS6C 1NUNB 3ZMSA 4MCYB 4UZGA 2OPCA 4B9IA 1YEKL 3Q0HA 3T3PF 3TVMD 4XODA 1OTUC 4MA7H 5B8CB 1DBJH 4L2YA 3NDYE 4UAOB 5KSVA 3KDPB 5HPMB 4O4YH 5JHDD 1VADA 3ATFA 3DX4A 1HAUA 4BZ1A 5IKCB 1T7VA 3OZKA 4WUUD 2JB6B 4NP4H 5GRUH 2P47B 3QC6X 12E8H 1S3JA 3CXHF 1DQML 3VFRB 3N42F 3SE6A 4NZFA 2XC8A 1KIQB 2AJZA 1DR9A 3UP1A 4ZFFA 1QBAA 4KITB 5JH7B 2WBWB 1CFNB 1ZLSL 2ENYA 2WHVA 3B9KC 1A9EB 1F6AA 2YLHA 2ZCKL 4XB8A 3QZWB 1QO3B 3PJSK 3ARGD 3TIDA 3MLRL 4MLIA 5B38A 2RAMA 1LXMA 2DQUH 3C5SA 3V0DA 1N36B 4XOEA 2ZX5A 1F4WL 1NT2B 3BVDB 5CB4A 1M1KW 3JAMN 4BBWA 3A22A 4DO2A 3DJSA 3K6NA 5KMGA 1V54C 3HKBB 4M48L 1X5IA 4WFFA 4A04A 4A6YH 2R0ZL 4AEEA 3OAYK 1CPUA 1T83C 1I3VA 1AHWC 4J6RH 4ODWB 3CFCH 2OMWA 4AQYO 1K5NA 2I60L 3HZ3A 3J7HA 3PWNB 1JV5A 1R3IL 3ZOAA 2EILB 1D2DA 4JFTA 4WFHA 3LZPA 3IGFA 4P9OA 5EUKB 4KROC 4XNAA 5H4ZA 1SZTA 4YO0B 5JHDA 1VACA 2Q0ZX 4WBNB 1MELA 1INDL 3JVFC 4LFHG 1B0WA 1BV8A 3S8GB 4RMTA 3LQZA 4MASA 5DRNA 3MV9A 1U96A 3EGXA 4HIHB 4EKJA 3FU0A 5ADPH 5CA0B 4E9VA 4NM4L 2X40A 1PF3A 4H1LG 3DBXB 2WV3A 5A2KH 2JV6A 5E2UL 3C5JB 5CZKA 3U6RA 5FCUH 1G7IA 3VGBA 4AE0A 3OZ9L 2YEZB 2Q2LA 4JHZA 1DQIA 1G9NH 4JFED 5E4AA 4EI5B 1AZUA 3LS4L 5BOZG 1KBHA 1G1OA 4G6FD 1CC3A 3WN5B 1JI2A 2UY6B 1ZS2A 4TOYL 3RWDB 5K5YA 1O9VA 4J3UA 3IFLH 5AKRA 3HE7B 2VLLA 2UZIH 2IBGA 1Y66A 3IDMB 5BS0D 4NP9A 5MEPA 1QQDA 2F54A 4I4WA 5JDSB 4YGAB 2K6WA 2BTQB 3T0AA 5ADOH 4X8AA 4XO9A 4DF9A 2Q76A 5FEBA 2DW5A 4O4JB 1NPJA 5JUEL 3QQ9D 2Y0PA 2LU3A 4K9JA 4X4KA 1JGLH 1RK1A 3LDEA 3PFUA 2MMXA 4HUVA 1LWRA 4FTVB 1JVLA 4GZRB 2W80C 4HCRA 5CF3A 3B9VA 4PWGA 1DLBA 3F7PC 1U8JA 4ADGA 1EJOH 4PWIA 1UEMA 4WRLA 2OYKA 3ETQA 1MCOL 2ZR2A 3WMSA 1ORQC 4TUUA 4TUKL 5F3BB 2H26A 1P6WA 4P2QE 2OZ4A 2P5WD 3BH9B 1WCBA 3CRRA 3KPPB 4DGUA 3FTXA 3P3SA 5AKTA 2R7EA 2X4NA 3AK2A 1E2ZA 4F58H 5GZND 2GPZA 3MJ7B 3K57A 3D69A 3PGCA 4PJFB 1J9RA 3I3EA 4XN5A 2CA4A 4JCWA 5F96H 5FF6B 1T7YA 2W0FA 2WXPA 1UATA 1OP5K 3B2VH 2WK2A 3ZL1A 5KHGA 4LOVA 1LYQA 5J57B 5GGVH 2CJ3A 1A4KA 5CBEA 4GG6E 3D4YA 2BSRA 2W95A 4B7LA 3MROA 4HOMA 1Y76A 4OCYH 4KTYA 4HU8A 5DQDL 1KC5L 2VL4A 4WU5B 5DQDH 5J3HC 1AD9A 4A7QA 1IUZA 5CMAA 4AIEA 4WHTB 1ECYA 1Z0NA 2GG1A 1NL0H 3I5DA 1PS3A 4DT2A 4LLUB 3LDDA 3BQUD 4J3XA 1WC7A 2QWRB 3L2MA 1OHZA 5FHAH 1QSFE 4M56A 4MNHB 1DLFL 4NOBA 4JPSA 4W9HC 1DLFH 4KRMB 4OZHB 5D1QB 2WAHA 3BXNB 5MEOB 5J13C 1AGCA 4ZYKA 1Q1JL 5D70H 4AQOA 3A0BZ 2X4QA 2HX7A 1D6VL 5I74C 2RTTA 3F5TA 2CKBH 1XSOA 4KJQC 4O2BB 4XO5A 2JJSC 3OBAA 4LSUL 3BYYA 5HGDA 1BZ9A 2EC8A 2J25A 3NJXA 1U58A 4MKMA 1A7OL 3H9SA 4NPYA 2F1MA 1ZXKA 4WTZA 2OTUB 3MRCA 4UCUA 4HH9B 1IGYB 2H9GB 2PPCA 2VLRB 3RDTD 1S7VB 3NRQA 3QNYB 4JZ2A 2YGNA 1MF2H 1PCSA 3QJOA 3RGHA 5FB8B 4JFDD 1Q0YL 3CQQA 1Q38A 5TGBB 3V6ZA 1I3RB 4Y5YA 2B9BA 4X5RA 2X1QA 5AW0B 2N0MA 2WO4A 4LDCA 4AXWB 3RUGE 2BC4B 3QR2A 3W81A 1UADC 3CDZB 3OGCC 5D7JD 5CEXB 3VB9A 3C6SA 1Q94A 4F92B 4JRXD 3F01A 4C8XA 3PF2A 4Z0XA 3HAEA 2FZ3A 2IOOA 2KS0A 2JS5A 2ZD0A 5J2TA 1YSOA 3OKEB 2PW1A 1HL9A 4EIGB 4KOCA 5GW7A 3V2AR 4UOZA 2A6DA 3ARFB 3PWPD 2X4PA 3WMPA 3UO8B 4X9BA 1MI5A 2HT4D 1MIEH 4FXLA 4OFPA 2ZOOA 3HBZA 4KO7A 4GXVH 3CRAA 4ANWA 5T3ZE 3NIGE 3TYGH 4UNUA 3QCTH 1BLNA 1YQVL 1QWNA 1N0JA 3VXSA 4TVPE 3SO3C 2ICWJ 4JHVA 1SBSL 2E9WA 2BNUA 3M17A 3WNIA 4W4LA 3CHQA 3KDMB 2AJVH 2ITFA 3JVGC 4H8WC 5B1AC 3QEQD 2VR7A 2DJMA 2AQQA 4GAYB 4PR5A 4ZSOB 2ZIMA 4HWBL 1T1YB 1ZTXL 4FPPA 2VWJA 4K3DL 3RWCB 3HPLA 5CR1A 1KTLA 3DK0A 1CI3M 4JFOB 5D1XD 3FK3A 1VGKB 2XV6B 3TYFA 4NTXA 1D6EB 3IETA 3QJQB 3IFXA 3DX2A 3NFNB 3S3CB 5L2KE 5D2LF 1L0PA 3MGOB 4L1LA 1D5NA 3UG3A 5T1MA 5LO7A 3TNMB 2OXHB 4L4TB 2NY3D 2C9VA 2EICA 3GPEA 2OSLA 1OE2A 4Y2NA 2J6EA 3WO4B 1H8NA 1LTXA 3B2VL 4FTVE 2CLVB 4KO5A 4Q97A 3BPOB 2XQBL 4KK8D 1BZDA 2KL6A 2QSCL 2DW4A 5ERWB 2Q7YA 1BF8A 1JPGB 3U36A 3BHPA 3U30B 3UTSE 4PWEA 5D4IA 1T20A 4Q0XH 1F58L 4ZQTA 3JSLA 1WA2X 3VM7A 1I94O 4OLEA 5C71A 1T6WA 4BFBD 1B0GB 4I4WB 1SUJA 3GT6A 4TKWA 2Q10A 2R9AA 2R56H 2ZSVA 3WHXA 5EU6B 1LDPH 4I1PA 3AY4C 3ABKC 5JW3L 5INCA 2RQ8A 1MAKA 4HKJB 1OCCC 1S9XB 2K7QA 5AVVB 4PJGA 2WO3B 1Y1UA 4RMQA 2UUBB 4MNGB 4C56D 5IDJA 1DQJB 2IJIA 2JB6A 4MVOA 4UVCA 1I7FA 1CGTA 2DLGA 4QF1A 3A67H 4TNWK 4ZOBA 3A67L 4KFZC 3ZHQA 2A9ML 2Y69B 3PWLB 2JLPA 5EN3A 4G8IA 2PTVA 1XH3B 3A6OA 3BCCH 2OJZL 4PGEA 3VFTB 2GTSA 3HKDB 1RSOA 3BP5B 2BFVH 1MUJB 2XKNB 4W9ZA 1FSKC 1JPGA 2FX7H 3U36B 4ZD3L 3PL6A 1VFUA 3A5VA 3FFCB 4N86A 1MCWW 2R51A 5E2WH 3QWRA 3G9AB 1N5YL 4DEWA 3QI9D 3T0DA 3W82A 1URLA 3Q8FA 4AYEC 1RP8A 3T1YO 4NO5B 5L4IA 2AMUA 1CFQB 1OAYH 5LG1A 1JPSH 4K71C 2VLKA 3UTTA 2PCPB 5DC9B 3U4BL 3K3WA 2NRDA 5IVZA 3U2JA 5FO7B 1KBKA 2E75C 2J43A 5C0DA 5E23A 4HEME 3N0AA 1XREA 3M1CA 1Z5WA 4MA8L 3VI4E 3GFUA 4F7MA 4Q9QH 1TIUA 3N2KA 3FPYA 2FO4B 1KXHA 2CNZA 1VZHA 1UFIA 2JS3A 3IB4A 4UB8Z 4G6FB 2BHFA 4RMVA 4AWJC 3U6RB 1VZIA 3VW3H 3QA3B 5E4OA 1V10A 3FOLB 1PD6A 4EDWH 4PRIA 4RFOH 5BS0B 4XVTL 4WQOA 4F8NA 3U9UB 4JN1H 2YQ2A 3S3PA 4YSSA 3OZ9H 5ITFB 4MMXC 1LP9F 2H0EA 2RCSL 3HS0A 3L3HB 1S5HA 4K94C 2HKOA 4KUZH 1LD9A 2QPDB 5HDLA 5IG7B 5I0ZA 4ZAKC 1QR1A 2DQMA 4WV1A 5CIPB 4YHIB 1GGYA 5ACMA 1EFRG 4RGOL 1EHNA 1ZLEA 3WIHL 4PJHA 2G5UA 3JWDH 1JNHB 4QR7A 1KIUA 5LGHH 5DZLA 3PGDA 3K71A 1OTSC 3TO4B 1WITA 2GJ6A 1ZVSA 1AZRA 1N8OE 3D07A 1E4HA 1SVCP 5E8DL 3FT4B 1MLBB 4HXAL 2VC2L 3AG2C 4P46D 1QO3A 1VERA 4JL2A 3EJRA 2E56A 5DMGD 5CIPH 4N5ED 2JJ2G 4OZFA 3GB7B 4JTDB 4EIZC 4HAMA 2E6QA 1EZVH 3HPJB 4QLRA 3B7TA 4UM9A 5CO1A 1NC4A 4ELMA 1TAEA 2Y7SA 1SUHA 5FYLL 3RPIB 3NZSA 4ECNA 5J12C 4KROD 1NUDA 3FAVB 2AXFA 1P7HL 5AALA 1P7BA 2XA3A 4XO4A 4BZ1L 4L3CA 1SM3H 1FL3A 3BRCA 2IIJA 4P8QA 4KL1A 2L35A 1ODAA 3ETBF 2ZTBA 1F11B 3TJTA 4XNXH 3PP3K 4XOBA 3K2UL 1G9ML 2P80A 3TEYA 3E8UH 4X8JB 3GXNA 5FS5A 1CE6B 1LDSA 4J8RB 5FXCH 2UWEF 3DOSA 3FT2B 4LSSL 4MMZA 3UBFA 4AKPA 3ZL4L 3FO1B 4N8PA 2UVFA 4WY7L 4JYCA 5B1JA 1BQHB 3QO8A 3MV9E 4CH6A 3P4MA 1D7FA 4MQTB 3G6BA 1D9KA 1QRNA 3LX9A 4KAQH 3SJVA 4M61A 1GY1A 2GJZA 3CSGA 2IAMB 5T5FH 2L04A 3KYAA 3D51A 1AANA 3L4WA 3LD8B 2X9ZA 1L1FA 1NCWH 4JZJC 4IYHA 2B59A 5IJ0A 1R17A 3QJVB 2B0SL 2CG9X 3JWNH 5BOPA 2G2PA 2X28A 3P69A 2L4OA 4PS3A 3RFZA 2F1AA 3K8KA 3KAAA 3LRHA 1KN4H 1IC7L 1K4DC 4X2UA 4DKTA 3VSQA 2AVGA 4HH9A 1OSZA 1KIQA 2AJZB 4ZFFB 4G2KA 4A67A 3UYOD 3KBPA 1ZJAA 1XO8A 4F5CE 4XZUA 5C7XH 3I9GH 5FB8A 1TZIA 4H37A 1QPPA 5GGQH 2H1PL 4K94L 4BHUI 3EJPA 1ETZA 5KSUA 1ZT1B 5F7LB 5DHVB 1IAOA 4KBPA 2IG2L 5SX5H 3QIBC 1BFVH 2AGJL 5LQBH 1OWRM 1JX9A 5FK9B 2F54B 5SWZA 1BGYH 1YHQV 2Z92B 4A66A 3UADA 1CMOA 3KLKA 1DYZA 5KS9F 1W0VB 3W1ZA 1KEGH 3SDXF 1G7QA 2GJ6E 5HJDA 1MW3A 1P4LA 4FZEH 1ML0A 9CGTA 4F8TA 2WINA 3O3UN 3NCYS 4JPKL 5EUOA 1N2RA 2XJLA 5L4FA 1NEZA 2GITA 1F2XK 2E8YA 3MZGB 3CFCL 2QDVA 3VXSB 4AL8C 3O9OA 4MDIA 4NN5C 2FJUB 2QPEB 3AXHA 5IZ7A 3KHOA 1WWCA 5DJ6B 1U8HA 1XIWB 2NUTB 3ROLB 2ICWA 3OR7C 5JOFA 3O65A 4WW2A 4IOFD 2Q2EB 4MYPA 1C8PA 3CQPA 4NPJA 5EOTA 2JGDB 2OLDA 2W0PA 4BSVA 5FLXN 2DBLL 2EINC 4N21A 3MLSL 3O3EA 1N6QH 2CO7A 1AJ7L 1RUMH 2V5RA 3HAEB 5E9DD 2V33A 5HHVH 2FZ3B 43C9A 1FGNH 5JIIA 3C90A 3KYMA 4JN1L 4EQ2A 3KNBA 3RVUC 4LOUD 4AM0B 1NCJA 4UCSA 1RI8A 4Y4FB 3TBBA 4CNIB 5IOPB 5CU9A 1QSFA 5FA4A 4WFGE 5ESAA 3OG6B 1S9YA 3FO2B 3K9SA 1JHKH 4B27A 5BMVA 1VQNV 1YY9D 1GA2A 3IMUA 2O1AA 4KNSA 3FT9A 4K8RC 3ZTNL 1U93A 3DJ9A 4ZS6D 1AQDB 3ELQA 4X8XA 4EVNB 4EUPH 5E79Z 3WB0A 3M6DA 1Q3EA 5EIBC 3CZKA 1JMXA 1O6SA 1U97A 4LCWA 1DEEA 1OGPA 1R24B 4DGWC 5ESVA 4CSPA 1WTLA 2ZPKH 4WEMB 4YIQB 1B0GA 4JFEE 5IROD 4K9EC 4MNQB 2GUOA 1LNUB 2X12A 3QDMB 4M7ZC 1RAMA 3G5ZA 4ZIBA 1VF7A 5KA5A 4I77L 2IWGA 5DT1H 1MHPH 7TAAA 3AUVA 1F51A 4I77H 5DT1L 1LP9B 1F0LA 1E4KC 3BZFB 5D71L 1HQRA 4M1DH 5SWSE 3VI3A 1KGUA 1NFAA 1I5YA 3E8HA 3PIQA 4HV8B 2D03H 1BQ5A 4M02A 1WS7A 3HN5A 4IKLA 3FQNB 5IY5C 3CZFB 1RUPL 2HJKA 3CH1B 5I6MA 4XPTL 1AZCA 4TTDC 3JUYA 4YMPA 4K3HA 3ZRVA 4KMLB 3SR2C 1WZAA 2OAAA 5FYLH 2VJ8A 1VQ9V 2QQNL 2W9EH 3WL9B 5D96C 4HSAC 1YNTB 2XWBB 1ASOA 4U6TA 3TLRA 4ELMF 5K1XA 5C0RL 4MJIE 4LZKA 1TOXA 5ALCH 3CFIC 1SM3L 1KU9A 3OSVA 1ZANL 3MDSA 3KMDA 1MMMA 1A1OB 3FRUA 3C5ZB 4QIRA 1AJPA 4UYQA 3V0WL 2OL3H 5DQ9B 5H2BB 3VMPA 1RVFH 4WBNA 2YIAA 3FFDA 3NMEA 4KXZI 4UQ3A 1CLOH 3GSRA 2FB4H 4N8VA 5CP7B 4ZHQB 4YDIL 3IKKA 3MLYL 4HFUH 4QRFA 3UBXA 3HMXA 4XDKA 1W2BU 3IC7A 1YJDH 3N6YA 2EIDA 2PWDA 5HVHB 1DBML 1SEQL 2YD4A 1J7VR 1NCBL 1R75A 4YJ2B 5KSAD 1T5WB 4OZFB 2GBTA 5CS7A 4KHXH 2X4RA 3NA9H 2A6DB 3ARFA 3N44B 2VZSA 1F97A 4M8QB 4JFQA 3LDBB 4X99A 5IMLB 1E4WL 2EKJA 4U7NA 2EDXA 4M62H 2YUZA 4XXWC 4N6QA 1XB6A 3WEOA 2PO6C 2PTTB 4G1EB 1KIRA 2QQKH 4KKAC 3DMMB 2GB2A 1FD9A 2MFNA 2ZWLT 4YXKL 4HGMA 3BH4A 1SY6A 5DF0A 1KKCA 1D5BB 3GJEB 3MUJA 3IJYB 4LHQB 5EO1B 2HPTA 1JXGA 4JAMB 3IMWA 25C8H 2V2TB 2Q76B 3EDFA 1E9QB 4S1DC 4OZFH 5LGYA 1UD8A 3ELAT 2EXWC 5T1LB 2NNUA 1VQKV 4N2LA 2VGLM 3D39D 3K6FA 1JCHA 1KLUB 2QHRH 1D5IH 1JXJA 2P80D 4JM4L 1MCLA 3RFZB 3IXAA 1BREA 2BX5A 1U8MB 1SQVH 2PF6A 2VL5A 5JQHC 4U3CA 1S6NA 5IHZB 4UCOA 1I1FB 3VGEA 4C83B 4IBWA 2BCKB 3GSVB 3LN4B 5C0BB 4HS8L 3QVAA 4WUUB 5CJQH 4WU5A 1QVGU 2XFGB 5I8CA 1I9RL 4KNUA 4CMHB 3HKCA 4PRDB 3BDBA 5D1XB 2XWJA 2HN7B 3SDAC 3MLZL 3PHSA 5I17A 2XCMC 1P84J 4R26L 2A6KB 4YX2H 3UG4A 3L3DA 3QHFL 4FZ8L 1EMTL 2N3JA 2VDNL 4JDTH 4P3DA 5D93C 3H3BC 3G6JB 1IQWL 2YPLD 1LR1A 5IROA 2J2ZB 1QR9A 5KZCB 1BD2E 3C87A 3OW2U 4JKPL 4MZ2A 3UMNA 4L8DA 3VH8B 4JM2D 1SQMA 1ICTA 3P4NB 5ALBL 3UAJD 5AW6B 2YSUB 1VKXA 4DR1B 1JJOA 5TPWH 3N2GB 2AQTA 1AD9B 3Q2LA 3S2CA 3TNNA 4BXSV 1S9VA 1BFSA 1I1YB 2F9BT 4O4IB 5KVEL 3MUGA 2WYTA 1AFVL 4ZFGH 1G1KA 3QNZB 3CXDL 4Y9CA 4X9FA 3OR7A 1ZDQA 3SKNB 4RUEA 2QKIC 4ZO9A 4DGIL 1J5OL 3FFOA 1M7UA 1EJ8A 3HUJB 5KVMC 1WF5A 3TESA 1DBAL 2C7UA 3T1HB 2R29H 3F65A 4KHTL 1I8KB 4BZYA 2ZM6B 3ETTA 2YOAA 3UTTE 4PGEB 2DRUA 2HJDA 5IUSA 3IEAA 4JCMA 2IPTH 2EVJA 3QDME 2ZE5A 2WJ5A 3KYNB 2P8MB 4JRYA 4NHUB 3VJ6A 1JVKA 1N6UA 3ZDXE 3VI4A 3HC2A 2PABA 3INUH 3Q8CA 4G8FA 2K3TA 4M4RA 2I9LB 1YN7A 2AJSH 2D4FA 2V9RA 1QBZA 3L3JB 4IKKA 2VLKD 1R5VB 3SE4C 1EUUA 4JUTA 3UMTA 4QXWA 2XQBH 2JNZA 1NIBA 4JI3B 2D9QB 1QZ1A 4XAWH 3EOAB 1VQ7V 3NOIA 4KRLB 3I6LD 4UT6A 4PLKC 1V54B 1MWAB 3KCPB 2G3NA 1QYGL 4R8WH 3OKEA 5D5MF 4ZAKD 4NNYA 3CHSA 4MMYA 3K5MA 1BF2A 1O7DC 1R5WA 1UD4A 4CJ1A 5JHLA 1DF5A 1FO0B 1AHWB 5EEZA 3GSWA 3BPCA 4BKLA 4TQDA 3IAPA 4ZMWA 1HOCB 3TZVA 4OLWH 3C5ZD 1PD1A 3CDZA 1A6AA 2FT6A 5B1CA 4JY4A 3SDDC 4I1NB 3L4VA 4KHTH 3WBDA 3CK0L 3M1BA 3ZRXA 4CC6A 3OFNG 3O6LL 3GHEH 3T0BA 2FIKB 4OTXH 4PVBA 1FZOA 1BQHA 5J6GA 4P2RB 1XGYH 3U9UA 4U6HA 3FL7A 4XI5C 5DFVD 2BHUA 2GK0A 3E38A 3S3DB 2W07B 4W9FC 2WJ7A 3MJWA 3NQKA 4QRPB 4G70B 1LL1A 3OPZL 4AI7A 4LIQH 4YSPA 1T0NA 1C1EL 4HISA 4P2QD 1D6EA 5FGCE 3GI8L 3VQLA 5DTFA 3BRFA 1MCFA 2ZXQA 3U2SA 3FTYA 2OMXB 2J8UA 3KJ6L 4JQIH 3KLAA 4PJGF 3LN5A 1NGYA 4G7VL 1PAZA 2PYLA 1SS3A 1EMTH 2VDNH 5F1NB 3WN5C 2DJUA 2V5TA 4Z7WF 3R4DA 4I4TB 3SPCA 1KYAA 4ZAKA 4DRXA 4YSQA 2UXFA 2VDKH 4CH4A 3MA7B 3P30H 3VRIB 1XMOO 1QUNA 5T1KD 4YDLB 2XWDA 4G8EA 1BVKB 3BJ91 4QHMB 1FPOA 3CZFA 3X3FH 1B6DA 3IDUA 2YIBD 4U7OA 1AP2B 2ZT9C 4B95C 1NTDA 3T3PB 3WTUA 2GJRA 4QHPA 1Y4MA 4XN9A 4G8GE 3V52H 2X2UA 3LRLA 1QFOA 1IXMA 1ZT7A 4KKBC 3ZN6A 2HMID 4BSJA 5I0YA 5E6UB 1D7DA 4PJ8C 5HI4C 4PGZA 3BQUB 5B1OA 1W0KG 4AJ0A 3F6JA 4MWFA 1OARH 4ETYA 3MSPA 4BEIA 5E8NA 5F8RC 3QQDB 2OMTA 4MBRA 4QT5A 5I9QC 1CXFA 1JVMA 3VWJB 3STLB 4X1IB 4BD4A 1L9NA 1YJWV 3DUHA 3V4VA 5C0AA 2BO0A 4H1LB 4POUB 2PWEA 1OV9A 4GW1A 5I18H 4MX7A 3OXRB 5TQ2L 3CVCA 4LR3A 2FT7A 4M61B 1FL6A 3THML 2JRIA 4UT7H 4DP4X 1MZZA 4GQPH 2GBVA 4FXTA 4F27A 4IMLA 3BFRA 1TUPA 4HIJB 3QHTC 4BK8A 3BZEB 5BZWB 3VXUA 1NEUA 2W60A 1EPFA 3MRJB 4AG4L 1US6A 1S46A 2CM5A 2HZHA 4KKZA 3GXDA 4OQTA 2FYUH 4Q89A 1IVTA 1HEHC 3LQZB 4LL4A 3HLAB 1AR1C 2VAAB 1LO5B 2BH0A 3CN2A 4KY1L 3FFQA 4HD9A 4OLZH 3B2MA 4BA8A 2WXIA 4DR7O 2NSQA 3FTUA 1AVAA 1WH0A 1ZPUA 3VD2A 1MZFA 2AZAA 4S0SD 3EHBC 5B1BB 4MSWC 1OSPH 4O02H 4WI5A 2F43G 4ES9A 6PCYA 1GGBH 3ESNA 3EBGA 4N2GA 1WAAA 1SERA 1VF5B 5DJDA 3AG1C 4F7MB 5DDHA 2LAAA 4K4KA 3PIQB 2Y3AA 2BHYA 2CKBL 2YARA 3C2SA 1BT8A 4X9HA 5I18L 2Q8AL 3DWTA 5ALCL 3IXAB 3E2HC 5HI5C 4YBQC 1BA9A 1J9TA 1AKJA 4EQ3A 3EOBB 5HHOD 4GB9A 4MGXA 3OAWA 1MVYA 3CN4A 1L0YA 2VW4A 2W9LA 3POHA 5LYJA 3QDMA 3UTPE 3NUKA 4RWYH 3BKMH 3RKDC 1BL8A 3WXWL 1PKQB 2V4LA 3KPSA 4RIRB 3S36H 3UCRA 3WAJA 4DV4O 3C8KB 3CSXA 4N1CA 2YXLA 1SXCA 3MAQA 1GW0A 2O6EA 4P9ML 2CUIA 4PYGA 8FABB 3NZHL 5KAIZ 1ZT1A 2BOBA 2CR6A 4E2LA 5AOKA 4GYBA 4QO1A 3MRNA 1F5WA 3GLAA 1TSRA 1FYTB 2O5YH 4LCCB 4YHIA 3CBRA 3FPXA 4HWNA 5CZVH 1IZKA 4Q8BA 4QRSA 1AR1D 3E83A 3L5HA 3LS5L 2H0JA 1E8YA 4IL6Z 3MHZA 2MQGA 1Q9LB 4L3EE 5LCVA 1NMBH 5C08A 3SE4A 5K9JL 1FZJA 5D7IB 1E79G 3DLQR 2ICEC 3D39B 2DWDA 4OM0H 4HAFA 1OZ0A 5AVRB 1HOEA 1OAUH 2FQEA 5IQ7H 1NAKL 1TR7A 3GMRA 2VDQL 1EX0A 1X7QB 5G5DA 5EZOL 4Y4KD 2WXRA 4RIRA 1XGTB 1BM3H 3ISRA 4F15B 4HIIB 4Y9BA 1DN2A 3MOQA 4B7IA 5ADPL 4PJ7B 3CSTA 5C0AE 3VRLF 2H3XC 2KG7A 4PJXA 1CLYH 5F1IA 5TFSL 2X2IA 2B20A 1PNCA 2GUZB 1XR8A 2VABA 2VNCA 3RKDD 3VG9B 1VACB 1NJ9B 1T6VN 2DQFA 3MCYA 4DV4B 3EJZC 2UXDB 1V7ML 2CU9A 4YL9A 2UXNA 1HWWA 3RY6C 3UTPD 4ZX3A 2N01B 1XIWD 3RX8A 3MUUA 5G2NA 1MG1A 3SDYL 3TH2T 1RH8A 1WS8A 2H7WA 4M5YL 5H6QA 3BPLC 3IMTA 1UD2A 2DM3A 4JPWH 3AM8C 3CFBA 3OV6A 2PYED 4I48B 2CLRA 3GWJA 3VI3E 1YNLL 5EUOF 4AMWA 1NCDH 2BNRD 3EYUH 4K2UH 4DN3H 4L8CA 2VUKA 1G6RB 1I3GL 4JO3H 4Y4FD 4OPHA 4G5ZL 3CD4A 4JV5O 2P7TA 1EHLH 1MDTA 2D0FA 2GUOB 1UASA 4LH7A 1E4XI 3GJFH 1QLFA 2NR6A 2A9CA 2NZIA 1A3ZA 2YFNA 3IFOB 2AVFA 1NFDA 3CCEV 3C8HA 4YPGA 4FAAB 1T1XB 3I02B 3VFPA 4PJBA 1Q6HA 3PU7A 4A2DA 1SNRA 5GIRA 2HVKC 5IVXA 4U6HB 4LEXL 1QLEH 4XMVA 3QNFA 4RAHA 2LFEA 4RGMC 1J1OL 1AHKA 4LASH 1HHIB 4JFPB 1OP4A 1BZ7B 3FQUA 3MR9A 4Z7QB 4GG8B 4UZSA 4AQEB 4PJXF 4U3FH 4M43L 1GPOL 1A7NH 4DXWA 2KDGA 1TQCC 4PY8J 2UZYA 3FUDA 3LV3A 4LF4O 5DJ0A 1ZWIC 3FB8B 1MAJA 1ZDSA 3UJTL 1FXKC 2WBJB 3MVSA 3S37X 3NYKA 1F4YL 2H3NA 3T1HO 4N28A 3SCMB 4K8RH 1ADWA 4OT1H 2NT0A 3FT3B 3OTTA 1A25A 2CGZA 2J5LB 3AZUA 3QAQA 4DPAX 3ISWA 3ZTNH 1BVKA 4WFFE 2OYQA 4YWGL 1F02I 2A73B 3T2OA 3UM7A 3TA4D 3ZSTA 2EDWA 2PYEE 1L4IA 4DK5A 3BN9C 4MFHA 2I9LA 5KSAA 3BVVA 2Q69A 2HKAA 3JD0A 2W65B 4K9EH 1JF5A 3HZMB 2R1WA 3V0WH 1G7PA 3RILA 1QTSA 3G04A 5KANG 4H2CA 1KGJA 3FX7A 3HG1E 4AX3A 4LAQH 2RMNA 4LDLB 4BRVA 2OJEA 5BR8O 1QW9A 2UXGA 2Q7GA 2Q4PA 3HMXL 2NDFA 1D5XA 3C60D 4NXNB 4U1GC 3ULVL 4G6AD 4NO2A 3WO3B 3N41F 4K71B 4LBAA 5KJ4A 4MSWA 4HZLA 4WGVB 3W2DL 3EBIA 5IQMA 2JK5B 4F9PC 2GK0B 5IM7B 5EU5A 4OF7A 1CR9L 4NFDA 4YSTA 4N4YB 1TEGA 1M6OA 1CR9H 1OAJA 1A7BA 3SKUD 3BXNA 4BE5A 5MEOA 3BSZA 3ULUE 2B1HL 1CBJA 4OIIL 4X5PA 3CLEH 3HKEB 2H1PH 4K94H 3VSVA 2WIMA 3PG2A 4X6BB 1GC1C 4PGJA 4K73A 4FHJA 3T5WA 2EEFA 4JQIA 3B1TA 1F4HA 5CMAB 1FS0G 1T5KA 3UERA 2QADC 3H0TB 1U6AH 4YR6B 2DE0X 4OZGF 5T1KB 3RJOA 2HLEB 4GW4B 4J12A 4ZFOA 4UIKH 1OM9A 3BPCB 4BKLB 1CFVH 3ARFD 2QELA 4X7SH 2PKDA 3IKCA 1RVFL 1P7KA 5KYYB 5ISZE 2J4WL 3DXAB 4J6IA 5IW1A 4FLRA 3CCQV 3WKYA 4Z6AT 1JWUB 5HYSB 3MRDB 4UOJA 4XBGB 5BRZD 1XMEB 2WLHA 2M7WA 2GW5A 4TRPH 2MTAA 1I3RA 3IMRA 5JZ7D 1KB9J 1EHKB 1DP0A 3NP3A 4ENZA 1B9ZA 2PTMA 2ZDIC 3KE0A 4G8EB 1G7MA 5HI4D 4EN3A 1VGEL 3NTCL 4GSXA 4B0MB 2EE9A 2YA2A 1KTJA 3UC0L 1QATA 1HL8A 2YAFA 5FPRA 3F3HA 5KBMA 3TO4C 1BQZA 5L0QB 3UZEA 3VFSA 2VDOB 3GZQA 1DK1A 3R8BB 1CFSA 2AJ3A 1DVFA 2QGCA 1CFTB 3QJZA 3LPGA 3AG2B 3QNZA 4Z7UE 5J11C 1FNGA 3FBQA 1U2YA 1M05B 3SKNA 4YY3B 2X05A 3VD5A 5TDPA 3GB7C 4ZMYA 3FCSB 4H2AA 2EIZA 3W7WA 4RWUA 1NAMA 2TRYA 4NO5A 4NO3B 3E8GA 2J8OA 1X5XA 2XFXA 3E1F1 4Y8AA 3SDCC 4GAGL 1E5UI 1AD0A 4PJIA 3L4CA 4PGCB 3HHSB 2YD3A 4L1HA 2E3CA 1XEQA 2BIIA 3G5YB 4PMEA 4B9CA 3R06B 3KBHE 4NZDA 1DQQB 1ZT4A 1FJGB 3VYPA 3ZQ9A 1X9RA 1LLAA 1EV2E 1HOCA 5KYUA 3U4KA 4C59B 3MHSC 3FB5B 2VQEO 3JZ7A 1T1WB 5F0LB 4PRDA 2CJUL 5EOCL 5CHNA 3KGSA 3SOBL 2XKSA 3PCYA 4TTDD 5D1XA 4APQC 5EF1A 5KEZA 4WHYH 4NZUL 4YY3O 5I19L 4WWPA 2QV4A 2AABH 1M1SA 1MWAA 3KCPA 2PO6A 4HS6B 4AHCA 3CZGA 2NY5H 3F7LA 5DURB 5IBTH 3P54A 3WFEH 2N1KA 3MFFA 1CGVA 1NDTA 1U8CB 4JFFA 2QHLA 4OJEH 3OB0H 4ZMPA 4DUWA 1MFEL 2QQNH 2Y22A 5EOQH 5LN8A 1L0LH 2F54D 1WICA 1FV1B 4EZKA 1FVEB 2OTPA 5EEYA 3ZIYA 4ZX6A 2H4EA 1S7VA 2IAMC 1RURL 5JHLL 2VQEB 2YSTA 2VSCA 4XWGL 4Y16D 4WGKA 2TSAA 4XC3H 4YHKH 4KMTL 1J10A 3LZNA 5E6IA 3W2DH 2HRPL 2BM3A 2C9XA 1CYGA 2AJUL 3EG9A 3QBTB 2X4TB 3DV6B 5EN2B 3W9EA 1HZLA 3PGDB 1NM9A 4ZMZA 3K71B 4NGHL 1G4MA 5LMNO 3JD2A 3MRMB 3B8NA 5KMGB 4ZRGA 1K4DB 1OGAB 3CPLB 1YY9C 2PYEA 3FUHA 2CK3G 1RZKC 5E2JA 3WS3B 2FJHA 4BFEA 4ZMAT 4YSAA 1IGCH 1SHMA 1INEL 3ARDD 3EGDA 2BJML 3NZHH 4HJIA 4O51A 4X8GA 2C1OB 3QC5X 4OI9A 4QJ5B 4RUFA 2Q3AA 4LOUC 2B9ZA 5E9DE 2YZ1A 3B9KA 3MFGB 2CTQA 4DV0O 2EDQA 4DVBB 4AL8H 1L5GA 4MA3B 4H7VA 5J5EA 1HL4A 1HXKA 4X98B 1ZCRA 1M42A 4AVJA 1WP8A 3LCYA 1FLTX 1Z5VA 2VT0A 3D0LA 3R0NA 3H1IH 4XP9L 5GS2D 4EFBA 1SEBA 3KPRE 1DVUA 4AW4A 1A6PA 3EFFK 3WY2A 2Y2YA 1CP9A 4CVZB 1KB5H 2P5PA 1BHBA 4HJJH 3WV0A 1FFOA 2OCHA 4DR4B 3M88A 5E5UB 5AD0A 3DURB 3MKKA 1ITBB 4HIHA 4F7TA 1SJMA 3L9RB 4F2FA 2A1WL 2X70A 3VFMA 4DR2O 5E4EC 4FQIL 3DYOA 3FTSA 3MACH 4JYBA 2V0AA 3L71H 3PREA 4DKEH 1RP9A 5SWQB 4ZOLB 4PJ9C 2AGAA 4UUJB 2FRGP 4L5FH 5DK0B 1PAMA 4W93A 5FO7A 2WP3T 2Y2TA 2V17L 3FMGH 4UILL 3U1SH 1MRFH 3FUNA 2AV1A 2LP7A 2HJKB 2VR6A 1JPST 3CMAV 3MOBH 1CGUA 2Z3FA 3O0RL 3JXAA 4FP8L 1Q94B 1P7QB 1M3JA 1RXLA 3VCLA 2DI9A 1USZA 1E9PB 1UWEL 1Q9WB 1RM1C 1D9KD 1QRND 4W4KA 2ADFH 2J56A 4ZUUB 2JI2A 3VSUA 4WUKL 3AU1A 2CHZA 4TSAL 2XVKA 3WFDL 3WI9A 1X3DA 3D69B 3PGCB 3QAZB 4OSUH 4XPFH 4I0XA 4HZ1A 4QRUA 4NM8H 4HZ3A 3WFBH 4C58B 3W7XA 3QJFB 3DUUB 2J88L 3TIEA 3QO1A 4K7FA 5GSRA 3HG1D 5F3BA 4DW0A 4JO8A 3DHJA 1AS7A 2F8VA 4XHJC 1QNMA 2ZM6O 1O9ZA 1MCQA 2ZKMX 5SV4A 1JGUH 4PY7B 3QUMA 1WP6A 2VRAA 5C0CE 3ILQC 4LFBB 1IAIL 3WGVB 5JYLA 2CHDA 2W9DH 3S4SB 1WHPA 3US0A 4DV5B 1U8OA 2A6IB 4ISVB 5ACZA 5FM4A 2FECI 5F88A 4PP2A 3LZOA 3FU7A 4XC1L 4XNBA 4GW4A 5FGCB 1N34O 5L2KA 3K74B 3UGEA 4WWNA 4JV5B 1MJ8L 4ZUTB 3AREC 3GHEL 3OR6C 5LGNA 3MODL 4GKNB 3OXSA 5ENWB 2Z8VC 5IQ9B 3CMGA 3DPDA 3UBXI 4AYFB 4NKOB 4X7TB 4LSUH 1YLBB 1NGWB 1TTGA 3DMMD 4EI6B 4I3GA 3HLKA 3E80A 3GLZA 5C08E 1YEEL 5IVOA 5HTSA 4HIJA 4G8AC 4J4PD 2VDRL 3DETC 1XEDA 2X44D 1DSFL 3U0PB 4WJKB 1DVYA 3NSCA 3PP4H 5IMOA 3MBEC 2HX8A 4YDKH 2LR4A 3ZTJH 2Z3YA 1RIVL 4MCNA 2ZOLA 3ENEA 3UIZA 4PM1A 4AV5A 3IDJB 5I30H 1PLAA 4NO2B 3LH9A 5DHEA 4P9PA 1Z9PA 2HH0H 3IJHA 4F7KA 1HYRC 3QIWC 2NQDA 4N5EC 4WTQA 1XF2B 4QIWF 1I9JH 3E22B 2E86A 5DWUH 1SRYA 3ZO9A 5DLLA 2XN0A 2R0WH 5ICXB 2P46B 4RDQF 5DUPL 1CLZH 5IYZB 1YEIL 5CMUA 1NFIA 3FN0L 1O9GA 4AK1A 3K46A 4FFYL 2FQFA 1HJCA 2BVPA 2JI3A 4H13B 4KHPB 3WFVA 5DVOA 5IQOA 3GEWB 4KX8A 1AP5A 5EBWB 3A23A 3HI1A 4EJ1C 2MRYA 1YPZE 1FL5A 4ZNEE 3QQXA 5B21A 3SBWC 1IV8A 1JF1A 1L9MA 3ARPA 4U1LB 3L7EA 3FZUC 4G27B 1IL1A 4OFVA 4DQAA 1S7SA 4FULA 3UEQA 1BYPA 3QUZ