3SPVA

Crystal structure of a peptide-hla complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a peptide-HLA complex
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
total genus 81
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2011-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3spvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3spvA01
2RCSL 5DK2A 3HS0A 3QXVA 4U7KA 2JK5A 3L3IB 2VDRL 5IEHA 3D0VB 3UDWC 5CBAB 4JPVH 3CFIC 5E8PB 2AJZA 1TFHA 5KTEH 1CFBA 5MENE 1ZT1A 1F6FB 3WFEH 2OI9C 1MRDH 4PFEA 1U93B 1BD2D 3ZLQC 3RU8H 4JDZB 3F7VB 1NBZA 5GGTH 1X5KA 3T0EB 3IB4A 3QCUH 5IB4B 4JY5H 1W72L 1SJVA 4NM8L 4LLDB 4BFIB 2AJVL 4BQ6A 5GS0D 2YKLL 4PG9B 3BQUD 4P4RB 1HSBB 3BRGC 4LNRB 3DGCR 3NZHL 1J1PL 3TA3D 5C0FA 2PTTA 4ZFGL 5IF0A 4N0RA 4RIRB 1F13A 5IT2L 1EK3A 5KS9F 1MLCB 2ICWJ 3JV4B 5DMGC 4PB0H 4ORZC 1WVZA 3T0EE 3BEWA 2WIMA 5B8CB 3FCTB 1DEEA 1I3UA 2BMKA 3ZHKA 3TO4B 2DWDA 2PYEE 1CFNA 2V9RA 1EO8L 1G7HB 5AAMA 4K94L 1QD0A 3H7LA 4LASH 2WWMD 3K2UH 3DYOA 4NZRL 5HGHB 4F3FB 1YY9C 4OD3H 2A1WH 3WFDL 4PD4K 4U3HA 1PKQA 1I1YA 4LK4A 1MFBL 1IVLA 4J3TA 2XT1B 2VNCA 4NNYA 5MP6H 1HHJA 4GKZB 5ALCL 4P0DA 4Y8AA 2NY4C 4FNLL 1QLEH 5DJ6A 2NY1D 3ARQA 3WYRA 3VW3L 2PUQT 4ALAH 4PY7B 5EBWA 2JELH 4M62H 4DCQA 4PJ9B 5IIEA 5ESQA 2VN7A 1TZHB 1UKQA 1GOFA 4QHKJ 2ADFL 4WUKL 1EHLL 4YHNA 4IDJL 3SCMD 5EWIH 1A6WH 4LPCA 2GTWB 3ARFB 1A9EB 2V2WA 5B3NA 4CL7A 2B4CC 1XH3A 3A6BL 5BV7H 4MNQE 3DX7A 4V1DA 1H5BB 2ITDA 1T03H 4EI5C 4BUGA 2I5YL 4HZLB 3ULVL 2F58H 2NZ9D 4O2CB 1Q94B 3LZFL 4FZ8L 5HGBA 1GIGH 5IM7B 2HJKB 4QRTB 3GI9H 3RUGF 2APXA 4U31A 5DYOA 2OCFD 4L9LB 8FABB 2R1XB 1UQSB 3DARA 3QBTB 2L4OA 5J9PA 5JQ6H 3WLWD 1UENA 5CZVH 4M00A 2XKNA 4WCYH 5KVEH 5IW6B 3SDCA 3D39A 1XIWC 1SM3L 4FQXA 4HWEL 4RQQB 3RWGB 1FP5A 2YD5A 4JCLA 4LSUL 2KUTA 3RWEA 4UBDC 3SBWA 4JE4B 3VFNB 3IGAA 1K4CA 4LQ1A 3RWCA 3BP4A 3MUZ1 2E7LC 2YMXL 2VLMD 4ZXBC 2X89D 1KPVA 1YN7A 4M1DL 3ZMRA 4HCRA 4Z95H 2O5YL 3QCTH 3NFSL 4XNUL 5ERWB 5KSVB 4CVXB 3ELAT 1A1MB 1QLRB 4KK5D 4U1NB 2MCG1 2GJ6E 1J12A 2M1KA 3EHBD 5BQ7A 1YY8A 4JFFB 4L1DA 4XVTH 3PP4H 3ZL4L 4WUUA 4XPAL 1KOAA 4OI8A 1RUKH 4DUXA 3QIBD 3AY4C 3DUUA 1RJCA 1OY3B 2LE9A 4MMZC 1P7HL 3LZFH 1WBXB 3NCFB 5IB5A 5JHDD 4DGIH 5D5ME 4TVPH 4NQEB 5T3XE 4TNVK 4XNQA 5DJAA 4RGNE 2H26B 4JZJC 4QHUB 2CDFB 4P2CG 5DJ0A 5F6HJ 3RWIB 5F96H 5IFAL 4XCEB 1QEWB 1ZT7A 1MI5A 2JIXB 4ETYA 5IHLB 4O00A 3ULUC 1A6WL 2YN3A 3RWJB 1AD9A 4MXQA 5TH2B 2DIBA 2GTZB 5IMMB 1F4HA 5DI8A 5I16B 3QR2A 2V5YA 4OJFL 1UB5B 2AEPH 4RMWA 4JDVB 5C70A 3JSSA 3SE3C 2Z92B 4X4MA 4GJTB 3DURB 5ESAA 4ZYKB 5IR1B 5J11C 3RGVB 1VERA 4I18A 3MA7B 3T09A 5MP6L 4MX7B 4YHIB 4WUUE 4IIQB 4LMQI 1PEZA 3S3JA 2ADGB 3EYQC 4GG6E 2R56L 1IM3A 3IJSA 3HE6C 3JTTA 5GRXG 2YUZA 4N0UB 1HKLL 4G8FA 5I1IH 3N50A 2P7TA 4QWWC 4X80H 2B5IB 3VXUD 3MFFA 4NWUL 4LLQA 4P5TB 4DQOH 1EO8H 1S8DB 2BVTA 1CD0A 2RIKA 4HWUA 2X4PA 5J11B 5F70A 4BQBA 3C60B 4CN4A 1IZKA 2NPLX 3KDMA 4G9FD 4M7LT 5HJ3A 4NFCA 2RAMA 4NFDA 4HKJA 5D1XA 3DV4B 3NABL 4MD0A 1TTUA 1MLBB 3VFSA 2VR4A 2A0LD 3MLVL 3PL6C 4KRLB 5IKCB 1OAXH 3G5VA 1UACL 3KLHC 4Z76A 1KPRA 3VXNB 5HVHB 4WDIA 2D9QB 2BNQA 2CKNA 4ZS6C 2PO6C 4DTGH 1JK8B 4LLWA 1R5VB 1CICB 1T1WB 4GW1A 3GJEB 4N1HB 1U8KA 4HCRL 4KK5C 1DQMH 2DQIL 4GRMA 4G43A 5GS2D 4OCYH 3RWHB 4GRLA 1T66C 5D7IF 1MCLA 1ZA6B 4LCCB 4RFEB 5FGSA 3IYLW 4ZMAT 4ELME 1QUNA 4KY1H 1E6OH 2VAAA 4JGMA 4LF3B 4MB5A 4NQVB 1N5AA 4ZUUB 5EUOF 3QAZC 1MSPA 4OSUH 2BK8A 1I7UA 4EN3D 5JW4N 2VIRA 2WSKA 4S11A 3AREB 4KK9C 2OSLB 3GHEH 3GSNB 3V5KA 4PJFA 3KPQB 5BZWB 3S96B 4RAVA 4L4JA 3U6RB 5ISZE 4WFEE 1V3JA 1CFSB 4ORGA 4HUWA 3NH7L 4U6TA 5GSVA 4YAQB 3HG1A 5EBLA 4K3DL 2UYLB 3R4DA 4JKLA 5KBNC 4TNWF 3GKWH 3ARGA 4CVXA 1B0GA 3H7BB 1RZFH 2KZ1B 5D9SA 5F7FA 4BQ8A 3QUMA 1C12A 3SJVB 5L2JA 3S88H 3C08H 4ONGL 4B50A 1S5IH 1R3KA 1MCIA 1YUHB 1BEYL 5GRJL 5CP3A 5DHVH 1T1ZA 5JQ6L 1E27A 1Q38A 1HK6A 2O93L 1AGEA 5IIEB 4L8BA 3QEUB 2BC4B 4LAJH 4QCIA 1YEKL 3MRNA 4O9HL 1KJ3L 3BPOB 4YHOL 1P4LB 3QFJD 5J13C 4O4YH 4Z7OE 2Q6WA 1KUMA 1MHPH 1IRAY 1QBMH 3K7UA 4NNYB 3RPKA 1BX2A 1QO3A 1U3JA 3NN8B 1B88A 4KV5F 4PV9A 4HX1B 2BJML 5DXWA 1EUTA 3QNYB 1BFSA 1JGLH 1LO5B 5E9DE 2COQA 3H0TB 5E8NA 3VRJB 1URLA 4R4FH 3QSKB 4OD2A 2KQNA 2EE9A 4OD1H 4ZS7H 2PN5A 4X5XA 4Z7UF 3FTGB 2JB6B 4LCIH 1KC5H 1JPGA 1H5BA 2ITDB 2X4OB 1AKJB 5TGBA 1GVIA 3PDGA 1KLGB 1U8LB 3LMJH 3MLTB 1MFEH 4OZIE 3S4SG 1GXEA 3VFGH 4HJ0C 3AMLA 5MEPB 5GS0C 3EYFB 5GGSA 1PSKH 1MRCL 3DV6A 5CUSH 3MV9E 3PHQA 3TA3B 5H37G 1D7FA 1RJYA 4XPBL 3UJJH 4RGND 2G75A 1R3IH 2EDNA 2WBWB 4NC0B 1I1CA 5T3XD 1VFAB 1GAFL 4Y8DC 1IAIL 2AI0L 2FHFA 1MUJB 5C92A 1K8DA 2V9TA 4H0IA 2ORBL 2WV3A 4XC1H 2F53D 4Z7NE 5I76B 3BP7A 3FB6A 3S98A 4HDIA 3FO1B 5F89A 1CGSH 2WIIB 4JCMA 2YHGA 2VR5A 5J56B 3EGSA 3U7WH 3SQOL 1W72H 4YIQB 3EJZD 1L7IH 4JO1H 2W0FA 1ZT4B 25C8H 1FNHA 3O3EA 5FYLH 4M3KB 3RZCC 4U6YB 4Z7WF 1T0NA 3C8HA 5KJRH 3TIEB 2GT9A 5IB5B 3QO0A 2CDEB 3QZWB 2OMBA 2FX7H 4JO1L 3RQ3A 1WEJL 4ZSOE 5D1ZB 2E27L 4NN5B 3MJ6A 5EZJA 2NR6C 1V5JA 2DQTL 3MBEC 4I0PB 4KK8C 1M4KA 4C56E 3TT1L 4UB0H 4AYFA 2E27H 1I8IA 1EZVX 32C2A 4KROB 1AE6L 4AG4L 2A6IA 1IGTB 2FX7L 3BFOA 5F1KC 4KUZL 2DM7A 1NPUA 1TTGA 4JFEA 5B8CC 1NCAL 1FORL 4XWOD 5DJXA 3N1PC 3ARRA 4M5YL 5FGRA 2Q3ZA 3NCEB 1L7IL 5C08D 3QA3A 2LU7A 1RI8A 2NY0B 5IROA 1PSKL 2X1XR 4KK8D 1I9RL 4OF0A 4RZCB 3WXWH 5GXBB 4CVWA 3X14A 4XC1L 3MMEA 3PG2A 2EIZA 4K94C 1WFUA 4MB3A 2A6JB 4NZTH 1IAIH 2AI0H 3QPXH 3VXMD 4U3CA 3S5LG 1CD8A 3UZEA 3W0WB 3VFVB 1MHCB 1XF4B 1G7LB 4F80A 4PV8B 3I3EA 1JP5A 1NCDL 4HIIA 4R4FL 2MCPH 2P7TB 2NXYB 3CFEB 4LLQB 1RUPL 1AGBB 5F1OB 5E08L 5DJDA 5ISZB 2FSEB 3WLBB 4FZEH 4ELMB 4X9BA 1WWWX 3PWLA 3LSOB 3SGDH 4Y2DB 4B0MM 3Q2CA 5EU6B 5E6IC 2AK1L 5C0DA 3TA3C 1JZ7A 2R0KH 3QDJE 2KQMA 1F4AA 4XP5L 3RTQC 1JWMB 2Q76A 5K93A 2Z31B 4WEUD 3BXNA 4JY6A 2IFFL 3QI9D 5ID1A 5L6YH 1RUAH 4PJ7F 1KJ2A 2VH5H 1HH6B 4D8PA 5C0CE 2DIJA 5AUMB 1MNUH 2HAZA 3O3BB 2FBJL 4EVNB 1CLOH 3A6OA 4KXZI 1LK2B 3HR5A 2JIXD 4JFDD 4YE4L 3CZJA 4F8TA 4M43L 3IJHB 4YDVB 4M1GH 3P77A 5GQBA 2IBGA 2LQRA 3OR6B 5K9QI 3GSVA 4KAQL 4WEMB 4LCYA 5L7XL 3MRCA 5GRJH 1NANH 4M7KH 5C08E 3TC9A 1RZKL 4G7YL 4JQVC 4X6CE 1DANU 2DQFA 5SWSB 4X99A 4W81A 3ZKXB 1LO3L 1FYHB 5A2KH 3KYMA 4LKXB 1IAII 4C56B 3TEUA 3NA4A 4BM7A 4U1HA 3FOLA 4ENED 3LN4B 1CG9B 4LVHC 3V52H 4PY7A 3VI3F 2FD6H 4X7DC 5D1XC 2HLFD 5HBBA 4CMHC 2YUXA 5GZNC 2WWKO 4YGAB 3QPQC 5DJZB 2YOCA 2B1HH 1CT8B 4I8DA 4EI5A 4PIRF 1A3LH 2CUHA 1T04A 2H41A 1FVCB 2ADIA 4XCYB 4GAFB 3KR3L 4Y5YA 2BCKA 5C3LD 2FJGA 1A9BB 4PLKD 4MXVF 1AH1A 2QKIB 3PWUA 3NN8A 1JZ6A 5J6GA 3DV6B 2Z35A 1FNGB 2MQ3A 5JW4R 4OCYL 5BMFL 4NQDE 1IQDB 3RRQA 4JVPA 1I85C 5E8OA 1TCRB 4AK1A 4JFFA 3MRLA 4JHWH 3K4AA 4QOKE 2PF6A 2HRLA 4LHQB 4XNXL 2CUMA 2H9GB 4CADA 1LE5B 5BXFA 1RZ8B 1CGXA 1J8HE 2LV4A 5ABDE 2OI9A 2IQAB 1BVLB 1ZEAH 3K74B 1RZIB 5ACZB 5KSAC 5B39G 4MZ3A 1QQDA 3HUJB 3B8SA 4Q6YA 1WCQA 2X9YA 5F9JB 1Q9WA 1ZVHA 1UM5L 2D0FA 1QEWA 1ZT7B 2JIXA 4E5XA 1FAKT 1OSPH 3LQMA 4QXGH 1C5CH 5F7YC 4X6DF 1R24B 4TQEL 1GC1C 4Z9KB 3U83A 4NCDA 3I50H 4CJ0A 2O61A 1BQHB 3PQYD 4MJIA 3U36A 3O4LA 2OR7A 1OGTB 4M8VA 4ODBD 4OJFH 4XGZA 1CE1L 2JK5B 4U1LA 4G8EB 1T21B 1WT5C 4K8RH 2AQ3A 1ODAA 1QFWL 3EYFA 5GGSB 3FO1A 5F89B 3LCYA 5IGXL 1TNNA 4BZ2H 3GSRA 1QTYT 4S1RL 3QUZA 3Q3GB 2DI7A 1IEAA 1WWAX 4PUBL 5E7BA 3MBED 1XF2A 3VFOB 3FN0H 4HWBH 5TJWK 1HSAB 4MJIE 1I8KA 1OSZB 1U42A 2X1WL 4XP1H 5E6IA 2ICEB 4X4ME 3AC0A 4HKBB 4R0LB 3DGGB 4XPGH 2HG5A 1Y6MR 2BNUA 3EO1B 1FCGA 4WTWA 3WD5H 4ZNEA 4N0FB 4X7TB 4APQB 3N85H 3RL2B 1G1CA 2DTML 1KV3A 3RIAK 3C5ZB 5CCKH 1XCTA 3F7YA 4R90H 5BZDB 2FJHB 1RY7B 3MOQA 1ACYH 3PIQA 4OFYA 3H9SE 5DJ2A 3ILQD 5E8EA 1AHWB 3S37X 4S2SA 1BZ9A 5J8OA 3DHJA 4DK6A 4G8GB 1KIPA 3DRQB 4X7SL 4D2NA 3ZT6A 4IOIA 3FQWA 4XAWL 5L2KD 2AEQL 2JCCB 2Y07L 4P5KA 1NGZA 4NKDB 1NGQH 2NY2B 2XWJA 3MV7A 5K33A 4DWHA 5EOCL 3UTQA 4DW2H 2R2EB 3MRFB 2V7HB 2HMIC 1KGCE 1KPUB 4X4YB 4GW4B 4JGUA 1NMAL 5EA0H 2D3VA 3MOAL 1KJ2B 5A2FA 1L8JA 1R0AL 1X5FA 3BQUC 5LGHL 3H42H 5EIQA 5HY9A 1ZLUH 1IMHC 2X89A 5D7IE 4Z7OF 1IKNC 4O2EA 5I1DA 2NCMA 3KPQA 4KPHL 7CGTA 2HFGL 2CJUH 2HLAB 4DZBA 3PWLB 2CKBA 4HWEH 1RIUL 2MKLC 4L8SB 5C2BH 3LKSB 3TBYA 3CK0H 3FONA 3FO0L 4OZIB 1JHLH 1RZKC 1WC7A 4JN1H 1LE9B 1ZVYA 1MCRA 3WD5L 5IVXB 4DUVA 2ZUYA 5F7DA 3RGHA 1UA6L 2AKRB 2V7NA 2VAAB 4PTTB 5C0GB 2CLVB 3BH8B 4JQVA 3S36H 1S9XB 3GIZL 2LTQB 1EO7A 1BBJB 4JO2L 2OR8A 2AXJA 4LPTA 4OD3L 4X6EB 5DUMH 3RGVD 3FT4B 3FAWA 5F7UA 3CVHB 3NCJH 1QVOA 2UVEA 1F42A 1QFWH 5J1AB 2BVEA 3MV8B 1EX0A 4KC3B 1OF2A 4CU6A 4ZTOL 4MA3B 1Q72H 2NYYD 4ODUB 4JPWH 5I75B 2P45B 4FTVD 5DC4B 4XP4L 1LQVA 4LCYB 1U8JA 43C9A 2NY7L 5HYSB 5CGTA 3GJFA 4PS4L 5FB8A 1NDGB 3DSNA 1F4XL 1PKQE 1OPGH 3E6HB 1KXVC 5ANME 5GSRB 2BVOA 3HHRB 4HT1L 4Z77A 3Q1SH 1QNZL 1U3HB 3MNVA 2FO4B 3DBXA 4LFHD 3EDFA 1J8HB 3GSQA 3ZSSA 1N6QL 2CRZA 2DMCA 2X4OA 2W38A 4HUMB 1YYLL 4LLYB 4HHAA 1AXIB 1P9MC 2F54E 2XQYK 3MA9L 3W9DB 1CE6A 1A4KA 1ZHNA 1CK0H 4KRPB 1A6UH 4FQIL 1YYMH 4Y4KB 5AWNL 5KZCB 3LKRA 1IGML 2VTFA 3H8NA 5HDOA 4OKVB 1BVZA 2NNAA 2VDLL 5EBMA 2B2XH 4ZXBD 5IMKA 5DRWB 2EH7L 3HPLA 4OFDA 3GSOB 2ATPB 1T22A 5L8JB 1DVFB 3B5GA 3MYJA 4IRJC 4QRRB 4Q9BA 4NQCD 3FTGA 1LQSR 3D3VE 1MWAL 4K3HA 4L29B 1ROWA 4NQCB 5FM5O 5IB4A 4V3EB 1V7NL 3IFOA 2VDQH 3KLDA 3WS3B 2B0SL 3RY6A 1X7QB 1VPOL 3I02B 2VLJA 4PJ5B 1LE5A 3DHMA 4NO0B 1N8ZA 2AQ2A 2G60H 4RFNB 5IB2B 3DUSB 4UOW0 2CXKA 3ROLA 2XZCH 1FG9C 4PYHA 4TTGA 1QKZL 3OZ9L 1ZGLM 2XKUA 2QSQA 4XVSH 4MAYB 3F58H 1MJJA 3RL1B 5TH2A 2CR3A 4I3RL 1IC4L 3Q5YA 5ADPL 4WU7B 1FNLA 1C8PA 3UJIL 3DVGA 4JFDB 4EI5D 4BQ9A 2ZCHH 4G80A 4R3SB 2OYPA 3EYSH 3VH8A 1P7QD 3GEWB 3L5WB 1CGWA 3P0VH 5C09D 4HDIB 3OJMB 3KPRD 2Z8WC 1INQB 2I60L 1VEOA 3UTTE 3E3QA 3G5ZB 5EULV 4NN5C 4P5MB 2EH8L 1P84K 3E8UL 2DD8L 1UGNA 3OG6B 2X4NA 4M43H 5FCUL 3ARWA 3UAJD 3ARBA 1ETZB 2UZIL 1YPZA 4FABH 3IDYC 3BESR 4UAOB 2VDML 5IQ9A 4I5BA 1MFNA 4F33A 1U8IB 1IAKB 3MBXH 3U4EB 1MNUL 3FHAA 4U6XA 3KYOA 4NHCH 3VWKB 2W60B 3AB0C 1G9NH 3D85D 5IK3A 5K9JH 4MNHB 1N3NA 2FEEL 4LSVL 5E2VH 5C0NC 1FJ1B 3RNQA 3UPAA 4X6DA 32C2B 4YWGL 2J8UA 4Y1AD 1SEBA 2CO6B 1D6EB 1NLBH 1A1OA 2XTLA 1HEZB 1VKXB 5T1DH 5I73C 4NC1C 4JFPA 4YHYB 1FL3A 5DURB 1I8LA 2EH8H 4CVZB 3IU4H 3MO1A 3O6FC 2E6PA 1NAKL 5FF6A 5JOPD 3GUTA 1A7QH 4XP6H 3S96A 5DJ2B 2ZNWA 4YDIH 2VLLA 2Q86A 4L4VE 4NDMA 2BY0A 3QG6A 1MY5A 3VMNA 2C3XA 2JLLA 1BAFL 1N7MH 3DI2B 5I1DB 1JWMA 3G9AB 4M5ZH 2XG5A 1O7SA 1KBGL 4ERSH 3ORJA 4O5LH 1IQWH 2VLKA 3WNPA 2D7PA 3DO7B 1U8JB 2VXUH 5D7LB 2E9IA 4NPYA 3O11B 1TPXC 4ZPVB 2Q7YA 3TVMA 3D2UD 2P42B 2VDPL 1JFQH 3H3KA 4HK3J 3L6FB 5DJDB 1UCBH 2BVYA 5E0QA 5E70A 5DHYA 4YBLB 4F7CA 3CDFA 1XF5B 1V7NH 5I1HH 5KSBF 5L8KB 5HYJA 4M5YH 3QDGD 3R06B 3WUWA 4R97C 3ARYA 1LDPH 2XYCA 1CDIA 1KB9J 4KUZH 4OUUB 3QJHA 4LPUA 4P46A 1BX2B 3B83A 2RQ8A 4TSAH 2ICWI 5CKGA 2WBKA 4L9LA 1OARL 1V3MA 4E42A 1F00I 1OB1B 2YD9A 5EOQL 2VDLH 3CPLA 3H9SB 1JNHA 5JR1L 1WC7B 4R7DA 1HSBA 3O4OB 1LE9A 5DFVD 2BSRB 1CWVA 2E5EA 5BJTA 5K9KB 1WZKA 5JIHA 2HJLB 3ARFA 12E8H 5F3HB 4QKXB 5DMKB 3X12A 5KJRL 1QG3A 4HS8L 5C07E 1WFTA 4XVJH 3OGCA 4PJFE 3UCRA 3EYQD 1IGIL 1K6QL 5FYKD 2EZ0D 5I1JL 5D2LA 3BD3A 1DANT 4P2RD 4PJCE 3EDDA 2HKFH 1I3RA 2H32B 2YPKA 2QADB 3QUML 4HT1H 3RZCD 4I1NB 3U0WH 2X1OA 1A4KB 4D3CL 3KYKH 4DN3H 4UDTA 3SDCB 2NY7H 2AV7B 2GI7A 2NY3B 3AS1A 1R3IL 4Y16A 3U30C 5I9QB 2AK4D 2I27N 3VH8B 2QTEA 1U91B 4PJEE 1PZ5A 5JLZA 3MRPA 1JPGB 2C3VA 1G9MH 3OKDA 5B8CA 1GGCH 1IAMA 4HG4K 3CC5A 1MFEL 4WTZG 5HYEA 3NACL 2EICA 5DUML 5JA9A 5GGQH 4QHUA 2ZUTA 2R23B 4J7RA 5DJ0B 43C9B 5HYSA 4OLYL 1HKFA 1BWWA 3CFBA 1KJMA 2IF7A 3CDYA 1P7KA 2VLJB 3O2WH 2OZ4A 2YWYA 4JRXD 4CMMB 1S9YA 5TF1H 8FABA 4ZFOA 1T89C 1NAMH 3ALPA 1K2DA 4MA1C 5D72L 3MRIA 3KWWA 1JHLL 1N3NB 2FGWL 4FFWC 4P3DA 2F8XC 5DDHA 1CLZH 2UY6A 4DAGH 4IIQA 4TULL 5JDSB 4PJ8D 4GRLC 4G80B 1VKXA 1JN6B 3VGDA 1M7IA 4O9HH 2HMID 3TH2T 4KUCF 5GGVL 4XCEA 2GSGA 3G5ZA 4H5SB 2Z93A 4CUCA 2P5WD 4JG1H 1PZUB 4LOUC 1BD2E 5ERWA 1FZKA 2VDKH 4PRPD 4XTRC 1GHFH 4QTHB 1U8IA 3VA6A 4D0CA 4Z76B 3CX2A 2NY6C 5E2WH 2BNUB 3WS3A 1EFXA 1IM3B 4BFGA 2CR6A 1T6WA 4G6AD 4QRPD 3STZB 4OCSL 4Z7VA 4QRPE 4HUVB 1XR9B 3RNQB 3QULB 4JQIH 3DMMA 4NUGL 4RDQF 3B3IA 4KGLA 5ISZA 5CJOL 3H9YA 5GZOD 5HHMA 1QSEB 3DROB 3JWOC 1S7XB 4TNWK 3MLUH 1MCJA 5JNYB 4YH6A 1XF2B 3QNXA 1D5BB 1M71B 5DTFB 3MR9B 3VWKD 4X98A 4ZAKA 5FUOL 3X11B 3RWJA 2IQ9L 3FQWB 3T65A 2DWEA 3WNMA 1DN2A 1QFHA 4GKOA 3TH4T 2AP2A 2ERJC 1MHCA 1XF4A 2QQLL 3QCVH 5L8LB 4OZFB 3U1SL 3TYGL 3U82B 2IAND 2YD3A 3KXFA 1NGYA 2CKBL 4X7TA 4LL9A 4APQA 4GMSL 1EEYA 5B39B 1EGJL 5H2BA 4AH2B 1DLHB 4PR5B 3P4OB 3IDXH 3FN0L 4F15B 5C0EB 1K5NA 4HKZB 2D4FA 3TNNB 3VXRD 3T0DA 1AC6A 4YDJB 1NFIA 1HEZA 3OJ2C 1FBIH 4LHUA 2XICA 4O58H 3O9WC 1OAZH 1U8QB 2G2RA 3FQTB 1AJ7L 5JXEA 3QUYA 3CZFA 4PJEA 2IBZX 5EO1A 4FQJH 1KCSL 1JYWA 1ZLSH 4OCRL 2C7UA 5JDJA 1WWCA 3RPIA 4LCCA 1J5OH 2EYRA 4GAGL 2NY5C 1MCKA 5DFTA 2HFFB 1HHIA 1OAXL 5D9SB 5F7EH 3HC0B 3NABH 4PRHA 4QF1A 3DO7A 1G0YR 1QSFE 1WAAF 2DKMA 2K3TA 4GW4A 3DVNB 1UZ8B 2F5AH 4RWHA 4XBEH 5FF6B 3GUTB 1U91A 4PGZA 2BNQB 2V17L 4XBPB 4KDVA 1U8OB 2AXHA 4YDVA 1IGYA 1FCCA 2AK4E 3QO1A 1CICA 1T1WA 1Z3GH 4JDZA 3TN0B 1ONQB 4HGMA 2KH2B 4K7FB 3GSNL 1CT8A 4EI5B 3R1GH 3FZUD 3IDMB 1BREA 4DZBB 1E6JH 4HC1H 4LIQE 4OFPA 4RMVA 3KJ6L 1XFPA 3EJYC 3ALWA 4DJMA 3MLYL 3TBYB 5E4EC 4H1LA 3SE3A 4YUEL 1JHTB 4XWGH 4P2QE 2GW5A 1KEGH 2QADC 3D48R 1A64A 3CFKB 2P1YA 3S35L 3KLAA 1CLCA 5FUOH 2XQYG 4M9PA 4C54A 5E99H 2XA8L 4HAFA 5BJTB 5CSZB 1AO7A 2DQHH 3SDYH 2MJWA 4FQCH 1D5MB 4DGIL 2KL6A 3D1MC 5AZ2H 2F5BL 1PJ9A 1D5XA 3O41B 1XZ0B 1FVCA 2ADIB 3BQUA 5L88L 3T1WA 4YBQC 1LO2H 4YAQA 1PKQB 4Y1AB 3V4VH 3PWNB 4UNUA 5I6XB 4ZTPH 3TIDB 1CXEA 2BOBB 1BFVL 5E00B 4OZ4A 2GJ6A 4ODWB 5IVZA 4EUPH 2P8MB 2E8YA 2VDOH 3LH2H 5F6IB 3CDGA 1KIRB 1IBGL 5L7XH 1KTDA 1Q9KA 2PW1A 3FL7A 4U1GB 1HHGB 3QP3A 1DVFA 2DLFH 5F1IA 4KKNA 4XZUB 5DQ9B 5CHNB 1MAML 3EFFB 2X9WA 5IV2B 5GS0H 3OHXB 4OZFH 5FGBC 4XPFL 2GFBA 5D70L 5BVJB 2APFA 5FK9B 4JDTL 5GS0L 3BAEH 3W5MA 1JHKH 3VXSE 2HH0L 4P23A 3QQ3A 4NWTH 1BGXH 3DXAB 1R5WB 4HWZB 4WCYL 3H2WA 1UG9A 2OQJB 2WUBL 5HGDA 5E1AA 4UDUB 3BPNC 3DGGA 4HUXA 4JFXB 3STBA 2DQGH 1C16B 3QDGE 2QSTA 4OAWA 1KCUH 4GLRI 4PJCB 4XGZB 1BIIA 3MOBH 2CDGA 3S37L 2A6DB 2I9TB 1DBAL 4TSCH 1XCTB 5BV7L 4ZODA 3EOTL 1X5YA 1MEXL 2QBWA 3R0NA 3I9GL 4JGJA 5D8JL 4J4PC 1INQA 1OTUC 4XXCC 5EU4B 1IEAB 3DX6A 3LPWA 4JJ5A 1C08B 4G42B 1LWRA 3NCBB 2ADFH 4RZCA 4WUKH 5CJXC 3BJ91 3S97C 1I1AC 3EAKA 3BGMB 4EDXA 1ZSDB 2DQHL 3SDYL 1F2XK 6CGTA 4BQCA 5C0CA 1MREH 3GFUA 4L3CA 1ED3A 3GM0A 1JPFB 5DTFA 5JZ7C 3RVWD 5F7LB 5LGJB 3P9LA 4XC3H 3IDYB 4WO4D 4Y4HD 1EA9C 1JE6A 3RI5K 4ZOCA 1A6AB 3U0WL 1KEGL 5DFVC 5D7JA 3WDIA 1FLTX 1AGBA 1FIGH 3FT2B 3LEXB 2L0DA 5E4EB 5KN5B 5C09E 1VGEH 1QRNA 4NKMB 4MXVE 5EZLB 1I4FA 3LB6C 5H8DA 1FAIH 3P9MB 2P46B 3GSNH 4JRXA 5HVFB 2Z93B 15C8L 4KKBC 1ETZA 2VWEC 3P40A 4JB9L 2O26U 3VXSD 1KFAL 3VE0A 4FQPA 3OKKA 3VXOB 4HH9B 3F12B 3NIDE 1J0ZA 3UX9B 2AS5M 4OB5H 2VXSH 5HHOB 5ENWB 4OLWL 4KK9D 1PEWA 1GZQA 1JRHI 1SYSA 4R8WL 5MHSE 3TBVB 2FEEI 3P11L 4NM8H 3L5JA 2VZ1A 5AEAA 1G7IB 5SWQA 4EVNA 2A6IB 2HWZH 3QRGH 4YJZL 3EO9H 2AXFB 3GRWH 3IETB 1AD0A 5KANI 1ZGLA 1ZTXH 4R97B 5E1HB 4YPGB 2ATKB 2GCYB 3MR9A 5CSZA 3IKCA 4ZQKB 1FZMA 3QA3B 5T1KB 5CBEB 1OQXA 1FRGH 1TVBA 5TDOA 3RKDC 4Y5VB 5D7IB 4F9PA 2VN4A 1Q0XH 5B21A 2RJMA 3HAEA 3GMQA 2V5RA 1Z5LB 4OI7A 2VDRH 2ORBH 1FG2B 1PG7L 1F90H 2EDOA 5IJKA 3JTCA 1V8HA 1A1NB 2SEBA 2R69H 1VHPA 5DJ8A 5GJSH 4DKAA 3ILPB 4M9OA 1UM4H 3STLA 2WAHA 1UWEL 4O5LL 1S3KL 5ICYB 4KZDH 5JOFB 1EIBA 2E6JA 5KSAA 2P8MA 2FEDD 1F97A 1J0IA 3E6FB 3LVEA 3ARUA 4W68A 5HGAB 3F7VA 3BE1H 1HHGA 5H35A 3DX9A 4EOWH 5T1LD 3T2OA 1FO0A 2YPLB 2DJ4A 3L95A 3OR6A 3EYOA 3ZYIA 5DLMH 1QBLL 5CIPB 2HT4D 1TQBB 1AGCA 3BKCH 4XX1E 5T1DL 5CJOH 5D7SH 3HMWH 2JJSC 1L7TL 1Z9OA 3ZYOA 1T7XA 4OD1L 5HI4C 4LQFH 1MCPH 5T5NG 3QIUB 2BERA 1QZ1A 4HFUH 3LRGA 4L3EE 4Q9RL 5C07B 3HCVB 1IE5A 3GSOA 2VMFA 1T22B 5K9KA 5HDQL 3PQYE 3MXVH 4FQ2L 1MQKL 3IVKA 3RVTC 5BXFB 4X83A 3NMEA 1T04B 4HWNA 4LSSH 4OGXH 3QI9C 4AEFA 1BFTA 1VGKA 2P5EB 3OTTA 3OXSB 4LEOA 4XZUA 4KJWC 4TUOB 5C71A 5I8EB 4Y4KA 3BRDA 2ADJB 1D6VH 1V3LA 1H3XA 1S7QA 3O41A 4P2QB 2C1PA 5DGQA 3P0VL 3UC0H 4JY6B 4S1SH 4JZOA 3QT2A 5FIEA 3CLFL 3RY6C 3S88L 3MRGB 3FMGL 1DLFH 2EDWA 2DQCH 2A9MH 3BZ4B 4UILH 3WEXB 3WFCH 4MQTB 4P99A 4FOMA 4Y16B 4I3RH 5I2IB 4R2GB 4N1EA 1WSST 1WCBA 2EO9A 4NQDD 3WKMH 1RMFL 3ZDYE 1XH3B 3ULVF 5HGDB 5TF0A 4Q58C 1LP9B 1XZ0A 2IMMA 3BQUB 4ZPTB 1DEDA 5DRZA 4OI9A 1T5WA 4ZUTB 5F21B 2X42A 1I4FB 3ARGD 5IV2A 3NIFF 5FYJL 2ARJB 5I19L 4OSUL 2DM4A 4DKFL 3JWOL 4HULB 4J6RH 4Z7WE 2VXVH 4KWUA 3GHBH 1V7ML 4HKBA 3O9WB 2ZUSA 1AP2B 4ONOA 4P23B 4ETQB 3DVGB 4M93B 3O81A 3MV01 1G0XA 1NJ9B 3HI1B 3N0PB 5TPWH 3D87B 2JF1A 2EDDA 3EYUL 1T80A 3DUHA 4WVRA 2NX5A 1G7IA 5SWQB 3SCMC 2J8UB 3PNWB 1J86A 4KRPC 5DZNA 4NRXB 5FGCB 4HLZH 4OCWL 1M6OA 2NQCA 4KQ3L 3SHSA 3ZYZA 5E8EB 1A6AA 4YK4B 4F37F 3V79C 1T2QH 4XCFL 2VC2H 4ZQKA 4U1IA 3WIIH 2HVJA 1XR8A 1FGNH 5ID0B 3OKEA 1QSEA 3KPOA 3B2UD 4WV1C 2C4FT 4HBCH 4X5WA 3TFKA 4QXTB 4WWID 3PWPD 4OCWH 1FL6B 1OTUD 3IDGA 2R9HC 4LEXH 4PD4J 3RVVD 4OGYL 1FG2A 3LAFA 4WO4B 3OX8A 2NLJA 4MNQD 3C5ZA 1ORSA 3FRPG 4M6ML 5CJQH 3EYUH 4UQ2B 1HH9B 2ZSVB 1OAUH 1NKRA 4WWKD 2VUYA 2OL3H 3BKML 4G8EA 4ZTOH 3RBSA 3DMMC 4DQOL 4NRZB 4KI1A 1FNEA 1NBVH 5HGAA 5AYUH 2AJZB 2X4QB 1UADC 5A3ID 3NFNA 5EU5A 3UPRB 4NKMA 1BFOA 3P4NB 5DRXA 4NQDA 5DK2B 2MPAL 1PYWA 5FUZH 1H3WM 3L9RB 4QY8A 3MV11 3PQYA 4MJID 4NQUA 5IEHB 4TPRL 3T65B 5E95B 2IADA 2R2BA 4P9ML 2DBLH 5FHBH 3QDMD 4TVSa 3ABZA 3V6OA 4M61A 3MSPA 4L8SC 2WMPA 4YXHH 5D2NA 2C3WA 1FL5B 4ODXB 5CEYA 4LF3A 2HFGH 3SDDB 2A2QT 4N5EA 2DTSA 4PBVC 4QHNB 4HIHB 5D2LF 3X12B 2CLRB 3GMNA 3N1GC 1NCTA 1I3GL 3WV0A 4MQ7A 5ETUB 2Z31C 4HC1A 5LGHH 1J1OH 3INUH 3X14B 5ADOL 4IRJA 5IKCA 1R0AH 4NO5A 3VCLB 4P2RE 5HHNB 4QNPF 5CINH 3T0BA 1MQKH 3BH9B 3LKPA 1RV6X 2FGZA 1JYVA 3PHOB 1UZ6F 3G6DH 4QT5B 3W2DL 3A67H 4QF1B 1UT9A 5MEND 3GNMH 2X4RA 3QIUC 3GSWA 3TGXA 3ZT7A 1EHXA 3GGWA 3O6FD 4GUPA 5JLZB 2XI9A 4QOKD 5D1ZD 1YC7A 1BF2A 3B43A 4NZDA 4TOYL 2DRUA 4M7LL 3MLXH 1WBYB 2Z8VC 3WN5C 4NN7C 1PD6A 3V5DA 1Q8MA 3BP6A 3PWJB 3CXDH 1BPVA 1CVSC 1LO0H 4K3EH 3PWPE 3ZDZE 4U33A 1HHHB 4XNMA 3V4PL 4N0CA 1IAOB 2OL3B 4ZFFB 1PGRB 5CZVL 1TXKA 4EUPA 1X44A 2H2PC 4EDWL 3KHQA 1S7SA 3HPJA 3IFNH 4XB7A 3IF1A 5FYKE 4XHQA 1H3PL 4ZFOB 3LQAC 2CRYA 4X8XA 2YBRB 1T20A 5E2UL 3OR7A 3HMXA 3DMMD 2N7BA 3KLAB 4RAVB 1L9NA 2I5YH 4CW1A 3F58L 1T03L 1U8MB 3OG4B 4FQXB 4MAYC 1F90L 2ZCKH 2H32H 2EE3A 3VGBA 4HG4J 5F1IB 1M7IB 2QQNH 5CGMA 2VXTL 5D2LE 5HHQB 4NZJA 4HGWB 5IQ7L 1EPFA 3FN9A 4O2FA 3SJVE 1YEDB 2H8PB 4UT7L 2D0GA 3K4ZA 2NXYD 1QOKA 4KKLD 1KPVB 1YN7B 1VADB 5D5MB 3DXAA 1KCVL 3SGEH 3KPSA 1RULL 1NCCH 2BHZA 1I9IH 1UKTA 1WITA 2BVPB 4PJBE 5LBSL 4NKIL 2QQKH 3GBNL 1EXUA 2MHAB 2FZ3B 3W81A 3WIHA 1K4CB 5GRUH 3X3GL 1RZJC 3QXDA 2FYYB 4ONHA 4F7TA 4JFDE 5ESAB 3HNVL 5K59F 3MLTA 4M7JL 5ELIA 3QJFA 3HRZA 1JFMA 3S7GA 3T3ME 2HRPL 4WI3A 1JMZA 4PGBA 3IAPA 3C2SA 3MJ9H 3LPGA 3MA9H 3PJSA 5HHMB 3VGEA 5MERB 3TBTB 3BZ4A 3EFDH 4MCZB 3VXME 2UY7A 2W0FB 2H3NA 4OD2B 5CJ8A 2R4RL 4Q0XL 2X7LA 2B7DT 5I0ZA 4X98B 3T4AB 3VRIB 1JZ3A 1Q0YH 3TZVB 3C60A 3UBXI 3QDJD 3BP7B 2GUOB 4WGWB 3QFDB 4X6DB 5LBSH 4UDUA 4YHYC 5FO9B 4ETQA 5IB1A 5I16A 3MRQB 3BN9D 3LHPL 3MRBB 3KXFB 3QXAA 4G6ML 4JHBA 2HFTA 4XP4H 4EUPG 1ITCA 5FYKH 1OD9A 1KJ2H 4S0TD 4XTRD 4JPWL 3UTOA 1LEGA 2DQUL 3WFEL 4JFQA 2ZSVA 3GMPA 4L3ED 4HD9A 2NTFA 2VKXA 4L4VA 5FO8B 1S7XA 5KTEL 4LHUB 4N0UA 1W72B 1KNOB 1OTTC 3FQNA 1D5BA 1M71A 1S78D 2W60A 2J6EL 5DK0A 3B6SB 4M7ZB 5KAQG 1DBAH 3KPNB 4OCLC 4OIIH 1A7NH 5GRWA 5HI4D 4YXKL 1WAAA 3D3VB 3H3BC 3I3BA 5AG9A 5FA4B 4PG9A 2C3HA 3D3VD 3IU3A 5FGCE 1INEH 3T04D 3IFNL 1KCRH 4AQOA 3P4OA 4EDWH 4NJ9L 2XZAH 5EO9B 1S7TA 2X4SA 4J3UA 3BRFA 2X4RB 3ESUF 2BRRH 2GT9B 3QQ4A 4NQVA 3V6OC 3MO1B 4D94A 3JV4A 3ULUF 2Z8SA 2DN7A 5TE7H 1LEIA 2R4SH 1OTSC 2VRAA 4PP2A 2ZG2A 3OKYA 1G7HA 3GSNA 3V5KB 3VD7A 5DQDL 4HIHA 4UU9B 1CLOL 1AKJD 2F19H 4RFNC 2F54D 4QRUA 3IDNB 2W1NA 3GMMA 5EIVA 1J9CT 1CD9B 4HKXA 2DMBA 4H8WH 4N1CA 2VQ1A 3UZQA 4JO3H 5HTSA 3K4DA 3GJFK 4GMTH 3HI6H 4FFZH 4NO3B 4OLEA 2IFFH 1U2HA 2YR3A 1LNUB 4XRCB 4XPHH 1JGUL 5EOTA 3U9PL 4OLVH 4UMGA 3ARGB 4JM2F 3RHWK 3VD9A 4Z8FH 3KJ4C 4MAUL 4WY7L 4HFWA 4ZTPL 4HPYL 1HIMH 1B4RA 1CGUA 3B9KD 4G9DB 2O5XH 1GCFA 3TJEL 1HE7A 4LVNB 1OM3H 5JIKA 1OW0A 2F53E 4PRBB 4WHCA 5MHSD 1YEFL 1A7BA 2IGFH 4LVOC 1PW3A 3QIBB 1WUNT 3ZE0E 3C5JB 1NCDH 1NEZA 1BQSA 1XF1A 1J1XL 5HGBB 1U6AH 4EBQH 4HS3B 3AROA 5HHNA 1QSFA 1GOGA 4D9LL 1NC4B 3S35H 3I6GB 1CF8L 4FXKB 1SEBB 5FHBL 4HX1A 4J2XA 5LAXA 3FFDA 3RVTD 2J4WH 4UT6H 2IH1A 4AEEA 1PZ5B 2H45A 2QSCL 4MNGB 1MJ7H 2R0WL 3G6JE 3T1FA 3U2SB 5E9DB 1T20B 2FX9H 1XGUA 4M1CD 3GMLA 3QEUA 1QFUL 3IGAB 4R4NC 1S78C 4Y1AE 4WEBH 2VLLB 4BA8A 1YDPB 1OAQH 1WQVT 4S1RH 3KPSE 1CD1A 1C5BL 4HXBL 5C7XL 1P4LA 5IFJA 3U7AA 4QRSB 1ZK9A 1CBVL 3G9VA 3NCCB 3V5HA 1WTLA 5FYJD 5FECB 1I85A 1UXWA 4AM0B 3RY4A 1IM9B 5TDNA 2NXZC 5I1GL 1EMTH 1R5IB 1KENH 4MHHI 4XBGA 1WWBX 1ZS8B 3T4AA 3VRIA 3BIKB 1OWRM 2VO5A 1S9XA 4X9IA 4U0RB 4R7DB 3MRKB 3WJJC 1OGAA 3B2UC 2YUWA 4HLZG 5ANMA 1U3HD 3MREB 2NY3D 3LEVH 4F37K 2QKIA 4I2XE 3WNLA 1VESA 3SDAC 4PRAB 5C2UB 1IKFH 1QSVA 1HDMB 1PKOA 4ZAKC 1HOCB 2WM0A 4ZG1A 3I3DA 4RISH 4HBCL 3OXRB 4KQ4L 1KCSH 5DMIL 2DF3A 5DA0B 1NH6A 3S8WA 3U7WL 4CN1A 1FV1B 4JM4H 3TT3H 4P46B 2VZVA 2AV1A 3LDBB 1N2RA 4L4TE 2Y6SD 2HTKD 3GZKA 4MB4A 1NEUA 5CEZL 5HPOA 3ARPA 5C3TA 2IH3B 3MZTA 3QWOB 4MCZA 5I15L 2YA2A 2ZUXA 1ED3B 1YEHL 4JDVA 1TDQA 4DZ8B 4KMQA 4ZYKA 4GG8A 2PXYB 1I7TB 3LKNB 1IC5L 1XIWA 4PJIF 1D5ZA 5C0ND 2PO6B 1E4XI 3VFGL 2DI9A 1KGCD 2AABL 4NRXA 4DKFH 1MFAH 3TBSB 3DX6B 4JJ5B 4NQCE 5LXGH 5I19H 1YNTA 1N0XH 3QEGH 4HEPG 3MLUL 5ITBH 3SY0B 5D5MA 4A6YH 1YQ2A 1WIPA 3AM8A 2NNAB 4Q97A 1G7JA 4MQSB 4K07A 4U1KA 3T0VA 5F8QC 5HI3C 5I76A 4HH9A 2G9HB 1RMFH 2W0KA 1QYGL 3T77B 4MJ6A 3QUKB 5AG8A 4ONHB 4QOKB 4LVHB 4LCUA 2BSED 3MRIB 5TQ0H 4PJHE 4P5TC 1RZJH 1P5UA 2XN9E 2BY1A 3SCMA 4PJ7B 5JW3H 3BDBA 4XRCA 3ILQC 3DVFA 3GBMH 5KSBE 4UV7H 3KYAA 1EAPA 1HH9A 5BV7C 2BVQB 3QIUD 3GIVB 2Q8AH 3OKNA 1T2JA 1YEKH 3P3YA 2ZWLT 4R4BB 1XGPB 5T1KA 1HNFA 1RZ7L 5TQ2H 4LLUB 4BH8B 4DEPC 3BWAB 3LN5A 2VOTA 1S5IL 2XG4A 4EI6A 2FB4L 2GSIB 1IJ9A 1F11B 3IJYA 1NEZB 4FTVE 3VGAB 3VD4A 5KSBA 4UT9H 3VFMB 1H3VA 1N64L 4DAGL 1EEYB 5B39A 1BJ1J 3U7YL 1CLZL 2FGWH 4YHKL 1I9JH 3VXUE 3V4UL 1PX3A 5DK3A 4N8PA 4AQ1B 3EHBC 3ARDD 4HLJA 5KZCD 2XFXB 3HMWL 4NM4H 4U2YA 3ARBB 3WDJA 1OL0A 2AK1H 5SV4A 1NC2B 3MJ7B 3GHEL 3QQ9C 5TDOB 3ARBD 2CK0H 3UTSA 4DVRL 3DX7B 3C6LA 3OB0H 2YWZA 4V1DB 5T5FH 5GGQL 5C0RH 3RHWF 2BNRE 2GAZB 5A2IH 1OW0C 4EJ1C 1LO4H 1YNLH 1JIBA 5EN2A 2CSPA 1CR9L 2EDRA 3B2VL 2OX5A 3D2UB 5BRZA 3RTQD 3FAXA 2XTJB 3BD5A 5JHDE 4IRZH 3NFPB 4NO0D 3MRJB 4A6YL 2EDXA 4RGNB 1I1RA 3NBNA 1OQOA 4PTTA 1JI2A 1ZXQA 4RGMB 3DX8B 3JTSA 5AAWA 4UU9A 1JYNA 3O6ML 2UUDK 1NCNA 3MACH 1MELA 2DWDB 2WBJC 1HH6A 1YEEL 4D8PB 1W0VA 3IFLH 4HS8H 1S5HB 3BP5A 3TIDA 3DYMA 1P53A 1AI1H 4BUHA 4IBLT 2IG2L 2NY1B 4AG4H 5TE6L 1AE6H 3BZEB 4JLRB 1OT1A 5IBUB 2R1WA 2Q8BH 2KKQA 5FECA 1NLDH 4GAJH 4R6UA 5IW6A 3UZVB 3IF1B 3I85A 3BKJH 3MLZL 2A9NH 3WSQH 5EOQH 1VDGA 1D5MA 2Z35B 5DJCA 5I1GH 2R8SL 5EBWB 4F7CB 1WEJH 4RMTA 2HLAA 1OCWL 5CWSB 3MRCB 4RRPG 4P49A 4MXWH 4JB9H 3VDBA 1MJ8H 1WBYA 1LDPL 1CIDA 3I6LD 2R56H 1SEQL 25C8L 4KU1A 2P5WE 4AJ0A 1MF2H 3SQOH 4JZJA 4YPJA 5FUCE 3I6GA 4A6YB 1NANI 1UCBL 2XA3A 3RX5A 3CPLB 5IOPA 4HUUB 3O8XB 3EYVA 3K3QA 1C1EL 2D0HA 4J3WA 1FSKC 2AERT 2ICWA 4Z5RB 1KIQB 3LEYL 4XC3L 4ODTL 4BSVB 1K4DB 3M45A 4I0CC 3CMOL 1LVEA 1TMCB 3UYOD 1KBGH 4ERSL 3QDAA 3PWVA 4XI5D 3SDXA 1QFUH 4PRAA 1J1XH 1LK3L 3BYYA 1S7VB 5I1AA 5DRZB 1MRCH 5CGYD 2FX9L 4NKQB 1T5WB 1LEKB 4PB9L 1UXWB 3BW9B 3ZE2F 4DOHB 1CGYA 1RURL 2JJTA 1D5XB 2EC9T 1MHEA 4JPKH 3IU4L 4HZLA 3AGVA 4MSWB 4NNXB 4P2OD 4BFEA 3PP4L 3Q3GA 2O5XL 2MTPA 2W07A 1KC5L 4LCIL 3H6JA 1K3IA 4DKEL 2IPKA 5DZOA 2Y5TB 3MOBL 3QUYD 3ZDXE 4M03A 3CFKA 1UZ6E 1ORQA 2XWTA 1JGUH 4UOJA 4PJ8B 5GS1C 2OI9B 4WU7A 2PO6D 4M1DH 4PJ8C 4HHAB 1E28A 5I1CH 3RWGA 3WIHH 3MRBA 4NHCL 4CU8A 2VB5A 4I4WA 1IC7H 5EZLA 2F19L 3VXRE 3MGTB 3WE6A 2EDKA 3UMTA 3SKNB 4LRIC 4O4YL 3AVEA 1H8NA 3PL6D 4OKVA 4UTAL 4RDQG 1OAKH 4DN4L 1EZVY 1X3DA 5SWZB 5CSBA 1CZ8H 2VDNL 3FO2B 2P44B 2DD8H 3OKKB 5DUPL 3QXTA 1TQCB 5CKAA 2VLRE 1HXMA 4FFZL 1KIPB 1T7WA 3DRQA 1OGTA 1EERB 3KPNA 4U1NA 2H2SC 3X17A 4GH7B 5H37H 4PJEF 3WIFB 1W0YT 2VDOL 3B9KA 4ZDHA 3BPLB 4JFXA 4PLJD 1GIGL 5DQDH 1CU4H 4AEIL 1Q9LA 4M61B 5EU3A 1JL8A 1TVHB 4KROC 1QPXA 3V4VL 4NC1E 4Y88A 4JG0L 5IFHL 4C56D 3PDOB 4AIZA 4OV5A 3WLBA 3CNKA 3S5LA 5A2JH 4IDJH 4LSPL 2NXZD 4MA8L 1EHLH 5EZOH 4WI9A 4M02A 1P4IL 4MJ6B 4PJ9C 2OS7A 4JAMA 1ZSDA 2W0LA 1ZHLA 3LS4H 3HG1B 3Q6GL 4N0YL 3AREC 2DQUH 3VFTB 1WISA 1J05A 1S9WB 2VSDA 5SX4I 3QNZB 4DGVL 4NKDA 4YXKH 5B3JE 4QNPE 5ALCH 3Q5OA 1VFBA 4PRPA 5J0BA 3U46A 2OTWA 5J1TC 5KSBB 1DVFC 3LQZA 3L3IA 1KN4H 1TJGH 2HT2C 5F88A 1AHWA 3C6LC 2CH8A 2I9TA 4KRPD 5FM5M 4Y4KD 4PTUA 3VG0H 3TO4C 1E6JL 3I2CL 1IAKA 2BC4A 1MCBA 1II4E 1CK0L 2W65B 1DL7L 1UWXH 4WNQA 5C0CD 1CXIA 1TTFA 1ZHKB 2ZZUT 1KB9K 3I6KA 3MV9D 2R2EA 1H3TA 3MRFA 4NNPH 5DJ8B 1IGFL 5C0CB 3PGFH 3VXPA 4YZFF 4YNYB 2G5BB 1JPFA 1C1EH 2Z31D 3FT3A 1U36A 4YQXH 5ICXA 1LO5A 3MUGB 5GRUL 4XVUC 5TDPA 3X3GH 1NGYB 2YKLH 1ZKAA 1UACH 5L9DL 5GZND 4JFYB 4QHMA 3OAZK 1CTOA 5D6CA 5C0EA 3C5SA 4PJGA 3RVXD 4FFVD 4CVZA 3VXRA 3L5HA 4NNPL 5HPMB 3QUXB 4G6FD 4YO0B 5LAXB 2YPLA 4LPYA 1MCQA 4FA8A 4WRLA 3CAFA 3DRTA 4Q2ZA 3UTTB 3UTSD 4FQJL 2VIRB 2BMKB 2P5WB 1EV2E 1S7VA 2DLHA 3I2CH 2FO4A 3DBXB 4MDJA 3WSQL 4Z7UA 4HIJB 4MVBD 1X6NA 2K9UA 3BKJL 3P0YL 4CKVX 4MSWA 4NNXA 2NZ9C 3TVMB 2JTDA 3V5HB 5A3IC 1A5FL 4RGOL 1MCWW 3KXFE 4YBQD 2UZXB 5E2UH 2LTQC 3IFLL 3RWDB 3T4YB 3MYZA 4I77L 4J4PD 2AEPL 4PLJC 5ESVB 4L8CB 1WCBB 4NCC1 3E2HA 4JLRA 1BQLL 4DCQB 4ONFL 2X4UA 1U3ZA 1P4IH 2L7UA 1T1YA 5EZOL 1EFQA 3HE7A 5C0AA 3MGAA 2FH6A 1B0WA 3VGAC 3H9HB 1XCQA 3BEVB 1I75A 4YR6B 1X5LA 2FWOB 4HS6A 3X3FH 5HGHA 1CFVL 4IRZL 3H9SA 4YHZL 3SGJA 4TOYH 1F8TL 3BW9A 4R96A 3T3PF 1T6VN 3WS6A 3O9WA 3UJTL 1N59B 1JTPA 1FQ9C 4XPAH 5CZKA 4L4TD 1T0MA 4ZO7A 2FATH 5JOFA 1NMAH 4YXLL 1LO4L 1PQZB 4OM0L 1KT2B 4GBXD 3EO0A 3MRRA 3W2DH 1WFOA 4XXDB 2NY2D 3GK8L 1K8IA 5EDXA 4K3EL 1U8HB 1LO0L 4K23H 1BF8A 2V2XA 4XNUH 3O4LB 3QCTL 5I74B 5ALBL 5LWYH 2HFEA 1AQDA 3HZVA 2EKSB 4D0BB 3CVIH 3BMWA 5D7JC 3CXHJ 1A7OL 2Y07H 2AEQH 4NQXA 3MRNB 2DAVA 1QFPA 4A6YA 3NPSB 3P9WB 2P5EA 3ULVE 3INUL 2ESVD 5TGBB 4Y19A 2C4FU 2R0ZL 5T3XL 4K3JH 3NPSC 5I1CL 3QZWA 5DVNA 4MJ2A 4YHKH 1GGIL 3N1MC 2X4NB 2DLTA 1G6VK 1ADQL 3G6DL 1MCEA 4U05A 4U1SB 4GKNB 3RIAF 1S9KC 1AXSA 5CLWA 3ARBC 3H0TA 4DKEH 2UWEF 3W0WA 2P47B 5I1AB 2YPVH 4P9MH 4XPGL 1K8DB 4PRID 5JOPE 4E41B 1UWGH 3X13A 5DJXB 5JPMB 3SOBH 3DUSA 4LRNL 1ZLVH 1PG7X 2UWEB 3QQ4B 2BX5A 4IRSD 3TV3H 3G6JB 3IXAA 3LN9A 5JHDA 1WICA 5CEXA 5I8EA 4I4WB 1ZV5A 3A6BH 4LSTH 3AY4A 4F15C 3UDWA 3FQXB 4PPTA 4X9FA 2Y5TA 4RMQA 5IJKC 1JV5B 3CMOH 3FOMB 3BUTA 5E9DD 3PGCB 1KJVA 3P2TA 4Q6IB 1G0DA 4WTZA 4PJ8A 2ERJB 4LLMB 3BXNB 4I48B 1SYVB 3VW3H 2GSIA 1IFHL 3IJYB 2NYYC 1I7RA 3RGVA 2CO7B 3EZJB 3HC4L 3MROB 4M4PA 4XMKH 2M8XA 3KPRA 1R3LB 3QULA 4KKCD 1A4JB 1OHQA 5IB3B 3MLRH 3QHTC 5F7WC 4OGYH 2ESVA 4PRDA 4P2OA 5INDB 2P49B 1PY9A 4NQEA 1M6OB 5IHUL 1HQRB 3MXWL 3KPRE 3GB7B 4NO2B 3QAZB 3S9DB 4E0RA 1ZEAL 4Q9QL 2DS4A 5C9KA 2CDEA 4PB0L 5HYQB 5L2KB 2F53A 4XNXH 1JZ2A 1A1OB 1HILA 3TPKA 3FO9A 3O6LH 3QZWG 5IHZA 1DLHA 2CPCA 1L0XA 5ISZD 2DI8A 4JM4L 1IKNA 4QHNA 5FYLD 4JHAH 4X7EC 1NL0H 1CFTB 2XKSA 2VC2L 3QG6B 4P5TA 2VLJD 3MXWH 3TWCH 3GJEA 1MVUB 2HJLA 1NKOA 4PJDB 5D93B 5J12B 1NUDA 1CL7I 3DIFA 5B38G 2Y6SC 4XMKL 5C0DB 3HC4H 3KNBB 5HDBF 1IFHH 4JPVL 1HHJB 1KIUA 3HFMH 3W11C 5A16A 3G5VB 2HVKA 2VDPH 3G08A 3NIDF 3V52L 2ZUVA 3CDCA 2XWBA 3GSWB 4DGYH 3FFCA 2BNRB 3FFDB 3GMOB 3QISA 4J6RL 2N56A 3WFHA 1IAIM 5HYJB 3TFKC 5FDWA 3ZO0A 1IGYB 4P9HC 2I9LB 4ZNCD 1JGDB 2FR4A 3QJHB 3QWQB 1G6RA 2EYRB 4NT6B 3U6RA 4WIQA 4GRMB 1NAKH 1T1YB 2RFXA 3JV5A 4LIQL 4FQQB 4Y4HB 1MOEA 3U30B 1IILE 1H5BC 1VADA 1HCVA 3H3PH 3CSBA 5C6TL 2R2HB 3LD8B 4YWGH 5SWSA 4LBEA 3QUMB 4UINL 1P7KB 2APTA 2X70A 3D9AH 4WI2A 3UC0L 1F3DH 3RVXC 1YMHA 3LIZH 4K3JL 1JGVH 3D85B 5GS2H 3MBXL 4G6KL 3VFNA 3RY5A 1QSFD 3PWVB 5F9AC 5JZ7D 5D7SL 1RIHH 2ZJSH 2EC8A 4RX4D 3W39B 4FQ2H 2YZ8A 4U7SA 2ZP0T 2WANA 3PWNA 4M6NH 4P4KC 2CIIA 4NGHH 2AGJH 3GBML 2FHCA 4YR6A 4MA7H 3VGFA 4NJAH 1QO3B 3GK8H 3BH9A 2I60H 1VEPA 3HI6L 3RFZC 4Q9RH 1EBPA 4JO3L 4HFUL 3BE1L 1A6ZB 3FFCD 5JA8B 2OL3A 4ZFFA 2GSGB 1MVFA 1OVZA 2PYED 3OKDB 2PNDA 2GY7B 2A38A 4ODVH 5CD3A 1S9YB 2AJYH 2PYEB 3BMVA 3T0ED 3ALXA 4C56A 4GKNA 1DBJL 2PXYA 4N0FA 3ARGC 1DVFD 3VXTA 1LILA 5GJSL 5KG9B 3OHXA 3JXAA 3DUUB 4PGBB 2YPLE 5DLML 5JDSA 4JPIA 2XZCL 1X4ZA 4I13B 2NX5E 1W72A 4D0BA 4F2MA 2WK2A 3C8DA 2EEAA 3GRWA 4YDLB 4U0RC 3SGJC 4XVUD 4KH2A 2WP3T 1UVQA 4UV4L 5SWZA 4I77H 5CEXB 1IGCH 4NHUB 1YEHH 2XWJB 5E24E 3CSGA 4MAYD 1T5XB 4H25A 3DURA 3QRGL 4WUUB 2ARJQ 1PG7H 1OLLA 4WWKC 3O3AA 3P0YH 2H6PA 1ZE3C 2O61B 3ZHLA 4FXLA 4XB8A 2FYYA 2D9CA 3H9SD 3OQ3B 5ICZB 1ITBB 1TZIA 3QEHA 1PY4A 2IJ0C 1A6UL 4IOSD 4MXQC 4RISL 4RMSA 4L3EB 4PRPE 4AEHH 1ZAGA 2R1YA 2HT3D 4PGDA 1U9KA 3DWTA 5JNYA 1VGEL 2EDFA 3CH8A 3FQXA 1RHHA 4X6CB 1PFCA 1U8QA 2VZUA 4YLQT 3MBEA 5HHOE 3PGDA 1D9KB 4WGVB 1I8KB 4I0PA 3GSXA 4M48H 5JPMA 2FZ3A 4TVPD 1LNUA 3WIFA 4X6DE 5IB1B 2ADGA 4MD5A 5E6ZA 1FDLH 1IGFH 5EIIA 1X5JA 5I8KH 5DUBB 5GJTH 5HSFA 3BPCB 1OP9A 5C7XH 5EO0A 4MVBA 4XPBH 2HRPH 3AS3A 1CYGA 1FO0L 3Q6FB 3OGOE 3LKQB 1RUQL 2D7TL 1MCDA 2NZIA 3DVNA 4JZNA 5DHYB 3S34L 3WHE0 4G7VH 3VG0L 5DD5L 1YPZE 1MJ7L 5BS0B 1DSFH 1U8NB 1YECL 3CMGA 4WFFE 2QSCH 4L8SA 1DJSA 2FJFB 1KCGC 1MEXH 3EOTH 4RGMC 1QBAA 1T66D 4S1QL 3VFSB 3OX8B 4TSCL 4WHYH 4FFYH 4UIKH 1CF8H 1QACA 3HZMB 2UWEE 3GIZH 3S36L 2G5BA 3N9GH 4P2OB 4K8RD 3SDXE 3FJTA 1KPUA 3A6CH 1FIEA 3CK0L 3EOBA 5C2BL 1BZ7A 3BYTA 4YDKH 1GZPA 1EO5A 2ZNXA 1JHKL 1BOGA 3IS1X 4MWFA 2ED9A 3ARZA 1CFSA 4HQQH 4HPYH 1B2WH 2Y1VA 1YEJL 4LSQL 2FR4B 3LS5L 3FO9B 3H42L 5CIPA 3VD3A 2CKBB 1H3PH 1RK1A 2D4DA 1RJZA 5HHVH 3D3VA 2DKUA 1A6ZA 3FONB 3QDMA 3JVGC 4KGJA 1FE8L 1BEYH 4LLVB 4NKOA 2ICWB 5F9WB 2AKRA 2V7NB 3BAEL 3CXDL 3BO8A 4JDTH 4P57B 2NY1C 1LD9A 4CAGA 4LGRB 2V5SA 1A3QA 4GAYA 4UTAH 2QR0A 4G5ZH 5T3ZL 4QCIB 4YC2B 4H88H 4JR9L 4EXPX 4OF5A 4JVUA 2UZYB 4XXCA 1XGTA 1NFKA 2ZCLH 2DLFL 2N1KA 4HIJA 3NAAL 1FHGA 2W9DH 1A14L 5CS7A 4PDCE 4QRUB 3TZVC 2Z91A 4UTBL 4K9EH 1C12B 3SJVA 5L2JB 4LPVA 5EBMB 3ZTJH 4PJIA 3KPPB 3LQAL 5FDWB 4LNRA 4HEME 4HF5L 3KPLA 4U4BA 5KVGH 3SGKC 1XGRA 4BSVA 1VACA 3G5XA 4QRRA 2EIDA 3MRGA 3SO3C 1N6VA 3EYOB 1E6OL 4G3YL 2W9LA 5HGGS 1NFDB 1H8OA 5FV1L 4MDIB 1BM3L 4XXDA 1I3GH 1T83C 4QO1A 4Y5XC 5JXAH 1ZOXA 2DDQL 2AVGA 1AR1D 3SQBA 1H15A 4QHLA 1RU9H 3I02A 4QLRA 2DQIH 3GSQB 3BHBA 3VFWB 1DQML 3T2QA 5D2NC 2EDBA 4FXGA 4NBZB 4YXHL 2BHYA 4KI5D 1N4XH 1QR4A 4F3FA 1YPZB 4PGEB 3L5IA 1NSNL 1IAOA 1ZLUK 4K8RL 4CBPA 1AXTH 2X4TA 4V3DB 2VITB 3SKJL 3O4LE 4DZ8A 2XOTA 1H9VA 1KLUB 2MQ0A 4U1HB 4YUEH 3BIKA 3OR7B 5T3ZD 3IFPB 4RFOL 2P24A 5BW7C 5DVMA 2HT2D 4YZFE 5IMMA 1MF2L 4I3SH 3V0WL 1FYTD 3ULSA 4JFFD 4QXGL 3EFDL 1EFXB 1YNKL 5GIRA 2OK0H 1Z3GL 2CK2A 1S7QB 1YPZF 4GQ9L 5E2TH 5DS8A 3LDBC 1VB9A 3C60C 5JW4M 5KSVA 2ITCA 4M7JH 1G7JB 2FJGB 2ZKHL 3JWDC 5E2TL 1U8NA 1X4YA 2LU3A 1UB5A 2R1XA 2DMKA 1ZHLB 4NKIH 2Y25A 2C3GA 3TM6A 5TE6H 3RDTA 5C86A 4KUCD 1RULH 9CGTA 3TJHD 2FHBA 1FJ1A 1JWUB 3BISA 3MREA 5E6YA 5HJ3B 4PRPB 3TYGH 1D6EA 2AEIT 3WN5B 1ZLSL 4MLSA 1NUFA 2A6KA 3HRZB 2H2SD 3RVWC 1CTNA 4LKCB 4L29A 3AFLA 4Q6IC 4RAHA 1FBIL 2X5PA 3FT2A 4XNZB 5C07D 2E7BA 3CIQA 3WNNA 4ZUVB 3VD5A 4F7MB 1N4XL 5FOJA 5FFLA 5FA3B 2CGRL 3NCYS 1TZIB 1CIUA 3ZYJA 3MCKB 4NN6B 2ATKA 2Q86B 4OLXL 1I1AD 5LGJA 2DDQH 3FHQA 5JXAL 1E4KA 3C2AL 1HSAA 1D9KD 4HSQA 4JQIL 1BM3H 1QLRA 1VENA 2QQLH 2P5ED 4M3JA 4OCSH 2Y4SA 4YK4C 3M17A 3F12A 2WLZA 3PNWA 3VFRB 3OPZH 2OTWB 4WFED 1P7QA 4GG6B 3PL6A 1DZBA 3VJ6B 5BV7B 1IZJA 2VXVL 4HF5H 3ECBB 4QGYA 1A4JA 3P30H 1BVKA 2ED8A 3QUYC 3TBSA 3OB8A 3PIQB 3L3HA 3KS0H 4HMCA 1TITA 3BDXA 2WZPD 2ZCLL 1NGWB 4OLUH 4NQDB 4C83B 4K71C 4ODXA 5CEYB 5EUKA 5IMLA 5DWUH 2DQJL 5GISH 2YK1L 3GM8A 1ZA6A 2ICEA 1I3RB 2H32A 2YPKB 4YE4H 5C0JB 3BWAA 5CP7B 3OKOB 2HKHH 4WENB 4YNYA 1NCBL 5BRZB 1GHFL 2VL5B 2A9ML 1G7QB 2O5ZL 2FB4H 3SDAB 3ZDXF 3SKOA 5D2NB 1YEGH 2IFGA 4L4VD 1D6VL 4NPYB 4GW1B 4X7FC 5HHVL 5J3HD 1FFRA 4I2XA 3MUHL 5F7HA 4WI7A 3QXWA 4HK3N 4POZC 2F58L 2RHEA 5I9QC 1CXKA 4MDJB 4AMKH 2GJZA 1FGVH 1NDMB 5FXCH 5HDQH 1EBAA 3RVVC 2X05A 1YEIL 1MIML 2QV2A 4G9FE 5TQ0L 4M1CC 4Y1AA 5SX5H 4OCMC 2HJFB 5J4MA 3ROOB 1U41A 1MCPL 1N59A 2J8HA 4HJJL 1DQJA 4FG6C 4IMLA 3T4YA 2Q87A 3D69B 3S4SB 4LU5L 2CLRA 5DDHB 5BS0E 3HZYA 2H1PH 4X8JA 3QFJE 3BKCL 3QPXL 2WW8A 4NZTL 4NQEE 1MFBH 1QBLH 1Q9OA 2ZOLB 3RI5F 3UEZA 3QPQD 1NBQA 4MNQB 3BGFC 4ZOBA 3H9HA 4AIXA 1IGJA 5DMKA 1G6RB 2AABH 2QR0B 4HV8B 3LY6A 1QVOB 1R3JB 3WL9A 5I8CB 2VAJA 4G43B 4WU5B 4KTDL 1U3YA 5DF0A 1QHPA 1RUQH 1B0GB 1QRNE 3H7BA 1IGIH 2DQFB 5T33L 4LVNC 4YFLI 4ZUTA 3ZHDA 2E7HA 1EUUA 2ADJA 5FM4A 3SDCD 2X1QA 3C8KB 2NR6D 4OFVA 4E42B 2R69L 3OAYH 4P57A 2J5LB 3RIFF 5E2JA 3BZEA 1FN4A 3OAYK 3T2NH 3FKUS 3MRJA 2J88L 3SKMA 4C4KO 3TT3L 2OSLA 4JFOB 5I8OH 2XPGA 5ACLA 1HN1A 4JRYA 4UZGA 4AEHL 2K1MA 4XVJL 3WXVL 4XNMB 4TUJB 2IEPA 2BCKB 1UEYA 5GIRB 2DYPD 5KOMC 4PJIB 3HB3C 4HUNB 1WT5A 4CNIA 4OIBA 3I75A 3IAGC 4NZUH 1FNGA 5HDLA 4JM2C 6FABH 4Y2DD 1BJMA 3RKDD 1T83A 4Y5XA 1EXUB 3V0AC 1KENL 2OZ4L 3B9KB 4KHXL 1UCTA 2ATPA 1CDYA 5E6ID 3ZE1E 2H9GA 3NA9H 3ECBA 5DZLA 4JKPH 3WO3B 1OAQL 3BIAX 4Z0BH 3DTXA 2H6PB 5FYJH 3JUYA 2FLRT 3CX5K 3D5OF 2EE2A 4KTDH 4PGCB 1IL1A 1EDQA 1TIUA 3KPTA 3B5TA 2R0WH 3REVB 5BVPL 4D0DB 4NUJA 1A7QL 4XP6L 2DQEL 2X9XA 4PRNA 3ZSTA 5CD5D 1SY6H 1DBBH 3BSZL 3O3DB 4OZFG 4HBQA 2JJWA 1WBZA 2AJUH 4MS8D 3L5XL 1JF5A 2OP4H 2HP4A 3VE0B 5D96C 3O8XA 2P24B 4D9LH 1EH9A 5J1SC 3QDJA 4P4KA 1IQWL 5C0BD 5F8RC 4UILL 5HHOA 1DBMH 5DGRA 2DQCL 5GRVK 1I7TA 3LKNA 2QJDA 1YJDC 2GEEA 3GDBA 2NW2B 2OTPA 3B8YA 4XAKD 2YSSA 4KK6D 5J89A 4MYWB 4U7MA 1CFTA 1OM3L 3QEHB 4KKCC 1BHGA 2EDHA 4LSSL 1C5DA 5D5MF 1ONQA 2ZJSL 3O2VL 4O51B 4WI6A 5FCUH 4MCYA 4X5LA 2EDTA 4P5KB 3VXMA 1JPSH 3LSOA 5FO9A 3VFVA 3OF6D 4C83A 2K7QA 4LSVH 4PP2B 2C26A 4J3OC 5INCB 2EXWC 4HMEA 3CFEA 5DFWH 1CN4A 4FQLH 2MNUA 1RZFL 5BZDA 4N9OB 4X6FB 4ZUSB 2J3SA 2F8VA 3V6ZB 4FABL 5ADPH 4FN0A 3E6FA 5BRZE 5HY9B 3HAEG 4WJ5B 3NOIA 4R4BA 4JN2B 1HWGB 4PJDF 4R2GD 1G9MC 3MNWB 3BSZH 3I6KB 4U1MA 2IANE 3NH7H 4KJYA 5IQ9B 3GMNB 2D03H 2CQVA 1FLRH 4EKXA 5LCVL 5ID1B 1OWWA 3KYOB 4QTIL 5I17B 1INEL 4JM2B 4QRRD 4LPXA 4PV8A 1TPXB 4YGVB 3SE8L 5I1LA 1P69B 1S3KH 4XH2A 5C0JA 3B4NA 4OF7A 4YHLL 4XVSL 4OZFA 3IS0X 4Y7MA 5DRNB 4ELMA 3RWFA 2YD4A 2VLME 2OZ4H 3LV3A 1KTDB 1Q9KB 1UB6A 2FL5A 2PW1B 4IHOA 1B9ZA 1NC4A 4OM1H 5EB9A 2F5BH 3TN0D 5I0DA 1FPTH 3QDGA 2NY2C 3LKPB 1U8MA 1DEEB 1XAUA 4H20L 1ZTXL 4RBPK 2BSSA 1FVEA 4B7IA 2GK2A 4O02H 2EIZB 2C7UB 2DQDH 4A2LA 3QQ3B 4KKLC 5C0FB 3QB7C 4JZOB 3GJFB 3P11H 5EPMB 5DD6A 3CFCL 5CIPH 3UXFA 4Q7DA 4TRPL 5FEBA 1KB5L 3HC0A 4FQXC 3O6LL 1QR1A 1IGMH 1OPGL 5FOBA 4RAUA 5E9DA 4WO4C 3TPUA 1KFAH 3V7AG 1MCNA 4JVWA 5F3HA 2ZUQB 3C6SB 1W0WB 4KK6C 3QQNA 1TZHA 2WUCH 1ZHBB 1P6AB 2R39A 1AQKH 3QIWD 5F6HI 1BJ8A 4X80L 1M05B 3ROOA 3REVA 2QQQA 3G6JF 3KYNA 5I1IL 1GL4B 1HKLH 1FIGL 1KTKE 3JUZA 4RNRA 1BLNA 1OB1A 1HI6A 4KVNH 5SV3A 3CFDA 1OGAB 5AD0A 2ENYA 4HJ0D 5J57B 1JPTL 1CXFA 1ES0B 5AYQA 1OGAD 3PE9A 5IUSA 3HI1A 4OCRH 4W6WB 2BSTB 5J9PB 3SKJH 4YO0A 1UA6H 1UJ3A 3OF6A 1A1MA 1R24A 5IQ7H 2A6DA 2YZ1A 4KDTA 4JQXC 4NQSB 3ARXA 2QQNL 1CD1B 4P2RA 5IFJB 5BQ7B 2XQBL 1CQKA 1UYWL 1ADQA 1X7QA 4PP1D 1DQTA 4XMPH 4RA0C 5F96L 1MWAA 3EFFA 4PRHD 4LSTL 4E41E 4F7PA 5TDNB 1KB5B 1LP9E 3RWCB 1H8SA 4KJQD 4IOFD 3T0WA 4KTEL 5CEZE 4L4VB 4GLRH 4GS7C 5ACMA 4D9QD 4NC2B 3QCVL 1RUKL 3U48A 3VFOA 1X9QA 3NZ8B 2VXQH 2BOBA 1EEQA 2Y7QA 2FNBA 1OAYH 4JANA 1K4DA 1PQZA 3W5NA 3F65A 3LQAH 3MV8E 3NTCH 4JRYB 4YHPA 1A22B 4Y4FD 2J8UF 4MD5B 5EIIB 4K9EL 4X4XB 4WDIB 1DFBH 4KPHH 1AR1C 5ICZA 3BGFB 5EOCH 1AD0B 1HQRA 2CDGB 2VKWA 3OJDA 3P9MA 1ZWIA 3JV6A 4CDHA 2QHLA 3ULUE 4H88L 1NC4D 4JR9H 1EEZB 3MOAH 4PYGA 2OXGA 5DJAB 2WNGA 1MI5D 3OKNB 4LCWD 1KNOA 4KTYA 3UAJC 3EO1A 4FS0A 1A7RH 2L7JA 1J88A 5DK0B 3IDIA 4QHKI 3SDXF 4ZSOB 3SCMB 5CCKL 3KS0J 2DTMH 4WI8A 2GY5A 4OM0H 4PBWD 1YZZA 3MNZA 3BN9C 3OPZL 5MEOB 2HFEB 5IVXE 1UM6L 1JBJA 1GPOH 5GGVH 1U92A 3LS5H 1JF1A 1O7VA 3TFKD 4YHIA 4N8CL 1U58B 3RDTD 4FQCL 1T7ZA 1KN2H 1SBSH 5CJXA 1F5WA 2CGRH 1P1ZB 4YDKL 5FA4A 2EDYA 2XQBH 4MNHA 4B5EA 4S0UC 3W0WD 2A74A 4G9FA 5D7KD 3EDEA 4M62L 1E4WL 1KEML 3F7YB 3HNSL 4X6BB 1NGPL 5FYKU 1YY9D 3O2WL 1SQ2N 4NHUE 5KSAB 5DSCA 4GRLB 4R2GC 3GIVA 3QEQE 2MPAH 3BD4A 4XH2B 4HC1L 1XR9A 2A1WL 4YEEA 5T1KD 5KN5A 4Y0GA 1DSFL 1YECH 1T4KB 1NFIB 5EU6D 4BZ2L 5IGXH 5J6HA 1FFNB 5LVEA 1EJOL 1N5YL 4Y5VC 1R5VA 3KLSA 3P0GB 1EEUA 4JREC 5EUKB 2PXYC 3CZFB 5EO1B 5E6IB 2C9AA 5EU7E 4ZO9A 4ZFOL 1DQQB 3ISWA 4KI5C 1YNKH 2BNRA 5IT2H 4X6FA 4ZUSA 1U0QA 4LAQH 5EBLB 1BJ1H 4J12A 1J1PH 3VDAA 2BSRA 1QA9B 1JMXA 5H2BB 3KPLB 5JHLH 4NYLB 4YQXL 3O3UN 2OR9L 3D69A 4XBGB 3UTTD 5GGUB 1FGNL 3WIIL 4XBPA 4JY5L 4CW1B 1ZLWK 1A0QH 4O58L 3QHZL 3RWHA 5M94B 3LKSA 5F7KC 1DL7H 4N0CC 3D6GA 3TLRA 5C0BB 3PXHA 3PUCA 5EOCJ 1C7TA 2B1AH 3VXPB 3IDXL 5MEPA 3MTRA 4LNVA 5ICXB 4O2CA 1FV1A 5JXEC 2XRAL 4IS6B 4FTVB 4PGJA 2X70B 4R0LC 2X4TB 3VFUB 2C1OA 4YFLF 3K8LA 2VYRE 5EBGA 2J1KA 3S4SA 2ZSWA 1YMMB 4KI5F 3I84A 3HZYB 5C0AE 1K3ZA 2XIDA 2C3VB 3QWOA 5CWSA 4H0GA 1CDBA 1NBYB 1YDPA 3SE8H 1FPTL 4U1JB 4X4XA 4X9GA 3UP1A 35C8H 3SE4C 4HJGB 2G5RA 4QTIH 4FQXD 2B8OT 1FO0B 4XNZC 1Y0LB 3S35X 2W9DL 5LGKA 1TMCA 4U6YA 3UO1L 1AKJA 3L3KA 3PHSA 2IWGA 3EYVB 3RJQB 4NBYB 4F8QA 3PXJA 1O0VA 2VXUL 3FZUC 5HD8D 1LO3H 1UQSA 1TNMA 3ARDB 1HDMA 2WBJA 5CMAA 3FFCB 4FRWA 4K7PL 1JRHL 3HLAA 4LRIA 4B41A 2MMXA 4UBDD 2PW2B 4GRWE 5FKAB 4EN3C 3QRFM 3FRUB 1W2KT 2N7AA 1RUAL 2ZOKB 5IG7B 5F1NB 1JPSL 4JM2D 5IW3A 4M8QA 4X4ZA 3QG7H 2WWKT 2RFXB 2D2OA 4S1DD 1B2WL 4ZUVA 3AS2A 3KJ4B 2IPUG 1RIHL 2YUVA 1LP9F 2CIKB 4P5MA 2E6QA 5FGBA 4JRWA 3SDCC 4F7PB 4FQLL 1T5XA 1IC1A 1RK0A 3O6FA 4LDEB 2FO1A 3A6CL 5K9JL 1G9NL 2A6JA 3D9AL 4KV5E 3CDGB 2P8PA 4V2BA 1JWUA 2ID5A 4UINH 2GTZA 4CDGC 3NZ8A 2PYEA 3IFOB 1KCKA 4YFDB 1YY8B 3GO1H 1L7TH 4XPTH 1HYSD 1J0HA 4C57C 1I8MA 1A6VH 5EO0B 4IRSB 1CDGA 1QPPA 1F6LL 3QEQD 3LPFA 4M7ZC 1AR2A 4Z18A 1FZJB 4FZEL 4JPKL 3UPRA 4EOWL 2HLFC 2GJJA 5KVDH 5DD5H 1I1FB 1U92B 5H94B 1G9ML 1FNAA 3MBEB 4I0PC 2Y7QB 5GHWL 5IMOA 2MCPL 3NIGF 1ORQB 3OKEB 3MJ8B 1UVQB 5CZXC 1DBML 3R8BB 2EDLA 1F3DJ 4KZDL 1JVKA 5JXED 3OKOA 4X5WB 4JKPL 1BMGA 1CS6A 3OB0K 3ZKXC 4R26H 43CAA 1XGYL 4DGYL 2Z92A 1FDLL 3MYJB 1G6RH 2NLJB 3RZCB 5FDYA 1SY6L 4F9PC 1Q0XL 4OZHF 2DQEH 6FABL 4FG6D 1T0NB 4LFHG 1KPRB 1GRWA 2APWA 3F8UB 4OQTA 5KSUB 2VDQL 2G2RB 1CQYA 2VWEE 5HVWA 1NCAH 5D96B 1JPST 3NA9L 1MPAL 12E8L 1X5AA 3VA2C 3EO9L 3GRWL 3JTSB 3K8KA 3TJHC 1TJIH 3L3DB 3VXMB 4XCCL 1F4WH 3HMXH 3ULUD 2VLRA 4F9LC 5I17A 1FL6A 3IDGB 4L8DA 5LJYH 4R8WH 3QDMB 1CGSL 5JR1H 5L2KE 2VXSL 3SKOB 3ZZ1A 3UPCA 5AWNH 2VE6B 4OV6F 5F93C 1GGTA 3IRZA 1CG9A 1GAFH 1AI1L 5HVGB 1TVDA 3BPCA 5CJBA 1KG0A 3V6BR 2IAMA 1IGCL 2JE8A 3C6LD 1PX4A 5B38B 5HD8C 1FL5A 2CLZA 1KXTB 3ETBF 2VSCA 4PJEB 3SDDA 1IARB 1X5XA 4I5BB 2VLKB 4U49A 2J88H 3AU1B 5EU7C 4CRPA 4YBHA 1HHHA 4K3GA 2P5WA 3P77B 3L3KB 1F4XH 4J8RB 1I8LC 2HJFA 3TBVA 2J7LA 4GKSB 3U0PB 1AFVL 1B0RB 3GMRA 4FQ1H 4HXAL 2Z4QA 4L9DA 3TYFA 1N7ML 5T33H 1G7PA 1S9VB 5HVHC 3N06B 4HUKB 1U95A 4KMTL 3IXTA 1KELL 3O0RH 4JFPB 4P9HL 5CILH 1UFUA 4DVBA 1JGLL 1YNLL 1UB6B 1YQVL 2FL5B 2ILLA 3MV7E 4IHOB 3HE6A 3W9EB 1JWSB 4QEGA 2J5LC 1MIMH 4JZNB 2YD7A 3EUUA 4FP8L 4HGKC 2YS4A 4W4OA 2Z31A 4NGHL 4JEGB 4M6NL 4ZO8A 4GXUN 4I0PD 5I6XC 3BZDA 5C0AB 3MUGA 3KNBA 4WFFD 5TDPB 3BUYA 1C7SA 4PY8I 4MVBC 1AHWC 4LSDA 1Z9MA 3KPSB 1GGBL 2AK4A 1I9JL 4JN1L 1KJMB 4EUPB 2BJMH 2BZDA 2Q20A 3MRPB 4NOBA 1BGXL 5D1ZC 3C08L 2R29H 3BGAA 4NWTL 4ONGH 4CMMA 1J8HD 3NIFE 3MRMB 4MXQD 2AXGA 2VDMH 5H35B 4MS8A 4JFOA 4LHJB 3EJZC 5DC0A 1SJEA 3QYCA 4K3DH 5DJYB 4POUB 2FECL 4TNVF 2EXYC 2FWOA 2YD6A 1ZVSA 1AGCB 4NQSA 4FFEX 3BP4B 5HHOD 5ITFB 3OAUL 5E8DL 1DBKH 1A7OH 1PDKA 4C55A 1RZ8A 3C09B 2QSVA 4P2QA 1KCLA 2Q8AL 4N90E 3MLPA 2YD2A 3LH2L 2R2HA 3EYSL 3WMSA 4JFZL 4X0KB 5D6DC 4P4KB 1NGQL 3UBXG 1MY7A 1AQDB 2ED7A 3GBLA 1DN0A 2YN5A 3HFML 1ZA3B 2G60L 2NW2A 5FKAA 4YHZH 1CFVH 2BVQA 4RX4A 3KVQA 1Q9LB 1IL1B 4TUKH 1AGFA 4HK0B 5F1NA 2CIIB 4MD4B 4RGNC 1MAJA 2XA8H 3VU2A 3UBXB 4G8GA 5E94B 5E99L 1VEMA 2BNQD 4HGWA 3TIEA 3GSRB 3P73A 2IC2A 4M4RA 3S5LB 2FRGP 3SGDI 3WEXA 2BXZA 1WZMA 3RX8A 3VXSA 3RUGE 3SPVB 2KZWA 5D1XB 5K59E 1F11A 2DIAA 3HS0B 4XP1L 1MHHB 1G1YA 5D1XD 1A02N 1B4JL 1MFDL 5FKPB 1NFDA 4OLXH 2IAMC 4PJBF 3OV6A 2NY6D 5DHVB 4ZDHB 3ULSB 4FQIH 2YSSB 1SVCP 4I9WD 4HFWB 3U4BH 1QQDB 3AS0A 1KG0B 1YYLH 3KPRB 3VXUA 4PG2C 5SWSD 2ARJA 1QRND 2BY2A 1HXMB 4U1IB 4I3GA 3PDOA 5ID0A 2V6HA 3TBTA 2K7PA 5MERA 4MNGE 1JNJA 4OTXH 1A3RH 4PJHA 5JHLL 1JGEA 5HHXH 1YJDH 4QRPA 2GAZA 4TQEH 4AT6B