3SPVA

Crystal structure of a peptide-hla complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
publication title Crystal structure of a peptide-HLA complex
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 81
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2011-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3spvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3spvA01
5MEPA 4G59A 1MLBA 1KG0A 2XA8H 3O2DA 4U1IB 5FB8A 3IDXL 4PJ9D 5J6GA 4RA0C 3IJSA 2R8SL 2R1WA 4JZNB 3OKEA 2XNAB 2HAZA 1OOAA 4DAGL 1HHIA 1JHTB 5IEHA 4YHZH 1ZAGA 5BW7A 4OUUA 4MDIA 4UT9H 5F1NB 5F7EL 5BJTB 5M7QA 3UJIL 2Y5TA 1IGTB 1S5IL 4JO3H 2VC2H 1Q94B 3HPLA 4GAGL 1KCVH 1W72L 2GAZA 3HHRB 3TPUB 3UTQA 4G42A 4OF0A 4MD0A 2O61A 1U8HB 3QJHB 4IBLT 4LKXB 1LNUA 5I1JL 5CWSB 3R4DA 4PJ8B 2FH8A 4HF5L 4N0FB 4PJ7F 3DUSB 1NCDH 2AXHA 4OLWL 4KVCL 5HYFA 5KN5A 4HKZA 3DVGA 3T1FB 3NIGF 4X9IA 4NBYB 3DMMD 3CFBA 5FM4A 1A4JB 3UPRB 2MSPA 5HYEA 2YKLH 3PQYB 3OSKA 2EDYA 4E5XA 2WZPD 3FO2A 5J0BA 1EO8L 5GSRB 4ZUVA 1DBAL 1KB5H 4HWNA 5FGCB 4DVRL 1V5JA 5I71B 4OM1H 2NX5A 3SKOB 5IFHH 2O5XL 5F21B 3LSOB 2BNQB 4PREB 3DETC 3NFNA 4X6CF 1BFSA 1MCPH 2R2HB 3MRGA 3PHSA 2A6IB 2V5YA 2VMFA 3TPKA 1J86A 4G7VH 2KPNA 5DD1L 4HCRA 3VXRE 5J89A 4UBDD 4RFNC 4P2OA 4RISL 5IB3B 5EU3B 3VXMB 1F58L 2YZ8A 2PR4H 1LEKB 2DQTH 4XCNB 2GTWB 1QRKA 3SKNB 2R0KL 2OTWB 5CUSL 5DR5L 1EMTL 2JCCE 4H1LB 2X4NB 6FABH 1RAMA 1MIML 4I0PB 5C0DA 5TQ2H 4OD2B 4UTBL 2VDRH 4TSBL 3WJJC 4NZJA 2LTQB 2WP3O 4KK6C 4PJCE 2FLRT 5F3HA 5T1LB 2VUYA 3MR9B 3U4EA 5GRJH 5J12C 5IW1A 5IGXH 2NY6C 2E6QA 4C56E 2R9HD 4LLVB 1U3ZA 2F53E 4NC1E 4EJ1C 1A47A 4RA3A 1J1XH 2OL3B 5JO5B 3QXAB 3IETA 5EU5B 1FYTA 5FOBB 1Z9LA 3CH1A 3K4ZA 4V1DE 1ITCA 4F33B 4JG1L 2VE6A 3M1BA 4Y4HC 4Z76A 5ACLA 3L5JA 3BZEA 3MLVL 4JKLA 5A16B 2FO4B 3STLB 3HI5L 1IL1A 1I3RB 4IRZL 4HSQA 3EOBB 5DJAA 4JY6B 3UBXG 2NY2D 1LO3H 5GHWL 1UACH 3A67H 4KQ4L 4L8SB 2EXYC 3F12B 4PTTB 3W39B 3B2UC 2B4CH 2EH8L 2BP3A 5EOTA 4HLJA 3UTSB 1D6VH 5ALCH 4ELKB 4LVNB 2RCSL 4PRPB 2FL5B 1A3LH 1SVZA 2J2ZA 5FYLD 5DTFB 4LSVH 4TUOA 5I17A 1MJUL 1VFUA 2EH7H 1XGRA 1RJZB 3ZL4H 3FRUB 1MCLA 3RRQA 5C0CA 3HI1A 2F19H 4XPTL 3VFNA 4LF3B 4O2EB 2BOCA 5E70A 5FGRA 3B9KA 4EVNA 5JW4N 3ETBF 4U0RC 4Z8FL 1EUUA 3I50L 2DQGH 1JYXA 1NMCC 5I6XB 5FF6A 2Z4QA 1T2QL 4UUJA 2QADD 4KXZH 4EIZC 3KVQA 2EO1A 2X4TB 4RDQF 3FT4A 4JFXA 3MRMB 4XPBH 2ICWB 1CFNB 2N7BA 1KB5A 4PRHA 3TCXA 2ICWJ 4LMQE 2NX5E 1BZ9B 1CLYH 4KKCD 1FL6A 2CK2A 2YR3A 4Z77B 5EBLB 2GUOB 2UZIH 2W38A 3CZJA 4JANA 3IB4A 4JPWH 4U1JA 3D39D 4XP1H 1XGYH 1L6XA 1GGCH 1HQRB 1TJIH 3P77B 1BGXH 4JFYB 5GISL 4FQHB 3RPIA 4U33A 1YN7B 1XCQA 3W2DH 3CD4A 3WHXA 3MRCB 1BOYA 1UFUA 3SE3A 3TT3L 5MEQA 5CP7A 3ULUC 4JKPL 2QQKH 1Q1JH 1LO0L 2GFBB 1UWEL 5HHPB 3ARPA 3MCKB 5IBUG 1NGWB 3OR7B 4A6YB 3PJSB 2VZ1A 2GT9B 3DHJA 4YHNA 2RB8A 5T1DL 1A9BA 1RJYB 3E2HB 3C2AH 2Q6WA 5DMKB 3RVXC 3T4YB 1OCWL 2BMKA 1R3IH 5GGTA 3MZTA 3WUWG 1NGYA 3X11A 1TZGH 3O6MH 3EDJA 3QO0A 2FB4L 5GRUH 5HJ3A 1EAPB 2O5ZH 4OLYH 3NBNA 3EBAA 5HPMB 3GBLA 2PYEA 4YZFF 3SPVB 5EU7E 5IHZA 4HH9A 5E08L 4F7EB 3MTRA 35C8L 1NFDF 4LHUD 1BFOB 4FFEX 3ZT6A 5EO1B 3EHBD 3EZ8A 4PD4J 5F9OL 3RWCB 1XT5A 2BVOA 2DQUH 1NAMB 4KY1H 1LWRA 3AFLA 4YGAB 4K94L 5L6YH 4OM0L 2OM5A 5DJDB 4Z78A 3MFFA 1GIGL 1IC7L 3M45A 3VXOA 4XNZC 1JTTA 1EJOL 2OK0L 2Z31C 5BXFA 3R06A 1S7VA 5E9DD 4ZUSA 2D7QA 3W9DA 2Q8BH 1AIFA 4JFOA 4NHUA 4PLJD 5HGAB 2IADA 1OSPL 4N1EA 3G6DL 5SWZA 3VFPA 2VLRB 4HUUA 3ZDZE 4K2UL 1E6JH 1PLGL 1QHPA 2KZ1B 1T66C 3EOAB 2EC9T 3QDAA 3B5HA 4PY8I 3BP4A 1B0RB 1A6AA 3QUZD 3EYUL 4G6ML 4N5EC 3O2DL 4HLZH 4GBXB 3B6SB 3PGFH 1HI6A 1S9YA 4U3XA 5HGHA 1RU9H 1C08A 1NFDA 1MRDH 4Y2DB 4UNVA 4JRXA 2DTSA 1Q0XL 3M8OL 5D7JD 4IOFC 3JV6A 3L1OL 3OJMB 5EWIH 4FXGB 2Y25A 3TBWA 4IIQA 2EIBA 2WWKT 4H25B 3O6FA 4JM4H 1IRAY 1FL3B 3TIEB 5IB4A 1ITBB 3P30H 1DLHB 1AO7B 3ZDXE 3H3KA 3DBXA 2NNAB 5EBMA 3ARFC 3LN5B 4ZOBA 1YEJH 3HTLX 4XCEB 2OJEB 3VWKA 4Z0BL 3RX8A 3N1FC 3RL1A 3RKDC 5DD3L 4RX4D 3HAEB 1IGIL 4EIGB 3BMWA 2ZCLL 5MENA 4NQVA 4GS7C 4TSAL 4LPWA 4JFDA 1DL7H 4XMLH 2EE9A 4BFBD 2V5MA 3S34L 2ERJC 3IFNH 3DWTA 2Y06L 4I5BB 2Z0BA 1CLOL 1P4LA 1YPZB 4OFVA 3EIFA 5HI4D 4D0BB 5FO8A 2BJML 4I77L 4Z6AT 4X0KA 4OKVB 3BRGC 4W4NA 3S3PA 4PGBB 1MCEA 3T3PF 5D1XA 5IOPA 1QZ1A 2XTJB 3LS4L 4YJZL 3BP7B 4ENEC 3PWLB 4HCRL 5K9KA 4NQDA 1XF2B 3EO0A 3Q3GA 2CRIA 4RGOH 4KUCF 3KR3H 4YAQB 5IJKA 3MGAA 3LEVH 1I7UB 2Q1EA 1T1XB 2DKSA 2UZYB 1JWSB 3PF2A 1FG2A 3WFDH 5I1CH 4H20H 4GXVH 1A6ZA 5C0FA 2NMSA 5T1KB 3AAZA 2FSEA 4WWKA 3V4UH 1MI5D 3OAYK 5LWYH 1K8DB 1BQHB 1T5XA 3GIVB 2D7TL 1CDHA 4L1HA 5I1KL 3STZA 1I8MA 1C5DB 5IFJB 1MFEH 1ZLSH 1KCUH 1EGJA 4OF5A 2R15A 3U48A 4ZOEA 4XI5D 5BVJA 2OQJB 2BHYA 3BZ4B 4PJGB 2EYSB 4I9WE 4XAWL 5FUCC 4OZIA 1R0AL 1XGQA 3CFCH 4P5KA 3WNKA 2GJ6A 3NZ8A 4YDVA 5DDHA 4MNGB 1FZMA 3MLTB 2HVJA 2XA8L 1QPXA 1BFTA 2PNDA 1ZKAA 3BGMA 4BQ8A 4P9HH 4F9PC 4XVTH 2Q86B 4JRXE 1QBMH 4WNQA 3HUJF 2BC4A 1IGJA 1Y0LB 2P5WD 4M1GH 1KLFA 1EZVY 1KC5H 1MVFA 1OTUC 1QFWI 1WC7A 2F9BT 5J12B 4JLRA 4NWTH 4MXQC 2NY6B 3LQAL 4NO0A 3QUKB 4FQJH 4U1LB 3GKWH 5JW5B 2MHAB 4JRYB 2ZKHH 4OBRA 1GGIH 5ICYB 4ZXBD 1IEBA 3EGSB 3O3DA 3QBTB 4P3CH 2KH2B 4WTZA 5L9DH 1JCKA 2OR7A 4M03A 3CVHH 4GUPB 1IGYB 4Y4HB 3LV3B 3E6FA 1NCDL 3VMPA 1TZHA 5HDQL 4JFZL 4U4BA 1ND0A 1A7OH 2EDJA 1JV5A 4WTXA 4X8JB 1BREA 2QQLH 4XVJL 3GSUB 1Q9LB 2ATKA 4X99A 1LE9A 2HMID 3PL6D 4IEFB 1BAFH 3UP1A 1KPRA 2RBLA 1E4WL 3NABL 5IFHL 1NGQL 1UXWB 5FGSA 1DZBA 4RIRA 3QNXA 2HT3C 4YDKL 1NGXA 2AK4A 4LMQI 4G43B 1IJ9A 1LO2H 1NBQA 4PV9B 4Q74A 4U0RB 5EN2A 4NQDE 1GXEA 1N6UA 1IQDB 3QEGL 2GW5A 1A4JA 2WWMD 4YDLC 1HXYB 1NSNH 2DI7A 2V7HB 1RUQH 3GSQB 3X12A 1JNJA 3P40A 5GSRA 5I1EL 5HYQB 1G7QA 1MHPH 2NY7L 2K7PA 5I66A 2A6DA 1ZS8B 3BDBA 4LAQH 1I3GL 4U7KA 1P4BH 4OF3A 4M1CD 4ZPVA 1BQLL 5LGHL 1I7ZB 2MKLC 4PJ9C 2VH5L 3KJ6H 4NO2B 1I7RA 3WE6A 2CKBH 3VWJD 4OKDA 1B4JL 3FRPA 2FZ3A 4YXHL 4K3DL 4DUXA 1K4CB 5GGTL 3QDGB 3GI9H 2R39A 5C0RH 1CDCA 1KEML 1IKNA 2D3VA 4EKXA 4OZIE 4L4TD 3MRDA 1J0IA 1E6OH 2GJ6E 1UQSB 1R24B 5M95B 2V17H 2E9WA 2AJZA 3CLEL 1I8KB 1N26A 5D70H 4D8PA 4RQQA 3ZYIA 5T1LA 3MLUH 3UTPD 5E24E 2HVKA 1AXSB 1P1ZB 1LO3L 3MRBB 1MH5A 5K93A 1UACL 3ABZA 3A67L 5FA4A 5ID0B 3DMMC 2IANB 1R5WB 3WSQH 5IFAL 4NQCA 2VDKH 3OGCB 1BJ1H 5ALCL 3UC0L 3ARDA 5CMAA 1IILE 2E6JA 3V0WL 1N8ZA 1RIUH 3PV6B 3QA3A 2R0WH 2I07A 1JPSL 3T65A 4NQXA 4NYLB 4PJBA 4KK9D 3SHSA 3DPBA 4YUEL 3CVHA 4NDMA 4MVBA 5E8DH 5HYIA 1XZ0B 3KLSA 4EDXB 2XKSA 4UINL 1MQKH 1FG9C 3HC3L 1ES0A 1OAUH 3SBWA 4UBDC 3UTSA 4FZ8H 4K3JH 4J12A 1MOEA 3AM8A 1K4DA 1OAYL 1PKQB 1UWXH 3FQXA 4PYGA 3W0WB 1LQVA 4ZSOA 3GMOB 1YN6A 3ARBD 3W5MA 5INCA 1LE5A 3DOSA 1CLYL 4XNZB 2H2PD 4KV5E 1U8MB 1UXSB 4MNHB 3QDMB 2Z31B 3CGTA 5F9JB 1IM9B 5FKPA 1DBML 4GRMA 2AK4E 3RWJA 1JBJA 3O45B 2W59A 1AGCA 5AAMA 2UZIL 5IWLC 2ZWLT 2IPTH 3MV9B 5I76B 3U2SA 2R9HC 5IMOB 3I02A 4G80B 5DQ9A 3P73A 4FQIL 3VFSA 3VG0H 5ITFB 5L2KB 3T0XA 3OGOE 3P9LB 4X83A 4LSPL 5D1ZC 3QUMB 3C5SB 1CGSL 2X9WA 3MPCA 4HX1A 3P9WB 1M6OB 4YR6A 3EOYG 1C16B 2FECL 1EHXA 5D72L 4YHOL 3MFGB 4MS8D 5ALBL 3GSNB 5F89A 4TRPL 5LGKA 3S96A 3WO3B 1NCBL 3CXDH 3VXME 4HS6B 5AAWA 5HI3D 3H7BA 3QDJB 4HT1H 1OT2A 3DRQB 4V2BA 3EYSH 1A7PL 2GI7A 4HXBH 2B1HH 4RAVA 1KB9J 3U82B 4FHBD 3ARFB 1VFAB 4OZFB 4AL8L 4F2MB 4PB0H 4I2XB 2FX8L 1C5BL 3C6SA 5EOQL 4QF1A 4GS7B 4WIQA 3E2HA 3TO4D 1EK3A 1F3DH 3V5DA 1ZVSB 2QHRH 2X1QA 1FH5L 1SJHA 5MERB 2DQUL 3B8SA 5DRXB 5C9KA 5L6YL 1FVEB 3GNMH 2QADC 4NQCE 4YFEA 1EA9C 4U3HA 3IJYB 2IWGA 4EBQL 2BZDA 3ARRA 3AS3A 4F3FB 3JXAA 3IDGA 5IROC 4LRNL 3TFKD 3QUXA 4KK5D 4UB0L 5BVPH 2H26A 5D7KD 3R1GH 1A6WL 1EGJL 4PJBE 1T0NA 2ATPB 1U93B 3LMJH 4Y4KB 3VFWB 3U46B 1QSED 5GRZA 4TULL 1T3FB 3L3HB 1CXHA 4OFYD 3P3YA 1QFUL 5E6IB 2WMPA 3B5TA 4ONFH 4QO1A 3GKZA 5E94A 3UTSE 5DJDA 1N5AB 4M8QA 4RFEB 4R3SB 1CD1B 1I1FB 3NFSL 4CNIA 5HBBA 4WU7B 4JY4A 4KJWD 4L3AA 5ERWA 1VKXB 1NPUA 5ESQB 4ZSOE 4HKBA 4QYOB 2V5TA 4TVPE 5ESVA 1XGPA 1FFOA 2ZOKB 1EV2E 3IDYB 2PO6A 1AY1L 3ILQD 1AC0A 5EU6D 2FEEL 5GIRA 5EWIL 5K9OA 3VDCA 5JOEA 4HC1H 5HHMB 4YBLC 3S5LG 2HA1A 3X13A 3V5KB 3EOAA 4MDJA 4JFFA 5BS0B 4L8DA 1K9TA 1P6AB 4QRSA 3CZFB 4MB4A 4DKDC 2AXJA 5LCVL 4F57L 3S36X 3FT3B 2ZSVA 5H2BB 1MWAH 3L3KA 3CLFH 3VJ6A 1QRNA 4XCYB 5CEYB 3T2PA 1RMFL 4GSDH 4M6OL 2VAAA 1P84K 4UQ3B 3TF7A 3S36H 1T6VN 4XMLL 1AFVL 4Y16B 1FO0H 3MRJA 3R0MA 1LK3H 3IFNL 2G2RA 4NCC2 2O26U 3EHBC 5F7DA 4X6FA 3TIDA 4WRLA 2FECI 1HQ4B 5BOZG 2YUWA 3D25B 5E99L 2ID5A 1RZGA 3V6FA 2APBA 4M9PA 1O5DT 3MRPA 1BQSA 1FPTH 2BNUA 5F1KC 1A4KA 1KTLA 1EO7A 3BPLC 3DUUB 1AP2A 4LLYB 5E1AA 3A6CL 1SVCP 1AQDA 3MXWH 4WDIB 3HPJA 4OJFH 4RMSA 1AXIB 2B39A 4HWBA 4PD4K 1IQWH 3I6KA 4OTXL 4UDUA 3BE1L 3OKDB 4D9RE 3PABA 4K3GA 3WJLC 4PLJC 2P8PB 5ID1A 5E00A 4Z7WB 4QRRB 3TA3A 1J9CT 4CVZA 3O4LA 4TUJB 4XMPH 2WW8A 4HJJH 5I8KH 2FH6A 1PYWA 1XIWB 1S3KH 1DP0A 1YY8B 2FWOA 2CK0L 5DRWB 3AS0A 5HYJD 1SEQL 4JKKA 2GJJA 2PCPB 2YPVH 5MEOB 3BP7A 5D7JC 2DLHA 1U41A 3BQUD 4TNWK 3DTXA 5IB5A 3TBTB 3UROR 4NFBA 1H3WM 1T1WA 3EDDA 4XNYH 1JN6B 2IBZY 2P5EB 2X1WL 1W0WA 2ARWA 4YDLB 3CFCL 3U7YL 5JA8B 1FHGA 5DK2B 1DN2A 2WQRA 3IDJB 3QWRD 3G04B 1NJ9B 2D7MA 4XVTL 2F8OA 4HBCL 5IFJA 1KFAL 3OTTA 4KTYA 3WO4C 4M1GL 4PJ9B 5DZLA 1JMXA 3FFDB 3VW3H 3V7AG 1BQHG 2VZTA 2LQRA 2OL3L 5DQDH 2VIRA 4G6KL 3UPCA 4NWTL 4OIAA 3BW9A 1YECH 3IFLH 5I0ZA 1MFCL 1BX2B 4U1SB 1EFXD 4LOUD 5HI4C 5IF0B 5L9DL 4P3CL 4NT6B 1IM3B 2ZG1A 5H35B 4P59L 3H9SB 4K7FB 1MWAA 2C3WA 4CKVX 1QRNE 4QKXB 1AGEA 4FFYH 3V4PL 3BWAA 4ZPTB 4NQED 4KRMB 3HCVA 1OM3H 3CUPA 1KJ3L 4XPAH 4NN6C 2GSIA 4KKAC 1FO0A 4O9HH 1MIEL 4XWGL 2CRYA 3VGFA 1QFWH 3GI8L 5C0AB 5I30L 3DMMB 2PETA 3MRKA 3N1QC 3WXWL 4MXWL 3VGHA 4TVPL 1V7MH 4LSRH 4G8IB 3ULVH 5JOFB 3SKJH 3QWOA 4PJDA 2APXA 4YXKH 2VN7A 2CLRA 5AZEH 1UCBH 2FJFB 1JPFA 2AABH 1X5XA 2VZOA 5C09A 4XI5C 2Q7NA 5GS0H 4MCZB 5J1TC 1NSNL 5KSBB 5EUOB 3BKCH 4PJIA 2ZSWA 4L3EB 2E9JA 3HE6A 5IMLB 3IT8D 1KSRA 2F5BH 4M7JL 1K6QH 3O4LE 1U2CA 1QR1A 5CHNB 5CGYD 3E8UL 1KJ2A 3RGVD 2EDTA 5K9QG 4WHTA 5E2TL 4LAQL 1OGTB 3OL2A 3BP6B 1F42A 3NA4A 2XKNB 2G75B 1K85A 3IGAB 4JFQA 1EAJA 4JFPB 4AMKH 4K9EC 1IQDA 3MMEB 5TE7H 1DUZB 2AJ3B 1U92A 5C0RL 1NCAH 1PAMA 1ED3B 2V2TA 5TF1H 1G7JB 4NKOA 1MFNA 3FCTA 1CFBA 3EJZD 4YWGH 4BZ2L 3JTCA 1G84A 3ARQA 3BO8A 2A74A 5D1ZB 3MA9H 4MQ7B 5SV3A 4K8RH 1KIPB 5F1OB 4Q6IC 5E8PA 3REWB 2EICA 3ULVF 4PJGE 5DJ8A 5SX4I 4NRZB 5F7KC 1AR1D 2KDGA 3ARSA 4EI6A 4WGWB 2H6PB 2XACC 1RFDH 3CVIL 3QAZC 2HMIC 3KWWA 3PL6C 4QOKA 5HVFB 3JWDL 5C08A 3O8XB 1PEZA 2BY1A 4M7LH 4JPIB 4NO3A 4JCLA 1MHEA 4PJHB 5IQ7L 3DSFH 1U8KA 2VABB 2V9RA 5IB1B 2NTFA 4M7KH 2YD5A 2Y36L 4JJ5A 1DEEA 4HMCA 2UVEA 3EJJX 3D0VB 3KXFD 4OV5B 3MOQA 4OSUH 1QFPA 4L4VB 1JGLL 2WWMC 2VISB 4K3JL 5LVEA 1DQDH 1HE7A 3ES6B 3HZVB 3FB8B 4UIKH 3VU2A 1A7QL 4XNQA 1J8KA 3MOAL 3OKKB 2EDLA 4JM2B 2VLJA 5EOCH 1H8OA 4YIQB 4QRPB 1J05B 4XPFH 1ZV5A 3MRLB 1VPOL 2IFFH 4IOIA 4M1CC 4PJDE 2CLVA 4G8EA 5LGJB 1FN4B 3VWJC 1JPST 4GW4B 2YUZA 3TJHA 2IPTL 2XZQH 3NCJH 3V8CA 2AV7A 4AIZA 3WHE0 4BSVA 4PJIE 2DWEB 1OF2B 1YDPA 4WW2C 4DGVH 5DJYB 4WFGD 3L5WA 3LEXA 4DKEL 1A3RH 1Q72H 5FV1L 4PG9B 4MA3A 1VEPA 5LKNA 4APQD 1XF1A 1RZ8B 4IMKA 4PRIB 3WN5A 3FAXA 4KPHH 1CZ8H 5F88A 3HR6A 4ZAKB 4JDZA 5FOJA 1CQYA 2DWDA 1IEAA 2CRMA 4WFFE 3W9EA 4WI5A 5T33L 4LLDB 3VFRA 1I8IB 3OXRB 4P4RA 1OD9A 3N06B 2FR4A 1CFQB 4HXBL 3OJDB 3MUJA 3P0YH 1MVUA 5ICXA 5TDNB 4N5EA 2RR3A 5GGVH 3BEWA 4PY7B 5GSVB 1SYVB 4UIMA 3D5OF 2C1OA 1LD9B 5ADOL 1FLTX 4KK9C 1ZA6B 2DMKA 4HWBL 1MCBA 1TJGH 2XRAH 5IEKA 2DD8L 2VB5A 5IIEA 1M1SA 5DJ0B 4ORGA 2P7TA 4FQQB 2ICES 5FYJU 3QDGE 1YYLL 2XN9D 3OF6A 5D7SL 1DBKL 3B9VA 3UTZB 3WNNA 4I4WA 4P48A 4OZHF 1NC2B 1C7TA 1T2JA 1M4KA 4OCWL 1HSAB 1GZPB 4QOKE 3ARBC 4OLVH 5C08E 5BVPL 4QTIL 2H2PC 4KI1A 1OAXH 4I2XA 1DCLA 1PG7X 2EE3A 1ZT4A 2ARJB 3RL2B 1QBLH 1KPVB 5DLML 5MERA 3QPQD 2Z35B 2OR8A 4R96B 4BA8A 1KN4H 1K2DA 1WZLA 4ODUB 1PG7H 5EIQA 3HI6H 4HJGA 4NN7C 3UBXA 3QQ4A 1MQ8A 5F8QC 1G6RB 2VLJE 2EEAA 2H32B 1AHWA 1TVBB 4GKZB 3N1GC 4P3WA 3IF1A 4M61A 4DGIL 1A14L 4NKDB 1SYSA 1NBZB 5F7MC 3V0AC 3NCBB 3TYFA 1GOGA 2MPAL 2X4UB 5C2BH 3ARWA 1L0QA 4XT1C 1JUFA 1KXVC 1ZHLB 4NN5C 4G6JL 2NY5H 2VDMH 1G9NH 1R3HB 1PQZB 1DN0A 4PJAA 4U6XA 5K59E 5F6IC 3N9GH 1KIRA 3AMLA 3RQ3A 3G5YB 2CD0A 5DRZA 2QSTA 3U7AA 1CFSA 3LRHA 5E8NA 5HHOA 2VUOA 1B4RA 4HPYL 1PD6A 5HHMA 2UYLB 4Y5YA 3WO4B 3GO1H 4X5XB 3SQOH 5D2LB 3QCVH 5C0EA 1LK3L 3TO4C 4DGYL 1MUJB 1ZE3C 2LE9A 2JELL 3RIAK 1BLNA 3BSZH 4M00A 3QIBA 3LRSB 3P9MB 4DJMA 4DCQA 4XCFH 3DYOA 1KB9K 1VFBA 5L2KE 4XTRD 3NAAL 4NRYA 3LH2L 1ULVA 5D7LA 3CSYB 3SDXF 2ADFL 3TFKC 4F9PA 4KK5C 3Q6FA 4GFTB 3MXWL 1F3JA 2HG5B 3I75A 4AH2B 2L4OA 4UQ3A 1ERNA 4MAUL 2K9UA 1IQWL 2IGFH 1MHHA 3FMGL 4YO0B 4WV1C 4PJEB 1Q9WB 3I3BA 4G7YH 3HMXH 1Y18B 4NN6B 2B2XL 4UNTA 4JDVA 4YPJA 2LV4A 3KNBB 1KJ2L 5I19L 1OGAA 3SCMD 2V2XB 3GSWA 4PYHA 1S3KL 4KJWC 3WUWA 5CCKL 3IXTA 4E0RA 5DHVB 1VACB 1IBGL 1SQ2N 3OWEA 5EA0L 1VEOA 1JK8B 4I2XE 3ILQC 4KHTH 3VXSD 4W81A 3VH8G 3MJ6A 4NNXB 3A0OA 1CVSC 4XNYL 2DTMH 4G5ZL 3QIUA 4Y8DC 5DUPH 1NEZG 4M62L 2J88H 4BYHA 1RUPH 1N0LA 3GHBH 3PWPA 3VFUB 2DBLH 1UM5L 5DXWA 5C0IA 3KDMB 2VXVH 3TZVD 5L8LB 5I8OL 1DVFD 1ADQA 3BGFC 5EUKB 4NM8L 3F7YA 5CBAA 1FDLL 1TETH 3L5XH 5BZDB 1T20A 4LFHG 2MCPH 3TYGH 4N90E 3ORJA 1NH6A 4TYUA 5JHDB 4N1CA 4BZYA 4FQ1L 3TBSA 1TCMA 2CXKA 1YMHB 2AJXH 4PJAE 3B9AA 4G8FA 1EVTC 2E6PA 4HFWB 4JZJC 2K1MA 4CVXB 2C3GA 2L7UA 2XG5A 4UTAH 5HHOE 4OLUH 4DVBA 2ITCB 5HHME 4X7FC 1OM3L 2W0FA 2IPKB 1YA5A 4Q6IB 5I1HH 3LB6C 5L0QC 1HHKA 3O41B 1T6WA 1MCOH 4FXKA 5FUCE 1N2RA 3Q48A 2VL5A 3NPSB 5L8KB 2VDOL 4LCUA 3QQ3B 3WS6C 3CMOL 4ZOCA 3RNQB 4FZEH 3QAZB 5D7LE 3PL6B 1SY6L 1INQB 2N56A 3DVNB 5FM5M 3MJ8B 4JQIH 2JIXD 5DC9B 3FT2A 3D69B 4IMLA 1ZANL 2B1AL 5AZEL 1JHKH 4PJFF 1UCBL 3NCYP 1W0VA 3BQUC 1A6TB 1E27B 4X6DF 4YDJA 4E41D 3MX0A 1UKQA 4L9LC 1WBXB 5FO9B 3L3DA 2A6JA 2GJZB 3HMXA 1S9WA 2R2CA 1M05A 5I1AA 4LEOB 43C9B 3FL7A 1RZIB 3VMNA 1UZ8A 1OGAE 2NW2B 3RI5K 5BQ7A 1T5WB 3MV01 5KOMC 2HFEA 1IAKB 5I74C 5FYJH 1A1OA 3FTGA 4R4BB 2OSLA 1CTOA 5BV7B 3BJLA 1LHZA 3IDIA 5FKAA 1F4HA 2UUDK 5I2IA 4AMKL 3QG7L 2AVGA 1NLDL 1A2YB 2NZ9D 2QL1A 1CF8L 1DLFL 4PJXB 3OPZH 1D5ZA 4I3RL 3T0EC 2ED7A 2I5YH 4J1UB 3I9GH 3PWPE 3Q6GH 1VDGA 4L4TB 4LOUC 4K71B 5DVKA 1JGUH 3FO1B 4X6DA 5D7IB 1BEYH 3VXTA 5I73B 4CJ0A 4KHXL 3RFZC 3PWVA 2HJKB 3LZFL 1WAAF 1FYTD 4X7SL 5T3ZD 1YC7A 5AUMA 3VCLB 4LVOB 3MOBL 3NH7H 4NUJA 5B39A 4PIRF 2FGWH 2I9TA 4N8VB 4AT6A 5IWLA 3I6GA 1SMAA 4ZUUB 3RUGF 5D9SB 3UTTB 2ZG3A 2DQIH 3NMEA 1XF4B 3Q2CA 3WD5H 1ETZB 2C1PA 2BY2A 2DQJH 4QRQA 1CS6A 4IHOB 5DMYA 2BNRD 3JWNC 1CXEA 4HUVB 1TITA 2CR3A 3A6BL 5TH2A 4ODHH 4JFED 1I7TA 1KIPA 3DI3B 4P5TB 4P57A 1BHGA 1KLGA 2VXQH 4OBSA 3EYFB 4GKSA 1F97A 4G9DA 3TN0B 3KHQA 5ECJE 1KCRH 3B9KD 5FAAA 3RVWD 1HYSD 1DQDL 3V0VB 1C12A 4UIKL 5IQ9B 4XPHH 1CG9B 3P4OA 2X1OA 2NQCA 2FCBA 4LSSL 5EOCL 5CGYC 3RGVC 5HI5D 2EYTB 3FO0H 4AEIH 3H9SE 7FABL 4AK1A 1JYVA 3RUGA 4DUVA 3WIHA 2EDEA 3G9AB 1GVIA 4J23A 3K2UL 4OZGB 3BVNA 3PXHA 1CBVL 4PRHD 2BSSA 5JQHC 3VXUB 2XZQL 4YEFA 4JEGB 3TM6A 2WQ8A 4H0IA 4X7DC 4HUMB 4JO2H 4QY8A 3U4AA 5BOPA 1PGRB 3OKKA 3JWOH 1A3RL 4NN7B 1F4WL 3RDTD 1GGYA 4X98B 3UDWA 2LVCA 3EDKA 4HGWA 3EJZC 1JGEB 5IROA 1WWBX 5LJYH 4XHQA 5B38B 3MNWB 1T22B 2APTA 2CH8A 5FUOL 3T77B 4EUPB 5JLZB 5GZND 3D3VD 1R3KB 2YPLB 1G7LA 5IW3A 2O93L 1ZHKA 2MTPA 1IGMH 1JFMA 5FCUH 4RGMC 5KSBE 2Y4SA 3G08B 4W6XB 3K1KC 4QXGH 5AG9A 3D39A 5DGRA 3BH8B 1GZQA 2WBJB 3QG6A 1AR1C 4QNPE 1HCFX 4NN5B 3C8KA 1MJJB 4XH2A 1HHHA 3BEVA 4WWID 1T80A 3B43A 3MYJA 4U1NA 1YQ2A 1F3RB 3MLWH 5HHNA 4Z7NE 2HWZH 1A6PA 1TZIB 3CDFA 4M3KB 4Z7UB 4F37K 5DJ6B 4Q9QH 2D7NA 5BCAA 3MLYH 4JB9H 1X5HA 4HGKC 3MRQB 5C0ND 3GB7B 1OVZA 3RZCB 4N0YH 1OSZA 5L7XH 2PYED 1LMKA 1HXMB 4OCRH 3OKYA 5DD0H 1WISA 5BO1L 3D85B 4X4ZA 1WCQA 4NFDA 2LU7A 4AYFA 3B8YA 2D7PA 4UV7H 5FDYA 3WIFA 4FG6D 3OZ9H 4JG0H 1A64A 2VLLB 5E6YA 5CEXB 2I60L 5ENWA 4OLVL 3GMPA 2ZG2A 1K8IA 3PP4L 3QWQB 2OYPA 4FRWA 1JL8A 1JWMA 4PGEA 5DJ0A 3FOMB 2JJSA 3PDGA 1QBLL 2XI9A 3QPXH 3MJ9H 3UZEA 4LHUA 3ZO0A 4LARL 2YK1L 3V52H 4MA8H 2AEQH 3PWJB 4IDJH 2R29H 4S1QH 4WV1B 1PG7L 1VGKB 2XY1A 4A6YH 2F54A 2WUCH 4Y5XC 2R56H 1FGNL 5FYLE 2H9GB 5SWZD 2EIDA 5GXBB 1ADQL 4PGCB 3ILPB 4YH6A 4APQC 3CXHJ 2Q8AH 15C8L 4LNRA 1YJDH 4F7MB 1F5WA 3SDDD 4XBPA 1DUYA 5E9DA 3RTQD 3V5HA 2RFXB 4G3YL 4L4VE 3WJLA 5CIPB 4OCXL 5EZLB 1MFBL 12E8H 1ACYL 3DYPA 2V5SA 3AB0C 1OP3K 4NBXB 3N0PB 4GAYB 1JYWA 4M1DH 1G9NL 1V3MA 1JGVH 1HOCB 3I3DA 1JPGA 3HE7D 3QUZA 3VA6A 3SKMB 5FGBC 2W60B 3BMVA 4QCIB 5LXGL 2D31A 4JN1H 1NAMH 1ZK9A 4F15B 4AEFA 1HDMB 5ITBH 1MAMH 1FNFA 3TNMB 5D7JA 3CDCA 4KRLB 3MJ7B 4MQSB 1N6VA 4BFIB 2IAMB 3LKOA 3S4SB 3VWKD 4EXPX 4CJ1A 3HC4H 5FECA 4FQLL 4P3DA 1DFBL 3S3JA 3OKNA 5C3TA 5MEND 1RZFH 3O9WD 3SN6N 3D39E 1NCCH 5F7YC 3QIWB 2CDFA 3L95B 2HT2D 4JFDD 4LSTH 4PUBH 1YEIH 3L5IA 1FAIH 3SE8H 1RUML 1TFHA 3VFOB 3RKPA 3I6LD 4ZDHB 5L88L 2V6HA 3QRFM 4D3CH 1P9MA 3EYOA 3EUUA 1MFAL 4JZJB 2WIMA 5FCSH 5FK9A 4OFPA 1IC1A 1UKTA 1FNGB 4IRJB 2ZUQC 4RX4A 1IAOB 4PRAB 3KPPA 1UM4L 4DN4H 3TVMA 4HEME 4L8CB 2YA2A 4R26H 5DD5H 5E2UL 3B5GA 1E4XL 4XP9H 4N1HB 3QPQC 3DHMA 3HZKA 3L3IB 5FO7B 2P24A 2AEIT 5DEGA 3SKUD 4YGVA 3BDXA 3EOTL 2YUVA 3KYAA 5KSAB 3O2VH 3DROB 3WV0A 1H15B 3EO9L 5F9WC 4UU9A 4M93B 2PW1A 2E7MA 3FJTA 2NPLX 2UWEF 1RIHL 3GSXB 1KNOB 2R1YA 1DEDA 3MLXL 3TBVB 4RGND 4DZBA 4LLMA 2X4QA 4ONHB 5HGBB 4U6HA 2XFXB 5IBTL 3SDYL 5GJTL 1VGEH 3KPQB 3QP3A 1AGDA 3N85H 4IM8A 5BRZD 4U1HA 4ZFFB 3RHWF 3LRGA 2YWZA 5FYKU 3ESVF 4Z0XB 3ZDYE 1MI5A 4J3TA 3VFGL 2HN7B 4HFUL 4X7TB 5KVFH 4TNWF 1QLRA 3PWNB 5E9DE 1R5VB 4LU5H 2MCPL 3EFFB 5DO2D 1ZA3B 1CT8A 3ZE0E 5D1QA 3QFDB 1HHGA 4KUCD 2UWEA 3DGGA 3T0EB 2OX5A 5IMMA 1JI2A 2VLKB 5ETUB 2F58L 5CJBA 4XTRC 1F6AA 1I9RH 4HKJB 1EFXB 1N0XH 1I3VA 5AYQA 5EUKA 3RWHB 3TWCL 5EBWA 5ABDE 2W92A 4OLUL 3QHTC 2NY3D 2AJSH 5J1AA 4PV8A 3MGOA 1J0HA 4H88L 4KRPB 1DE4A 2P5WA 1T21B 4GG6B 3WFCL 4DN3H 1J8HD 3C60C 5E6ZA 2A1WL 2ORBL 3MNVB 1MCOL 5FYLL 3S5LA 1NANI 5E5MA 4TNVK 3CSBA 4WFED 4LHJB 1MJ7H 4YPGA 3MXVL 5CD5D 3SCMC 3QT2A 3KYMA 4XGZA 1CFTA 5IG7A 1CXIA 3HG1B 4KTEH 4LPVA 1T1ZA 4ZXBA 3WIHL 4FN0A 4WCYL 1KGCD 1B90A 3D18A 3BRDA 1TQBB 3IJHA 3M17B 4L1DA 3WFEL 4FQXB 3TJEL 1FORH 4Q6IA 3P4MA 3DSNA 3T1WA 2VDQH 1NUGA 2IPUK 2MJWA 1GC1C 5JORA 1YPZF 5CBEA 2E27L 3DYMA 2CLZA 3G5VB 4HK0B 2OP4L 2WIIB 4HDIB 4ONOA 1FV1A 4I0CC 3FHAA 4MAYD 4HIJA 5HVWA 4DKFL 3V6BR 3PL6A 4JZOB 2ITDA 3TZVC 1K5NB 2BOBA 3AGVA 4CL7A 2ARJQ 1JNHB 1KBGH 4ZS7L 4OB5L 3LIZH 4S1RH 1DQML 1X5KA 4QRUA 1A6TA 1CD9B 1LO5A 1YEHL 1UWGL 2J8UB 3QYCA 3JUYA 5EORH 4HUXB 3F5WB 4NKQB 3TBYA 2OCFD 4PJEE 4OI8A 5IJVB 1YEDA 3VRIA 1AGFA 3RJQB 1YNTA 1NBYA 1OW0A 3HC0B 1A1NA 1TLKA 1KIQB 3WBDA 5C07D 3KPLB 1RZIA 2BSRA 3V6OA 4MJIB 1MRFH 2I26N 3LKRB 4OCNC 5BW7C 3N50A 3FQUA 1XCTB 4WI7A 4P9MH 1WTLA 2GY7B 2FHFA 1AQKL 1YC8A 2A6KB 2FJHB 5J9PB 3G6JA 5HHVL 1FFPA 2IC2A 5E2JA 3VWJA 4ZFOB 1MRCL 4WU5B 1A1MB 1A9EA 1M7DB 2E9IA 5TE4L 3DURB 3QEHB 1FZJB 5CZVH 4H26B 3ARED 2X7LB 1U8QB 4H8WC 4WW2A 3WD5L 3HN3A 3BZFA 5KSVA 1U8NA 4Z18A 1P69B 1IT9L 3QI9B 4F7TB 1LEIA 2BVEA 3ARDD 1CFVH 4ODXB 4PP2B 3PIQA 4YHIB 4QHLA 4G6AD 4NUGH 3FN3A 1F4XL 3WIIL 3LVEA 4DZ8A 4LP5A 4K3HA 2P5WE 5ANMB 1W72B 2R2BA 4LRIA 1U9KA 3KXFB 2AV1B 1XGUB 1Q38A 2EIZA 2MQCA 1X5FA 4K7PX 2VLMD 4N8VG 1I9IL 3MV8B 2LAGB 3GBNH 1C1EL 4W4OC 3P2TA 1QP1A 2BHZA 4ODVH 2R4RH 2CUMA 3LCYA 2ED8A 4KZEH 3V7MA 3RPKA 4K7PH 4XXCA 2OZ4A 5I9QB 2NXYD 1G0YR 3SDAD 3U6RB 3L9RA 1F11B 4LGPB 5DT1L 2I9LA 3QZWB 3QRGH 2V7NA 1U8PB 4OCSL 1ORQA 1XH3B 3T09A 3GSOA 1HWGB 1RVFH 3F7RA 3MACL 4O5LL 4LCYA 1E4KC 5B22A 1QVOB 4QT5A 5HVHC 3S3SA 1T03H 4Y1AD 4Y5XB 4ELMB 1U8OB 2ENYA 5HD8D 3ARBA 4NKIH 3KG5A 1OQXA 5D71H 4APQB 2YBRA 1OTTC 4OZGA 5EB9A 4QHNA 4GAJL 5J06A 4OIIL 3TV3H 4UAOC 2CXGA 4TN9A 5FCUL 5JMOC 3BRFA 2XXMB 1ORSB 4XRCA 4O02H 3LKNB 1ROWA 1KCKA 4CADA 2PXYA 5EFIA 5JIHA 1S7QA 4GRWH 2J3SA 3L5HA 4QHUB 5CJXC 1V7NH 3RX5A 3BIKB 1UB5B 2DQDH 5C7XL 4Q9QL 2VDPL 1TVHB 1KEGH 4MWFB 2EDOA 5DS8B 4GKNA 1N64H 5C0GB 5AD0A 2Y7QA 3G6JE 1M7IB 1P2CB 3O3BB 1C5CH 1Z5LA 2D03H 4MA7H 3P4NB 4MS8A 4PP8C 1FQ9C 2GKIA 4OCRL 3H3PL 4Z7QF 5FYKH 3B9KC 3RVWC 3KAAA 4MB5A 4P2RA 4L8BB 4XHJD 1Y6MR 2YRZA 1MJJA 3BKMH 5JOPD 5B4MD 3S35L 4KUZL 4OQTH 5F6HJ 5ACZA 2PYFA 3NN8B 1TJHH 1WQVT 2DQEL 4L4TE 3MV7B 1YEGL 4U1KA 5JR1L 1JZ5A 3HZMA 5D7IE 2N4IA 3LKSB 4Z7UA 1QA9B 3DRTB 5J1SC 2P43B 4S10A 4YHLL 3ULUF 4F7PA 5HI5C 3FB5A 1LP9B 4NQUA 1GGTA 3UAJD 3MA7A 2K3TA 2ZUQB 1I4FB 3EYVA 3UTPE 2EDXA 3VI3E 1B0GA 1FE8H 4HHAB 5A1AA 4NP4L 3TO4A 4IDJL 4S1QL 1HH6A 4OI9A 5KANG 5LBSH 3V7AE 5E4IA 2YD1A 4G9FB 2Y23A 5DUMH 5IK3B 1VADB 3GSNH 4HUWB 2PKDA 2YPKB 1T0PB 3C5ZB 5TE6L 1WF5A 3RDTC 5KG9A 4O58L 5C6WH 1G7PA 3BP5B 3KPMA 3BT2H 5BMFH 1KLUB 3K1DA 3CPLB 4CVUA 4DUWA 5GZNC 5EPMB 4OAWA 3KPSD 1QSEA 4NO5A 1X5IA 1U58B 3SE3C 4P23D 1NC4D 4MGXA 5KS9F 4OFYA 3PWJA 2PO6D 2Y6SD 5TFSL 2G5BB 5DQJA 1A0QH 4LLWB 1TMCB 2BCKA 3PGDB 3BUTA 1H3VA 3RVUD 4M5YH 3MRHA 2DJSA 4XC1H 1N4XH 1JRHH 2WLYA 3BDYH 4NKMA 3WNLA 4BKLA 4N0UA 4JFFD 1NUNB 2BY0A 4MXVF 4JN1L 5JHLL 1EEUA 4NHCL 5F1IA 3WFBL 3PNWB 1F90H 3CDGB 4K9EL 4OZGE 1YUHA 5EU6A 5C0NC 4NZUH 5CGMA 2IJ0C 4LSQL 2DOCA 1LEGA 1NDMB 2GSGA 2QSCL 4GW5A 5EO0B 3VXPA 1PY4A 3NFPB 3WKMH 4Z9KB 1NFIB 4ALAL 4OD3H 2O5YL 2VZUA 5HYSB 2YEZA 3IKCB 1YEIL 2MWCA 4FG6C 4JAMB 4PS4H 2HJFA 1L7IH 3SE8L 2JTDA 3K4AA 5DURD 4DEPC 5KVDL 1A7NL 4D3CL 5KS9A 1JZ7A 2B4CC 4G8GA 4NBZB 3T8XA 1UT9A 3TNMA 5I15L 2CMRH 5CJQH 1OAQH 1BOGA 1RJLB 4QXUL 4LAJH 4LPUA 2BSED 3RIAF 4ODTH 3UTOA 1HYRC 3H9HB 5C0JA 3B4NA 5CSGA 4Y0GA 3C60B 1U8JB 2HRLA 4R90H 4YXLL 3X14B 4UDTB 1DQJB 5ESAB 4D9LH 1WBYA 4HV8B 5JUEH 4LCWD 3ZKQD 3QEUA 2XA3A 4V2CB 3MRNB 1GOHA 1YEKL 4Z7UE 3VXRB 1AGBB 1FRGL 4Z7VA 4MSWB 3GMRA 2YUXA 1FNGA 1N3NB 2E8YA 1BBDL 3IVKB 4N8PA 1XF3B 3ELAT 2RHEA 3SDDC 5IVZB 3L3OB 2CIIA 1RULL 3RTQC 5IVXA 5F3BB 3K0WA 3VXSB 3S9DB 1BJ8A 1AC6A 2YA1A 5JW3L 2XTLA 4IJ3B 1VGEL 3SO3C 3MCLH 2M26A 4X4YA 4MNQD 1BJMA 4IRSD 2NY1B 4PJCB 3Q5TA 1A7BA 4NFCA 5IB2A 6CGTA 1OT1A 3TT1H 4RAUB 2H3NA 3QEQD 3U7WH 5HYJA 2OTUB 5D7KE 3GMMB 3MRIA 1YNLH 2HKHH 3OKMB 2OMBA 4ONHA 2A77H 3H9ZA 2BK8A 5A43C 5MEPB 1QSEE 3BQUA 4KDWA 1MLBB 3VWKC 1KG0B 1MAKA 4FQ2H 4L9LA 1WZKA 1AE6H 1OB1A 3KPQA 1CE1H 5FB8B 1A8JH 3ZT7A 4ZD3L 3ZE2E 4AEHH 5J6GB 3IJSB 2HT2C 2R1WB 1OPGH 3JV5A 4S1SH 4JPKL 4NGHL 3OKEB 4JHAH 4N0UE 3QWRA 1HHIB 5IEHB 4OUUB 2FEDD 4MDIB 4HXAH 3CMGA 1S8DA 2Y5TB 5D96C 4KMTL 1PG7W 3LPWA 4M43H 2VSCA 3Q1SH 2QSVA 2AKRA 3HPLB 3JSSA 2GAZB 1K3ZA 1QLEH 5EU6E 3UTQB 4G42B 1U6AH 1UB6A 4P46A 4LQFH 4MD0B 4BZ1H 2O61B 3SGEI 3RWIA 2XWBB 1LNUB 5JXED 1JIBA 2UUDH 5C71A 4NC0B 3HMWH 4HZLA 4OT1H 2DS4A 1R6VA 2P8MA 4I48A 3SJVA 5KN5B 5IJKC 2OZ4L 3B2VL 3DVGB 4YX2L 5CSZA 3CFBB 1P53A 4E5XB 4RRPA 1B6UA 3FO2B 4ZUVB 4NQEA 2OI9A 3FONA 5T5FL 1FORL 1X5LA 1J1OL 1QO3A 2NX5B 1CLCA 5DHXB 3WCYA 3RWGA 4K3EL 1T04B 4Z95H 3NFNB 1O7VA 1UKSA 5C09D 5JQ6H 3MRGB 4JO1L 1YQVL 2VRAA 3PGCA 2VDNL 3S37L 2CKNA 4Z7VE 1HKLH 1KELH 1YY9D 4LIQH 4P2OB 3QH3A 4R9HA 1YEEH 3TESA 1IGCH 5IVXE 3U79A 5A3ID 5J11B 4WENB 4PJ7B 4ZTOH 4B7LA 3CK0L 3HS0A 5C0DB 3FZUC 4Z7WF 4H5SA 4KKLD 5D6DA 4CUCA 2AJYL 3X3GH 5DJ2A 3RI5F 4WO4D 5F3HB 4JZOA 3NZHH 2HRPL 3RGVA 3U4EB 2VWEC 5IW1B 3CFJA 3DXAA 3CFKA 5HVHB 4XWOD 4EOWH 2DMCA 1G0XA 5HYJE 1Z0MA 4KTDH 2NY3C 3QCTL 4WGVB 4LCCC 3IETB 2W9DH 5DEZA 2NY0D 1FYTB 4CMHC 1RIVH 3CH1B 3VH8A 1FLRL 2HP4A 2VE6B 3M1BB 4Z76B 3AU1A 3BZEB 4Q9BA 1OAZL 1VA9A 5GGVY 4DFIA 1IL1B 1NEZA 2E8ZA 1DSFH 4X7CC 5DJAB 3I84A 1L8JA 4CGTA 5JXAL 4P2QA 2R4SL 4YK4C 4BQBA 5EOTB 3LN4A 5CFHA 1EJ6A 3QQ9C 4HPOL 1Z2KA 5SWSD 5E03A 3C08L 4TUOB 5I17B 2AGJH 1XGRB 3C09C 3RA7L 5IT2H 2VXSH 4YE4L 3ZSSA 5C0CB 3HI1B 3Q0HA 1MCQA 3VE0A 2X7LA 5C6TH 3GJFH 4RFOL 1YMMD 3VFNB 2B8OT 3T0EE 3B9KB 4EVNB 1A6UH 2VLKE 3GBML 4URTB 4FFZH 4XZUA 4OGYL 1KCLA 1LO4H 2AXGA 2W65B 4M7ZC 2D7OA 4KZEL 2DN7A 4J3WA 5FF6B 2Z4QB 4K7PL 4UUJB 1DDHA 3OX8A 2FD6H 1KT2A 1Z9OA 4M5ZH 4FQCL 3FT4B 1S7XA 3QJFA 4JFXB 1J5OH 1KTDA 1WUNT 4NQEE 4GG6E 1MNUH 2X09A 4YFLI 3ULVD 2AV1A 1KB5B 3QXVA 4PRHB 3GK8H 1CIUA 3MUGA 3GM8A 1FL6B 5F97E 3ECBA 2DQHH 3MUZ1 4DQOL 4R2GD 3K74B 5F96L 5GS0D 5D71L 2X6MA 4JANB 1IKNC 4U1JB 1J11A 4R0LC 2QBWA 4U6VL 5HHXH 2NXZC 4QRTA 2Y07L 4XMKL 3T4AA 2EDDA 3FN0H 4HGMA 3VDAA 3RPIB 3WHXB 5MEQB 2R69H 5CP7B 5EUOF 5MI0C 2FX7H 4FNLL 1RUKL 4P9HC 1JHLL 3CJJA 2GCYA 3NA9H 3F58L 2YMXH 3OJVC 4U1GB 3H9YA 2IQ9H 3G6AA 2HFFA 5T3XD 2OR9H 4CAGA 4YHNB 4LP4A 5F1SA 1A9BB 2DQCL 1U3HD 4HIHA 2Q6WB 4DTGH 3O6LL 2BMKB 3ARDC 1NCUA 3FKUS 4YHYC 1AKJD 2VXUH 1NGYB 3X11B 3EJYC 3LHPH 2J8UE 3D6GA 3QO0B 2E5EA 2VOTA 3GMLA 4MA7L 4JN2A 3O3AA 1JNLH 5HJ3B 5I1IL 2ZZUT 5D5MA 3R8QA 4PB9L 2PYEB 4L5FL 4YNYB 1YYMH 4MVBC 4MJIE 3NACH 5IHZB 2FGZA 4HH9B 4Y19D 3U1SL 2YS4A 3U4BH 3F8UB 1R5IA 5FGBA 1MELA 1FIGH 1OP3H 5AEAA 5CP3H 4F37F 4GMSH 2BVOB 4YC2B 3JTSA 2APFA 4OUOA 2DDQH 3ARTA 1LILA 2NXYC 3OR6A 1P2CA 5LQBL 4KH2A 4Z78B 1CICA 2A83A 3MFFB 2NW3A 3HNSL 3P4NA 2EDBA 3THMH 1B9ZA 3FFCA 3VXOB 4NOBA 2VXTH 2V2WA 3FQRA 4LSUH 2XN9A 2A9MH 3BPCA 5BXFB 2CO7B 4KVNH 1S7TB 1PZ5A 3R06B 4AENA 4OIBA 4I13B 1S7VB 1ZHNA 4ZUSB 3W9DB 1P4IH 3BKJH 3X17A 4FABH 4FMFA 4HW6A 1UC6A 1AIFB 4JFOB 3BT2L 4NHUB 3VFPB 2IADB 5SWZB 2GK0A 2Y72A 4PJHF 4YHKL 1PX3A 4LNVA 3GJEA 3NTCH 3VXQA 1A6AB 5LAXA 4TPRH 4XNUL 4EI5D 3KXFE 1NGPL 1HI6B 1S9YB 1Z9MA 4ETQA 5HGHB 1NFDB 3P11H 1RZJH 4JRXB 4PLKD 4FQPA 4ETYA 3MV8E 3JV6B 3RBSA 5JPMA 4JM2F 2UZXB 4JPVL 1NKRA 4XP4L 1CXLA 2AK1L 4I3GA 4QLRA 3TBWB 4IIQB 1ZXQA 2C9AA 3O6FB 1QPPA 1F90L 5IB4B 2BFVH 2G9HA 4NZUL 3DBXB 1FVDA 5EBMB 4FTVD 1CK0H 3PXJA 3VWKB 3RL1B 1YNKH 4XHJC 5MENB 4NJAH 3MRFA 5B4MC 4NQVB 1QQDA 4UQ2B 3UJTH 1MCCA 4WFGE 3C5JA 5BZWB 1GAFL 5C0BD 4ELME 4X4ME 4JFDB 1UZ6E 2ESVD 1OAKH 1GHFL 3QIBD 4R4ND 2BVQA 3QUYD 1P4LB 2ED9A 2G60L 5GJSH 4OF7A 1TVDA 5D96B 3SDCD 1BVZA 5IESH 5FO8B 4X0KB 3FO9A 1WZ1H 4ODTL 4RMUA 5GS3A 2DM7A 5D5ME 2HT4C 4KAQL 5D1XB 5GGQH 4D0DA 5IOPB 4R8WH 3KPRD 3U0TB 3LDBC 4C83A 1N6QH 4WFHD 2Z91B 1OP5H 4BH8A 4Q7DA 5HHQA 3O0RL 1MCFA 4U1MA 5K9KB 4KQ3H 3LOWA 3MRRA 1MREH 3OXSA 1A21A 32C2A 3EO0B 5AYUL 3Q3GB 1UA6L 4NWUL 2Z93A 1HHJA 3FAWA 1INEH 3DGCR 3GZKA 1F4YL 2BDNH 1FG2B 1A6ZB 1BZ7A 5E8OA 4L29A 5C0FB 1EXUA 3AAZB 2FSEB 4WWKB 5TQ0L 2PO6C 4UOW0 1ZTXL 1T5XB 2F5AL 1I8MB 3STZB 4OV6F 1RUAH 4XC3H 1FNHA 1HZHH 3QIUD 3SCMA 4PJ5D 5BVJB 5JNYA 4R4FL 1HSBA 3G5ZA 4MSWA 2Y9RT 3B3IA 3IU4H 4HWEL 5DMIL 4OZIB 1YNLL 1XGQB 3FOLA 2CDGA 1SM3L 2DM3A 4P5KB 2GJ6B 3NZ8B 4YDVB 5DDHB 1FZMB 2HVJB 1Z3GL 3PV7A 3BGMB 4P5MA 5F7UA 3T3MF 2W9EH 1D5IL 5HY9A 3RVVD 5D4QA 4WNQB 4G9FE 3H42H 4R7NA 4WUUD 1OPGL 1QYGL 3MGTA 2BC4B 1ZLWK 1IGJB 5IHLB 4QGTA 2XWJA 3TZVA 1RK1A 4MJ2A 4XAKD 4JLRB 1A5FH 1Q9OA 4XCCL 1DVFA 5FHAH 4TTGA 5C1MB 4NO0B 5ADPL 1A3QA 5KVGL 3F6LA 2NY3B 4LCCB 2AJUL 4NNPL 5DHVH 1D9KD 1KUMA 3C2SA 4OF6A 4CMHB 1AJ7H 1FC2D 1IEBB 3O3DB 3PDOA 1J0YA 1B2WH 4QHKI 1X5JA 2IH1A 2XXCB 3E6FB 4OT1L 7CGTA 3O3EA 1TZHB 1QFOA 3UYRH 3T2NL 1U0QA 3QSKB 1R3LA 2W9LA 1MPAL 1ND0B 3TA3C 2L7JA 1JV5B 4XP6L 3C6LD 4QTHA 4EN3D 4HQQL 2CR6A 3IU3A 3FB7A 4X80H 2ATKB 2LABA 2XV6B 4X99B 2EKSA 4N0RA 5D2LF 2GYSA 3QXTA 5CLWA 1LE9B 2XWBA 1QEWA 4HK3N 1KPRB 2EDWA 4PLNC 4FP8L 4J6RH 1LDPL 1NBVH 1MJ8L 1IC4L 1BVLA 4TNVF 3GIZH 4RIRB 2VDLH 3QNXB 1NGXB 2AK4B 1TPXC 4IRSC 3VGGA 4O4YH 1HINH 5EN2B 3ARGA 4UV4H 5EZIH 1P7QD 2MMXA 3X12B 2JIXA 1IAIH 4AJ0A 1L6ZA 1KENL 1G7QB 2NTSP 4ZTOL 4E41A 5I66B 2A6DB 4LCIL 1CCZA 3O11A 3D2UD 4ZPVB 1T04A 2ADIA 5EZOL 3O2WH 1I7RB 3WE6B 5L2JA 3BH9A 4O2CA 1CU4L 4CVWA 4W4OA 2FZ3B 2NLJA 1MCRA 4M6MH 5KVMC 3RWDA 2XOTA 4HS8H 5CJ8A 5E5UB 4EOWL 2FEDC 1FIEA 1NGZA 4K23H 4MQTB 4R0LB 1B0WA 1FNEA 2NXZB 3MRDB 3TCLB 3QHFH 2W9DL 2ZCKL 5TGBA 5EIIA 3GRWH 4Q0XL 5FHBL 3VXSE 4PJ7A 3AXLA 2AJVL 2AJZB 2FATH 2ADGA 2P48B 1PW3A 4D8PB 4RQQB 1E4KA 4M48L 1FFNA 1IFHH 2IH3B 3S88L 4R7DA 4ZQKA 5D6CA 4TSCH 2HVKB 3K8LA 2H1PL 1MH5B 1NUFA 5J4MA 4XP5L 3V2AR 4HAGA 2FBJH 5FA4B 4NQCB 4KZDH 3QULA 1CDUA 3ARDB 5CMAB 2CJUL 3WDHA 3D1MC 1X5ZA 4WTWA 4X6CA 4YHYB 1NAKH 3CSGA 3SOBL 1N8ZB 3ZT5A 4LASL 3QA3B 3T65B 2I07B 2HTLD 2R2EA 3GHEH 4NQXB 3DX7A 3DJ9A 5BV7H 2M2DA 4HWUA 4PJBB 5IBLD 1AR2A 5EO9B 1A6UL 3CVHB 4NDMB 1QSFD 2X4PA 3UCRA 3HLAA 3DO7A 5CJXA 4Z5RA 1D5XA 3U9UA 4XVUD 5GGSA 3QFJD 3HE6C 1ES0B 2BNRA 1AXTL 5DZOA 5GS2H 2FD6L 1K4DB 2ZCHH 1J5OL 4X6BA 3FQXB 2NXYB 4JFEA 1H3TA 3WKNA 2Z92B 5A3IC 4ZSOB 1YN6B 4AG4H 5INCB 1LE5B 4Y4FD 3ZTJG 5B3JF 4Z7OE 2EC9U 4WUKL 5FKPB 4GRMB 3RWJB 5KZCB 4KJPC 4WO4C 2W65A 5DC0A 1AGCB 1KPUA 3VFMA 1G7HA 5IHBA 2ZJSH 2R0ZH 3T0VA 1ZHBA 2IBBA 3ARUA 3U2SB 4P4KD 4XWOC 3I02B 2HH0L 3CU7A 2I24N 5DQ9B 3P73B 1IC5H 4MX7A 3BI9X 3VFSB 4TQEH 4ODWA 2NY0C 2R69L 4E41E 5I1GL 2OJZL 5FYJD 1N59A 1JNNH 3ZSTA 5KTEH 4HX1B 2Z9TA 5DWUL 1KN2H 4YR6B 3LPGA 2WWKO 3U36A 1JJUA 2JE8A 2WBWB 2CPCA 5F89B 3RDTA 3V79C 3BUYA 3S96B 1E4JA 4PJ8D 4DW2L 4EEEA 3MNZA 3H7BB 1DQLL 1X6NA 3D3VA 1J18A 1CLZH 4PJ7E 5AWNL 4RAVB 4WVRA 3GRWA 3TO2A 4DWHA 2DQFA 4PJXF 4Q9RL 4LVHC 4BK5A 1JTPA 2VQUA 3PQYD 3NIGE 4M9OA 2AI0H 2EYRA 3NACL 2EKJA 3C6SB 4QF1B 4XBGA 5T1MA 3V5DB 2BNQD 4M02A 1SJHB 3MLSL 4OLZL 1FZOA 1RJCA 3EO1A 1UYWH 3X3FH 1EHLL 3JTTA 1D3CA 5CJOH 4KGJA 4X4XA 3ZMRA 1IGFH 1FYTE 4X6CE 3THML 5T3ZE 4HIEA 4F58L 1MCSA 3IDGB 2F15A 1BJ1J 4YNYA 3ULVC 4LSUL 1VCAA 1M71A 2A9ML 4KROB 3VFTA 3QUXB 3VXMD 2H26B 2YHGA 5EG6C 1T0NB 2AEPL 5F6HI 3OB0K 3OJ2C 4GQ9L 3WEXA 1X7QB 2XYCA 3BKJL 3LDBB 3TGXA 3TJHC 4R2GC 4PR5A 3ZTNL 1X5GA 3VD5A 5GS0C 2HFGL 2BNRE 5E94B 2F54D 3IRZA 4M8QB 4YQXL 4QEGA 2YD4A 4WW1A 2YSSA 4CNIB 4TPRL 3LS5H 2W07A 4X5WA 4JY4B 5ERWB 5C0CE 1GC1L 1NC4B 1S7TA 4HKBB 4IMKC 5ESVB 1XGPB 1RURH 4WHYG 3RY4A 1FFOB 3WN5C 5C92A 2PO6B 2IBGA 5FUZL 8CGTA 1OHQA 3D9AH 4EQ3A 3K81A 5GIRB 3OMZA 5EC1A 5K9OB 3X13B 2V9TA 5DD6A 1U3HC 3ET9F 4JFFB 4MDJB 4R6UA 4L8DB 3GSVB 3OKLA 1OARH 3LAFA 2A73A 4QRSB 5DMGC 1FVCA 2WBKA 3SDDA 4RAHA 4UILL 3RTQA 2R1XA 2ZPKH 3FB6A 4PRHE 2ZSVB 2J5LB 3L3KB 1WEJL 3V4VL 3VJ6B 4J4PD 3RY6A 4PRPD 4BSWA 1QRNB 4M6NL 4JO4L 2KKQA 5IW6A 1HNGA 3UJTL 3UJJH 2H2SD 2VAAB 1TQCB 4K8RC 5GS1A 1H3XA 3HE7A 1Q0YH 2Z8WC 3MRJB 2DI9A 2G2RB 2J12B 5F7DB 4X6FB 3TIDB 4NZTL 1BM3L 2IG2L 2DIAA 3QXUA 1H5BA 3IFOA 1INDH 1A6VH 1RZGB 3D3VE 3V6FB 4NJ9H 1MF2H 1FGVH 3MRPB 4EDWL 2BNUB 1A4KB 1NMAH 1KTLB 1WJ3A 5KVEH 1CL7L 4H8WL 2YD8A 1E28A 1AP2B 4WI4A 5E1AB 3O9WA 1JZ6A 1AQDB 1OD7A 3CC5A 4UQ2A 3BKYH 3TVMD 1D6EA 4NM4L 5D2NA 3BPNC 3HPJB 3TLRA 3ROOA 5BZWA 1EUTA 2B0SH 4XVSH 1BFVH 3I6KB 4UDUB 1TIUA 5CIPH 3PABB 3O6KH 3GUTA 5CKAA 3BIAX 4OCYL 1INEL 5ID1B 5E00B 3TA3B 4CVZB 3O4LB 2BDNL 1CD0A 1N5YL 3WS3A 1AHWC 1PYWB 3MROA 2FLBT 2FWOB 3DUHA 4EI5C 3WLWD 5I1LA 2PYEE 2W0LA 1G7IA 3U0TA 2QQNH 2Z91A 1JZ2A 1ZMYA 3BGAA 1HZHL 3LEYL 3VRJB 1TPXB 3DTXB 5IB5B 1I85C 5ILTL 1T1WB 4B5EA 2DYPA 1L7TH 1W0WB 4OFDA 3IFPA 4GLRH 3JZ7A 4X7EC 1DBBL 1JF1A 3KYOA 2AQ2A 3NCMA 3Q5OA 5EH1A 4ZNEA 4LPXA 1ZEAH 3ZYZA 3DX8A 1SJXA 4Y5YC 3BXNB 3HFMH 5BRZA 4UMGA 5H94A 5D1QD 2GTZA 3NIFF 4NHUE 1HEZA 2X70A 5SWZE 4IS6A 2VIRB 3MLZH 4JDTL 3QIBC 4RFNB 5HDBF 4I3SL 3BW9B 2CGRH 5T3ZL 1S5HA 3QUYC 4BSJA 4YZFE 2C7UA 4NZDA 1HILB 1RZKH 1NFDE 3QO1A 1EFQA 1J88A 4X6EA 4PRBA 1B2WL 1MLCA 1MWAB 3LKQA 1AGEB 3UXFA 3BWAB 1QHOA 3EFDH 3REVA 3HCVB 4YHZL 3VI4F 1BBJB 3CUPB 1XF5B 4UT9L 5AZ2H 2GSIB 4JO3L 1FO0B 2VC2L 1NDGA 1KCVL 4HWZA 4JY5H 4C55A 3WFZA 4YLQT 3MRKB 4LCCA 2I27N 2WUBH 5I8CA 2VLRD 3TH4T 2HKFH 2VYRE 3QWOB 4PJDB 1J8HA 5MENE 4WEBH 2CLRB 2WV3A 5GRVK 3H7LA 3MODH 3JBG7 2LU4A 4N8CH 4GBXD 4JFDE 1JPFB 3U0WH 3QIUC 1CL7I 4K7PY 2VKWA 5C09B 4Y2DD 4LLAA 2YKLL 1W8OA 3I6LE 5EZIL 5HDLA 4PJIB 2ZSWB 3MO1A 3HE6B 3ZHLA 2P4AB 4RMTA 1KB5L 1BIIA 3RZWA 3HUJA 1QR1B 1KJ2B 4UT7H 4CW1A 4OM1L 4WHTB 1I9JH 1NMBH 4HJ0D 2FBOJ 4YDIH 4FOMA 1AO7D 3DV4A 3RVVC 1QD0A 1MCPL 4GH7B 4JFQB 1RK0A 3MV11 4TOYH 5DI8A 4G7VL 2I25N 1G9MH 4M6ML 4MAYA 2MOVA 4WO4B 1G0DA 1EIBA 1NMCB 1U92B 2PR4L 2P42B 2DQTL 3MYZA 2V2TB 2NY5C 3U83A 1G9NC 4NKOB 3GRWL 4HIXH 3V8OA 4JRWA 4W6YB 3PP3H 6FABL 3UO1H 1F02I 5TQ2L 3FCTB 2VDRL 4YHMH 3RJDA 4MZ3A 4ZNEE 4JGJA 3BO8B 2A74B 2MFNA 5C07A 5GRJL 3L7EA 3N1MC 5BRZE 3LD8C 5B8CA 5IGXL 2FDBP 1KXQE 2HJLA 5E8PB 2EDQA 1J1XL 5DJ8B 4R0LA 3FRPG 2XTJD 3T3PE 3TCLA 3C6LC 4OGXH 4EN3C 4EI6B 1ZOXA 1IZJA 1NAKL 3KWWB 4TUKH 3STBA 4PTUA 4QOKB 4AM0A 5C08B 3UZVB 4NO3B 4PRNA 3BD3A 3PHOA 4H1LG 1MHEB 4NRXA 3AREA 4CN1A 1NL0H 1U8KB 2IH3A 1F6FB 2NTFB 5J57B 3MUHL 4JJ5B 1DEEB 5T1KD 4MD5A 1DANT 3MLRH 4XBEH 2DJUA 2B4CL 2VWEE 1D5MA 4S0UC 1D6VL 2Y1VA 3WDJA 1A3LL 5IMKA 4LSVL 3DETD 2EH7L 4XNQB 1ONQA 3ZL4L 5IP4A 3T0BA 3FQTA 5F70A 3QCUH 2VLJB 2F19L 1EDQA 3U30C 1FAKT 5I18H 2F74A 3ULSA 4U31A 3RWEA 4IOIB 5EO9A 4C4KT 1GSMA 1J8HE 2CLVB 2YC1A 5IHUH 4G8EB 1QKZH 2DQGL 1U95A 4WFEE 1BD2A 4AY0A 1MSPA 2APWA 4FS0A 2AV7B 4AIZB 4BSVB 3IDXH 1YDPB 4XPBL 1KGCE 3L5WB 2CDEB 3SDAA 2R8SH 3LEXB 4D0CA 2Z92A 3HUJE 4KK6D 5IR1A 4MA3B 5CILH 4DAGH 2B7DT 4KMLB 3T0WA 5F7EH 3DX6A 1QBBA 3UJIH 3WN5B 4OQ1A 4JRYD 2CRZA 1H9VA 5F88B 4GAGH 1W72H 2X1XR 4JDZB 4JPWL 2DWDB 1IEAB 3O4OC 1SBBA 1XGYL 4XP1L 4Y1AA 1GGCL 3W9EB 5F7HA 1TJIL 1BGXL 3VFRB 5I1JH 2PXYD 4Y4HD 4P4RB 3W2DL 2X4RA 1EH9A 4HS3B 5DFTA 2FR4B 3DLQR 5TDPA 3I3EA 2SEBA 1MVUB 1H0DA 5ICXB 2QQKL 1Q1JL 5DJXA 3BEWB 3C9NA 4OLWH 4KVCH 4UIMB 2C1OB 2PW2A 2FJGA 5C9JA 5INDA 1ZLUH 2CKBA 4RCAA 5CSBA 43CAA 5C07E 3BPOC 5IEKB 5IUSA 5IIEB 1EO8H 3C2AL 4ORGB 2NY2C 2P7TB 4P2RD 4XPGH 4ZO6A 1EEYA 1R3IL 4DVRH 1IAIM 3E6HA 5DA4A 1UYWL 1TZGL 3O6ML 4I4WB 2O5XH 1ZWIB 4U49A 5HGDA 3RIFF 1IGFL 5GRUL 4OLYL 2O5ZL 5EBGA 5GRVL 3HB3D 2EE6A 4NPYA 5DD1H 1BVKA 4MD4A 1WLHA 3GSRA 1F58H 5H37G 1ZT4B 4QHMA 4B50A 2R0KH 5CUSH 5DR5H 3VG9C 1JGDA 1MCDA 5SV4A 4KY1L 2ERJB 1MIMH 1K2DB 3TNNA 4P4KC 4UTBH 3T04D 4TSBH 2FHBA 3QDHA 4HJGB 3UBXB 3QQ4B 3UDWC 1T7ZA 1T2XA 2ADJA 1AHWB 2DLEA 1H8NA 2QKIA 5DRNA 1J0ZA 1GRWA 3G5XA 2C3VA 4KKCC 3W81A 3IF1B 4M61B 2H8PA 2H41A 1X7QA 5EOCJ 2AQ3A 4EZMA 1SYSB 2Q8BL 1MCKA 4QGYA 2B20A 3IDMA 3TYFB 1DQTA 2YWYA 3L6FA 1E6JL 3B9EA 3ULUD 4GMTH 1JUFB 3LQZA 1II4E 2HYMA 4JG1H 4BH7A 4QXTA 3MLVH 4HZAA 1DN0B 3AS1A 3KPSA 3PGFL 4PJAB 3RNKA 3HI5H 4P23A 1RU9L 1NC4A 4U6XB 2JB6A 1MRDL 2C4FT 4IRZH 4KXZI 1KIRB 1FJ1A 2IAND 5GHWH 3RVXD 5DRZB 1CFSB 3K8MA 4KQ4H 3AS2A 5DC4B 5E8NB 1S7SA 2A9NH 2EH8H 5HHOB 3ZE1F 2RCSH 3BAEH 3VD7A 4Y5YB 1Q0YL 3KPOA 3NIDF 5I71C 5C0EB 4JM4L 4Y1AE 3GSVA 1UH4A 3P30L 1BLNB 5A40E 4WY7H 4XPTH 1IAMA 3QIBB 1A6VL 4HK3J 4DCQB 2GHWB 4X9BA 1VFBB 1YEJL 2DLGA 4NRYB 8FABA 5J6HA 3I50H 5D7LB 3BD5A 5K33A 4G8GD 1R3JA 3Q6FB 2A38A 4S1DD 1F3JB 1IMHC 1T2QH 3I75B 3VRLF 1XGTA 2JJSC 4NCC1 3O3UN 3W0WD 4MMZC 1DL7L 4LSDA 3KPRB 2HLFD 1MHHB 2FO1A 4XX1E 5IBUB 5FYKD 3QDMD 2Z31D 5I16A 1IM9D 1KCGC 2MCG1 2LTQC 4JDVB 1OGAB 3GSWB 1ZSDA 3MV9D 3WUWB 3IXTB 3MREA 4E0RB 2IQAA 5A2IH 1S9VA 2X4SA 1NFKA 2E7CA 3ZKXC 3WNOA 5GISH 5JOPE 3HAEG 3K46A 4TTDD 2BVPA 3KPNA 5J3HD 1U8LA 4N68A 4RGOL 3KR3L 4LCWA 3TT3H 4OGZA 3LEVL 1LP9F 3MSPA 3QIUB 3V95A 4A2LA 1L7TL 3QNZA 4JKPH 1G7MA 3VGBA 1LO0H 1UWEH 3SDXB 3WFDL 5I1CL 4H20L 4GXVL 3QUZC 3QXDB 3PWPB 3JWOC 4NNYA 3V4UL 5C0IB 4S2SA 5LWYL 3DECA 1TTUA 1T0MA 5T1DH 2BVUA 4L8SC 1QBAA 2WK2A 3QDJD 1MFEL 3WNMA 1ZLSL 1KCUL 3F7YB 3HRPA 5CBAB 4MNQA 5DSCB 3VRJA 3HFML 4IRSA 3P4LA 4HIIA 4PGDB 1T20B 4X5LA 2H2SC 1GH7A 4KI5F 4HKXA 3QEQA 2CGRL 3S7GA 3TBSB 3MZGB 5DK0A 1URLA 1TTGA 2P47B 3KPSE 5E08H 1RZKL 4G8FB 4P9HL 1P9MC 3CFEA 5F9DC 1QBML 1RV6X 2VQ1A 3MBEA 5F9OH 3EDFA 3BXNA 3NPZB 4P46D 3TVMC 4DVBB 1KC5L 4K94H 4OM0H 2XPGA 4ZFZA 1XFPA 1GIGH 2W0FB 4HC1A 5AZ2L 1IC7H 3LD8B 4JFFE 3GMNA 1FL5A 2FEEI 1EJOH 4Y4KD 2OK0H 2DKUA 4YFDB 1HHKB 1WWCA 3MBXH 4FQJL 3GKWL 4FXKB 1N2RB 2ZKHL 1GGIL 2VL5B 1HILA 4LCUB 5E6ID 3SJVD 1F6LL 4YBQD 4BFEA 3WLWC 3CVHL 1OSPH 2E9BA 3G6DH 4GW1A 5JXEA 3FT2B 4IMLB 1PLGH 3TH2T 2YD6A 1BBJA 1P5UA 1XF5A 1W0VB 2X4OA 4YDJB 3EYUH 4G6MH 1LK2A 2XG4A 1CGUA 1A7OL 1EHAA 3O2DH 1NCNA 3L3DB 2A6JB 1W8NA 3FQNA 3OG4B 2QQLL 1P7KA 4OZ4A 1S9WB 3M8OH 2A2QT 1M05B 1CXFA 5I1AB 5IM7A 3L1OH 4MA1C 1BAFL 1UZ8B 5BQ7B 1Z9SA 4UT7L 1PDKA 1EEQA 5GZOD 1PX4A 3IDNA 2HFEB 5BS0D 1TDQA 3U30B 1A1OB 3FTGB 2OSLB 3QHZH 1YJDC 3IDIB 5FKAB 5SX5K 1LO2L 5I2IB 4RMVA 1SJVA 5CD3A 5D1QC 1BZQK 3QNYA 5E4EC 2D2OA 1X5YA 1QSZA 5DK3A 1RUQL 4LCWE 2FYYA 2Q20A 1D5ZB 1HIMH 4Z0BH 4ISVA 2YRPA 5DD3H 1MHPL 3OHXA 2ZCLH 4X9FA 2X9YA 2JCCF 3JV4A 1CN4A 4Y16D 4TSAH 3BN9D 3DXAD 3UO1L 1P4BL 2DLTA 2IEPA 3L3GA 1CDIA 5FXCH 1XR8A 2BX5A 4X6DB 4YHML 5JIIA 3VXTB 1T83C 3HZYA 3KJ6L 3S34H 2DM4A 3PWVB 2CKBL 4MXQD 1CLOH 4PJCF 4MNQE 5T3XH 5AUMB 4NUJB 4MJ6A 5B39B 4WO4A 1ZT1A 4KWUA 5SWQA 2I9TB 4CDGC 3D0LA 3JVGA 4AT6B 3GI9L 2JKXA 1KOAA 3I6GB 2BJMH 4I77H 4OLXH 2X89A 3O4OB 4Q2ZA 1ZVHA 1U91A 2AERT 4GG8A 4J8RA 3ISWA 3QEQE 2VQTA 1E6OL 4XNMA 2V17L 3LS4H 3ZKND 2C1PB 2VJXA 4N5UA 4TUKL 4P2QD 4ZXBC 4HCRH 3HRZB 4QRQB 2HLAA 2WY3A 4NC2B 3N1PC 4LQ1A 4LPYA 4QRRD 3L3JA 5D70L 4RWYH 3MLUL 4PBXA 1MEXH 4LEXH 1JZ4A 1T7YA 5TH2B 2JF1A 1XIWD 1I7TB 4P57B 1KLGB 2BERA 3HR5A 4GBXC 2D9QB 4GKSB 2JCCA 4G9DB 3BPOB 3H0TA 4LFHD 4Y2DC 2NY2B 4LBEA 3WSQL 2VDKL 5DYOA 4L9DA 1N7MH 1C12B 2HT3D 2D7TH 5I1KH 3P4OB 1RIUL 2DL2A 5SWSA 2R0WL 3B9DA 1ZGLA 5E5RB 5GGRA 3K4DA 2P5ED 1G1CA 1KYOJ 4C56A 2PN5A 2F53A 1PJ9A 3RUGB 5IHUL 1S7RA 1YMMA 5TPWH 1QKZL 4XAWH 5E8DL 1R0AH 3BVNB 2BSSB 1MQKL 2NR6D 1OAUL 1OW0C 4V1DA 4FZ8L 5DEFA 3VG9B 3JV0A 2QSQA 3V6OC 5I1DA 1S9XA 4QY8B 3AY4C 2QADB 2ZOLA 4P4KB 5E8EB 5CILL 4HGWB 1BQUA 4N0CA 1MCHA 4ZYKA 2EDNA 4OD1H 1IE5A 4U6YA 3ZTJH 3LQAH 1G7LB 2GITA 4PRDA 5C09E 1FBIH 1ZHKB 2KZWA 1TCRA 3H9SD 3D39B 2E3VA 3OB0H 2CDEA 2XTJC 1GZQB 2PTUA 3QG6B 3VG0L 3C8KB 4XH2B 1HHHB 3BEVB 3MYJB 2IALA 4U1NB 1J87A 5HHNB 5HDQH 5HXMA 4JFZH 2A0LD 4LLUA 5C0AD 2VZSA 5C8JA 3F62A 2XQYG 4XVJH 3C8DA 1TXKA 3OAUH 2CIKA 1CE6A 4LRIC 3WL9A 1OSZB 3CXDL 4YBLB 4XPGL 1E4WH 1U3HA 3NABH 4HT1L 1NGQH 4HS3A 3EYSL 3WIFB 4YDKH 1AKJA 1KJVB 2B1HL 3UZQA 4BFGA 3WHE1 5DFVD 5EIVA 1RSFA 1QTYT 4MJ5A 2P46B 5ENWB 1X9QA 2QR0A 4L3ED 4XXCC 3GMPB 2WINA 3QEGH 1K8IB 4PB0L 1CICD 3AROA 3IDUA 1JWMB 3FFCD 4PGEB 4F7CB 5I1EH 4Y19A 1UVQA 2QHRL 2NY7H 4LHUB 2X05A 3JUZA 1I3GH 3GNML 5KAQG 1ZWIA 4O2FA 1BQLH 5LGHH 2VH5H 1QUNA 5EC2A 2F54B 2JJTA 2Q76A 5SWSE 1B4JH 2J8OA 3I85A 4YXHH 3R1GL 4K3DH 3W11D 3LMJL 1MAJA 4LNRB 5GGTH 1T7XA 1HKFA 1B88A 3BPLB 5EU4A 3L7FA 1YMME 1KEMH 4H0HB 4OZFG 1WT5A 4XBPB 1DUYB 5E9DB 3ZKXB 3V5HB 4ONFL 2V9QA 3OKOA 3NCCB 5H8DA 2Q3ZA 3ZDZF 1KIUA 1B6DA 4GMTL 5D1ZD 2PXYC 3CLEH 2COQA 1JPGB 3QUZB 5C2UB 4BELD 4EI5A 4RMRA 5L8JB 2XQYK 2D31B 3ULVE 4KKNA 2A9NL 1H3UA 5IFAH 4WHYH 5D7JB 3UC0H 4OZHA 4HC1L 4MS8C 3BAEL 3ROLA 3LKOB 4MHHI 1A7RH 3V0WH 3O8XD 4LHQB 1I85A 5FECB 1QNZH 4P3DB 3OKNB 4YEEA 1UEMA 4ZG1A 1JPSH 1X3DA 4WY7L 5HI3C 4Y5VA 3ZDXF 2CDFB 1J1PH 2DLFH 1PVHA 4YUEH 3BD4A 3CFIC 4L4VD 1MWAL 4F8TA 2KUTA 3CLFL 4FTVA 4LPCA 3HB3C 4U05A 4W70A 3EYOB 4UINH 3HC3H 1VFMA 5FK9B 2FIRT 1UCTA 4GSDL 2PTTA 1SJEA 5GGSY 2X40A 1AD9A 3S36L 4JM2D 4JQXA 3KPPB 1FO0L 1OAYH 3OAYH 3TVMB 5D8JH 4QRPD 5T3XE 1OP9A 5C0BA 2ESVA 2DIJA 3HZKB 1KTRL 2P24B 5DEGB 3KS0H 4YGVB 2BY3A 3QUYA 5GGUA 1CDJA 4B41A 1S7UA 4DK6A 3SDCA 1DBMH 1FPTL 2BRQA 2HFTA 4UU9B 5F44A 2PW1B 3BHBA 1U36A 1XAUA 4OJFL 2VKXA 5JDSA 2R1YB 4DZBB 3KPRA 4LLMB 4NQSA 1H3PH 1VESA 4PDCE 2X4QB 4FQIH 4Y19E 5J8OA 4CBPA 4U6HB 1RHHA 4PRID 2DJ4A 3SE4A 4LSPH 1AGDB 4XMPL 3VFVA 2X1PA 4ONGH 3VGDA 4HJJL 2EE2A 1CGSH 5I8KL 4ZAKD 4U1HB 1WIPA 5D72H 4MA1B 4YHOH 5ALBH 2KL6A 2WP3T 4U3CA 1P84J 4TRPH 2YPVL 1MI5B 1NCBH 2HTKD 1OLZA 1UM6H 2EO9A 3PWUA 4XXDA 2CQVA 2JJUA 1QLRB 1U8IA 1A7PH 2KQNA 4PJ5A 1CT8B 1WFOA 5D1QB 4FFVD 5E4EB 4AIOA 1HHGB 3SDXA 2UWEB 4POYA 4AL8H 1FCCA 1EEZA 3DGGB 3QXDA 1VERA 1FZKA 1EX0A 2Q7YA 5IMMB 4BQ6A 3VXNA 2FX8H 1C5BH 5LG1A 5M94B 5EOQH 1F6AB 1AH1A 4PG2A 1UGNA 5EBWB 5JPNA 1FH5H 2BSTA 5DSCA 1NC2D 4S1DC 2C4XA 4PGDA 3WLBA 3VW3L 5J1AB 4PV8B 4WUUA 3MGOB 3FQWA 4OZHE 4CMMB 1DE4B 2P5WB 2HLFC 5DQDL 4EBQH 2JK5A 3U0PA 1JI1A 4J3XA 5KSUB 1YECL 3F7VA 4LRNH 3IFLL 3C87A 5FA3A 5ICZA 3MBXL 4UB0H 5I75C 3DVIA 3S5LB 1A6WH 1EGJH 5E5MB 3SGJA 1TENA 4YPGB 4TULH 3KYMB 2EDKA 4XGZB 1CFTB 5IG7B 1CDBA 2P8LA 1QFUH 1QLFA 1T1ZB 1D9KA 4ZXBB 4FTVE 4FFYL 4I18A 4ZUTA 3D18B 5GRXG 1Y6NR 4O51A 3MLPA 3IJHB 4XPAL 2GQHA 2JLLA 5J3HC 3IAPA 3NFSH 4TTDC 1T4KB 1DJSA 4D9QD 1OQOA 3IXAB 1S7WA 3P4MB 5C0BE 4O9HL 2ESVE 1QFWL 5JORB 5CBEB 4LLQA 2CLZB 4RNRA 3C6LA 1AY1H 4EN3A 2E7LC 1V7ML 4LSRL 3WFHA 1AD0A 1FV1B 3ARGD 4HIJB 3ULVL 1HH9A 3SKJL 2EDRA 3KLAA 2ITDB 4KJYA 4BQCA 4YXKL 1CDGA 2BOBB 2YXMA 3EDEA 3SE9H 3DIFA 3QHZL 2AABL 4QRUB 3KPRE 1LO5B 2ICEB 4WFHE 5GS0L 3TBYB 5LCVH 4F57H 2P1YA 3BKCL 1YEDB 3VRIB 1AGFB 1HIML 1YNTB 1NBYB 1A1NB 1CGYA 2F5BL 1P7QA 1K6QL 2BSRB 4MCYA 1RMFH 4M6OH 3FQUB 5I8EA 1AFVH 3BIBX 4OF8A 1JWUA 4JGUA 3D2UA 1D5BB 1F13A 3E0GA 5T3XL 3G6JB 1FFPB 4P46C 2ZNWA 3VWJB 4BUHA 5E99H 5TE7L 2GEEA 2X9XA 1T89C 1A9EB 1UJ3A 3P0GB 1NCAL 4OLXL 4PJ5E 4LGRB 5TF1L 4OZIF 4MQXD 3RGHA 4UI2A 4Y4KC 3SDXE 3UMTA 3A6CH 4WW2B 3GMQA 3BZFB 4PJFA 5KSVB 5E6IC 1FFQA 1U8NB 4YWGL 4WEMB 4ZUWA 4OTXH 4YHPA 3BE1H 4YBQC 1LEIB 1DQQA 4KKAD 3MC0A 3MA9L 4RWYL 3PIQB 1MCIA 4QHLB 1MEXL 4LEXL 4K8RL 2OI9C 2UY7A 4WUUE 4DZ8B 2VTFA 5JTWA 2R2BB 1I1YA 2CK0H <