3SPVA

Crystal structure of a peptide-hla complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
publication title Crystal structure of a peptide-HLA complex
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 81
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2011-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3spvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3spvA01
5EN2B 4ORZC 2WLYA 5JQ6L 4QY8A 3QCUH 3MLPA 5I1GH 1C5DB 3WCYA 1F4YH 1U3ZA 3WIHH 4CVWA 3JBG7 5I76B 1EEYA 1SMAA 1CE6A 3VFTB 4QXUL 5D7LE 4MXWH 5I8CA 2AS5M 3PQYB 3H9YA 4NUGL 1YEKH 5IBLC 2OR8A 3GMNA 5BVPL 1A3RL 5E2VL 1CIUA 3P0GB 3FAXA 1S5IL 1JGVH 3EIFA 1Y0LA 4UAOB 1ZHNA 2D0GA 3I85A 1EA9C 2VDOL 2BP3A 3D0LA 5I1JL 2VDNL 1Z0NA 4L29A 2FHFA 5KJRH 4MNGB 2W38A 2FJFA 1FGVL 5EPMA 3FO0H 3I75B 3K8MA 3L95B 5DI8B 3BKYL 1TETL 3HC0A 4IJ3B 1PFCA 5D1ZB 1WBZB 4XHQA 1I8IB 3IDIA 4JFEE 5I2IB 3OAUH 1WSST 5DA0B 4WHYH 4U7SA 1DBJL 5DF0A 2NNAB 2FHBA 4WHTB 4YFLF 1A4KA 4LP5A 5E03A 4C55A 3G08A 3TWCL 5TDNA 5GGVL 4HT1L 1CVSC 3RPIB 4HXBH 4M5YH 4QRSA 2X1PA 4G9FD 2HVKB 5TF1L 5FKPB 5FYKL 5T1KB 2OLDA 3CUPB 5AWNL 4GMTL 5CP7B 2E7LC 1BQHB 4RWYH 1O5DT 3IAPA 3C5SB 1TJIL 2OTPA 4NN5C 2Q6WB 1ED3B 5DJ8B 3MRMA 1HKLL 2ADFL 4KZEH 2AJXL 1RVFL 3BJ91 1KJ2L 1G7IB 4OCXH 1HHIB 4X6CB 1C7SA 2AK4B 5TE6H 5F1NA 1L6XA 4OQTH 1A6WL 2HKFL 5JQHC 3HUJB 3MV8E 4XX1G 3X12A 3MJ7A 1MCPH 3NVQA 4RBPK 3ZSSA 5EZOH 1KC5L 1C8PA 1QQDB 3O6ML 4X7TB 2B7DT 2MNUA 3Q2CA 4MQ7A 2OL3L 2FDBP 1VFAA 3ZE2E 3VI4E 1OT2A 3I50H 3NZ8A 4GS7C 5I19L 3WKML 1DBMH 2F5AH 2R4RH 1BJMA 3RWEB 2HKHL 4PGEB 4YHOH 1NBQA 1IGFH 3VXRB 5IQ7H 2Y36H 3EOTL 1WQVT 1DL7H 3SN6N 4GG8B 1AGFA 2ZSWB 4MQXD 4HJJH 4WW1A 1DUZB 2R1WA 1PX3A 5IM7B 1VCAA 1I1CA 3QEUB 4PIRF 2XTLA 4X98B 5TH2B 1AGDA 1T5WA 3UTZB 3WXWL 3K74B 4JFDE 5BZWB 3L5WB 2CLVA 3HG1E 4RGNB 5D1QD 1ERNA 2OXGA 5GRUH 4U1NA 4JY5H 2F19L 3FOLA 4FQ1H 4OTXH 5CGYD 5AZEL 3ZKSD 3DX8A 4JRXB 3HMXH 5JO5B 3IETB 4QOKA 5I6XC 5HHQA 5DGRA 3TFKA 5H37H 1ZTXL 2GIYA 5CHNB 3ZHLA 2XICA 5IEKB 4FXGB 1WISA 3BSZH 4WWKB 4FZEH 4HDIA 3MJGX 5L2JB 4UV7H 2NY3B 5IK3A 1VACB 2AI0L 5B3JE 4NNYB 2IANE 1O7SA 3KJ6H 1FO0B 1AD9B 3K4DA 4QRTB 5DVOA 5TE4L 2XYCA 1TVHA 2C3VB 3TFKD 4OZIA 4PJ5E 1DLHA 2V2WB 4EJ1C 2YPLB 4PRAA 5DD6A 4QEGA 4UINL 3TN0B 2J8OA 1F58H 1NDMA 3HR6A 2HLAB 3Q1SL 5MENB 3ZE1E 1YNTA 5K9KA 4ODXA 3IFPA 4YK4C 2MCG1 3QZWB 4P59L 4TNVF 4D9QE 3BE1H 4HKJB 3GZKA 5HGDB 2RBLA 4KZDH 3IF1B 1HHJB 4LSPL 3RVXD 2VL5B 1RJLA 5F96H 3S7GA 5B38B 4DCQB 1U8PB 4K9EC 3VW3L 1WZMA 3BT2H 5IB1B 1V3LA 5BJTB 2EE2A 5DMKB 3UJTH 2QL1A 3EOBB 3C8KB 3NFSL 3WBDA 1RZIA 2UVEA 3CCHA 1JPSL 1NAMH 1WBYA 3CDCA 2AV1B 2EC8A 4PJCA 4Q58C 2VDMH 4LLMA 3L6FB 1WVZA 2XA8H 2XA3A 4NHUB 2ADJB 4MA7L 4HH8A 5DLML 1XF4B 1E6JH 5ENWA 3RBSA 1GL4B 3QDJE 2BSTB 4NHCL 2ZCHH 2D31B 4G8GE 3TO4A 3VGHA 5H35A 2EYRB 1MCQA 2AJSL 1I1AA 4U6YA 4ZFFB 5LG1A 5FUOH 3V95A 5EULV 3MLXH 2GJ6A 2UZYB 4IRZL 1CTOA 3PP4L 2WLZA 1CK0H 3WD5L 1NGXA 3REVA 3TLRA 2IAMA 1VGKA 5E8DH 1KT2B 5DJ2A 4LVOC 4IEFB 4JN1H 1U3HA 4WW2B 2HT2C 2YBRB 2ZPKL 3OJDB 2CQVA 1XGTB 2I25N 3F12A 3TO4D 3UC0L 5TJWK 4UDUB 4NDMA 3TH3T 4PJEA 1I1AD 5SX5K 1AI1H 5GSVB 3E8UH 4KQ4L 1J05B 1LP9B 2GJ6D 4HIEB 4POZD 1B9ZA 2XV6B 2FBJH 4LP4A 3QUKB 1OGAE 2B2XL 1X5IA 1H3WM 1IKNA 1WT5C 2YK1L 4KUCF 5E6YA 2IAMD 3L3HB 1X5HA 5F7DA 2YD1A 4XRCA 1AKJD 3VJ6B 4P3CH 4XAWL 1U3HD 4LQFH 4QHUA 3KPRE 4DKEL 1DBKL 2HFEA 3PGFL 3GIZL 3HZMB 1MCKA 3FQNB 6FABL 1IC5H 2NY1D 1OAQH 3U4EA 4BA8A 2A6DA 2BMKB 5CSBA 4MB3A 3FT3B 4BYHA 3VGGA 2IWGA 5D7IB 4I18A 5KSAB 4LDOB 4PJXF 2NY0B 4WO4B 5D7SL 5DDHB 5LAXA 3JV6A 4K71B 5J89A 4V3EB 3L5JA 1IJ9A 4FTVE 2A6IA 2MSPA 4WTXA 1SEQL 2EYTA 1YN7B 4LBEB 1CLYL 4HWEL 5J13C 1MFDH 2NLJA 4KDVA 4JFZH 2DL2A 4PFEA 3EHBC 3PF2A 3TCXA 4Y16B 1S7SB 1OF2A 4L3EA 1NC4A 1UXSA 4KQ3H 3HZYA 2PW1B 1Q9KA 3E3QC 2ARJA 5CJ5A 2EDTA 2R0ZL 5EN2A 2ZNWA 1V3MA 4HPYL 3VD3A 4DTGH 3RGVB 1V5JA 5GGUB 5D2NA 1FNEA 1ZEAH 2F54D 5CEZL 2P5WB 1IAII 3HE6B 4LSQL 4MNHB 4NC2B 3OGOE 4XPFL 4MAUL 4FQJH 1G9NL 1KEMH 4LSRL 2ZSVA 4N0RA 4HAGA 3D25B 4ODUA 3QUZD 5D96B 5I76A 5TGBB 3HHRB 1A3LH 3O3DB 4RGOH 4L3ED 4RRPG 1JHKH 1NC4D 5L0QC 5T3ZE 4LCIL 5CWSA 2MQ3A 2EZ0C 3PWNA 1V7NL 4M6MH 3G6AA 1SBBA 1L6ZA 3QUYD 3ARTA 5E2TL 2AABL 2EDDA 2F58H 3HC4L 4X6EA 2YUWA 3VI3E 1R5IB 3VGEA 3B9VA 1DBBL 4QXUH 2MPAL 1F8TL 1AXIB 1KB5H 2VDPH 3QNZA 4UV4H 1J87A 1JPFA 4U6VL 5MEQA 3GMQB 2FWOA 2V7HB 2JB6B 1T89A 3BP7A 3MLYL 5I2IA 2V9RA 3D6GA 3KR3L 3MLTB 4I2XB 2BNQB 4LLDB 4NKOA 4M3JA 2VL4A 1FORH 3R8QA 4NT6A 3D39E 3EDDA 4ONFL 1FCGA 1MJ7H 4RMSA 3VFRB 4GQ9H 4XP6L 4NQXA 3RPIA 1X9QA 4RBPH 2VDQH 3QWOB 5T1KA 4LNVA 5GJSH 3QRFM 1BQHA 1AH1A 2D7TH 3BX7C 2XKUA 4HF5L 1GGBL 1MVFA 5JDJA 1DBJH 2Q6WA 4HIHA 4Y4FB 5C0JB 1KCKA 4XI5C 2P7TB 4WUKL 4OFDA 4YAQA 1VESA 3K2UL 3TZVA 2Z8WC 4ENED 4IDJH 3H3KA 1WIPA 4B0MM 2HVJB 5IVZB 3FB5B 4JM2A 1XEDA 4L4TE 1FYHB 1NEZA 3ARWA 4YXKH 3IFLL 3VRIA 3D18B 3IXTB 4XPTL 2JIXD 3TO2A 1K4CB 1OWWA 1MEXH 2JE8A 3FQTB 3W9DB 1JWMB 1A6WH 3TZVD 1L0YA 5BS0B 1Q0XH 4RSVA 3SBWC 3BGMA 1N8ZA 5SX4H 4Q74A 2IQAA 1JL8A 4WCYL 1K5NA 1WZ1H 4NRZB 4PGDB 5JW4N 4WNQA 4JM2D 4K8RL 4C83A 1A6PA 3LS5L 3QIWB 2ZSWA 4TUJB 4BZ2L 1R0AH 1JTTA 2C3XA 1MI5B 1BD2E 1K6QL 5IM7A 3PHOA 5HDBE 4X4XA 3HI6H 4X98A 9CGTA 3L5WA 5EA0L 3RAJL 4GXVL 3F62A 3Q5OA 1R3JA 3IT8D 2RAMA 4YHMH 3MMEB 3ILPA 1MFEL 4LHUA 1NFIB 4HHAB 3BPLC 4JRXA 3EOTH 5C0CA 5HSFA 4U1MA 1P4IH 4Q6IC 4PJDB 3LOWA 1EHLH 1PQZB 3IETA 4FP8H 3UX9B 4C4KT 3DBXB 1YEDB 1M71A 4Y5XC 3ERYA 1QSFB 4NQDB 1QLEH 2MQCA 2BSRB 1BPVA 5E6ZA 1A3QA 2V17H 4Y5YC 4AEFA 2NXYC 2RFXB 4R4BA 5DMGC 2DQUH 3DUSB 4JY6B 5AZEH 2M1KA 2P48B 2DI8A 2X42A 2XTJC 2VKXA 3HLAB 2J2ZA 3PL6B 4WFHE 5DHVB 5B22A 1W72B 3NZHH 2CDEB 4LHUD 1Y6MR 5FV1L 5HHVL 4P9HC 5C0CD 4PJIB 1FO0A 5HYJB 3VFSB 4X7SH 2C1OB 5CD5C 1S7RB 4R4FH 5D2LE 3NCJH 4TVPE 5KSBA 3KVQA 1QPPA 2V2WA 3MRCA 4PD4J 5LBSH 4NYLB 4LARL 43C9A 4K3HA 3GKWL 1LDSA 1XH3A 2X7LA 2ITCB 4UZGA 4H5SB 5CKAA 4RAUA 5HD8C 2R29L 1CICD 5D7KD 5EWIL 3QFDB 5C09E 4WEBH 3C5ZC 4LVHB 4GRWE 4K94L 1LK2B 5JIIA 1OCWH 5HGDA 2VXUH 1UB5A 3OKLB 3IF1A 2DI7A 2CLRA 1MLCA 3L3KB 1U41A 1L7TL 4U1KB 5DFWH 3VGAB 1ZE3C 4WTZA 1EEZA 2N4IA 1AQDA 5IVXA 5I1AB 3P11L 1RY7B 3Q1SH 1U58B 4FG6D 5T3XD 4P59H 4OB5H 3DROA 3U1SH 3VA6A 5EBLB 3Q3GB 1MOEA 1A5FH 3GMLB 1CGUA 4XVJL 1WK0A 4HGWB 4G43A 4EOWL 5C1MB 3HNSL 1IGML 3AY4A 4G6AC 4M1GH 2Y5TA 3O4OB 2BC4B 5SX5H 5I18H 2O93L 2ATKB 1S7WA 3LV3B 1C08B 1JN6B 4NN6B 3T2QA 3WFHB 3NFSH 5BZDA 1DSFL 2NY6D 3S37L 1TTFA 1HH6B 1FZOB 1I9JL 3PWUA 3FAWA 4G8IA 1OWRM 1I4FA 4RCAA 5DLMH 1J0HA 5TE7L 1I85C 1HNFA 2AQ1A 4YHNA 1CFQB 1R24A 3V7AE 1RI8A 5ALBH 5F21B 5T33H 1S7QB 5A3ID 2DQCL 2EKJA 5HJ3A 3ZYJA 4IRZH 3IXAB 4ODTL 1KACB 4WI9A 1MHPL 5JHDB 1I7TA 2HH0L 1IBGH 4EBQH 4TNVK 4WI6A 5E9DB 3G6DL 2XY1A 4YEEA 3TVMC 1LNUA 2QQLH 3RVTD 1YNLL 5CMAB 2DQEL 4PGBB 4YFEA 4JDZB 2VZSA 5EFIB 4Y2DA 3GIVB 2DJUA 4LLYA 3TBSB 3WIHA 5C86A 4KQ4H 3WS3B 3WUWG 5JORB 2Z31A 1UYWL 5T5FL 5I1LB 2VLJE 1U8JA 1ZHKB 2YK1H 5HYSG 2HLFC 2IJ0C 4OCYH 2ICEB 3HZVB 1A7RL 1EVTC 3NIDE 3RWHB 1MJ8L 4OGZA 1C1EL 4WU5A 1IGIL 1TPXC 3DARA 4LAJH 4PPTA 4YDKL 3QJFB 3ZE2F 3VI4F 4Y2DD 2YPKA 5HYEA 1GIGH 4GAYB 3TBVB 4LSVL 4AL8H 5CILH 5LJYH 3C6SA 1ZHLA 2XOTA 4KKAC 4POUB 2FECI 1UWEH 2CDFA 2JJSA 4FQIL 5E8OB 2C3WA 2G5RA 3NCFB 2BK8A 3D3VE 3ARDC 1RMFL 2W65A 3HS0B 3LSOA 5KOMC 3REWB 3SDCD 1J5OL 1KLUB 4Q9QL 3HE6A 1MFBL 1RQ5A 4L4VE 1AXTL 1KTKE 1UACL 7FABL 3D25A 4U6HB 2NY4B 3P30H 1MH5B 3DI2B 4G6KL 5DO2C 2Q8BH 4HWBH 3QFJB 3O0RH 4KROC 2ADIB 2H32B 4ZTPH 1JPGB 1FVCA 1OPGL 3BDYH 1IC4L 1T7VA 3LZFL 4PJ7F 3MSPA 5DK0B 3IGAB 3RNKA 4MSWB 4R0LB 1JZ6A 4LSRH 4KMQA 1QUNA 2XWTB 4WV1B 2NY2B 3QULB 4OQTA 1LVEA 3MLSL 4K3DH 2BVQA 2I60H 2VYRE 4PRDA 2AGJL 2EYSB 5F6HI 4RFOH 3PDOA 4DKFL 5EU5B 1LHZA 3GMQA 2V7HA 3F7PC 4JN2B 4AT6A 5KS9B 4OGXH 4F7TA 1OAYL 1TVBA 1QHPA 1KJ2B 1XF5A 3SDYH 5JPNB 1A1MA 1MRDL 3B5TA 5C0BB 4U33A 3S4SB 2E7HA 4NC1E 4JG1L 5DJZB 3VFRA 4YO0B 2J8UA 3VH8A 4O4YL 1DBBH 5F1OB 5I16B 3GUTA 3FT4B 5I15L 4GKOA 4NO2A 4LLVA 3NAAH 4JFFA 1CBVL 3ZE1F 3QEGL 5ILTH 5KVEH 1HIMH 2GUOB 1MHCA 3ILQD 4XP4L 1U2HA 3HNTL 2DLIA 1KN2L 3KYMB 5GXBB 3MCKB 4Q9CA 3BRGC 5IMKA 2OL3B 3RU8L 5BV7H 5E8NA 3MYJA 3MJ6A 2P7TA 1QSED 3I6KA 3G04B 2G75A 5DJ6B 4GSDL 1JNHB 5FKAB 1PKOA 2FB4L 4Q2ZB 4FOMA 1XR9A 1OSZA 2JJUA 1ZGLB 4TSCL 1BQLL 3DV6A 4JFFD 1NGPH 2ILLA 5IVZA 3HMXA 4HF5H 1GGBH 4ACPA 4Y4HC 1MLBB 2YHGA 2J12B 1FG2A 3I3DA 3M17B 4U05A 4QWWC 1DP0A 3CVHH 3VWKC 3V7MA 2HTLD 3QWQB 4CL7A 5GHWH 1ITBB 3D69A 2AJ3A 5AZ2L 3S88L 1XIWC 2UZIH 4HXAH 3L3JB 1TMCA 3UJIL 4YHPA 3MV9B 3AREC 1KIPB 4PLJD 1WWAX 3Q6FA 4K9EL 3ARXA 5DMIL 5IMLA 4XXCA 2PO6B 1HQRB 2DAVA 5E5UB 4FXLA 2Y7QA 3EYOA 4QXWA 1WICA 2J6EL 3OMZA 3QIWA 4LRNL 5FF6B 3ARGC 3D87B 4PJ8B 2OX5A 4XC1H 4XXDB 1MI5A 4G7VL 3RWIB 2FH8A 3QRGL 3EYUH 3WO4C 1QOKA 2BY0A 3BDBA 1A64A 3LVEA 2ATPA 2I07B 2X4SB 5F1KC 3MCLL 3MRRB 5DK3A 3BPCA 3LS5H 3VU2A 1R3LA 1U8MB 4PJDA 2X1WL 3ARFD 4TQEH 4Y5VB 4R7DB 2D7MA 1KXTB 4WGVB 4YBHA 4JB9L 5EOCH 4JDVB 1QSFA 3TGXA 2WWMD 1NSNL 3MODL 2EKSB 1UVQB 4NN7B 4KJYA 2DDQH 3VFWB 3DUSA 3W9EA 1JZ8A 1MFEH 4JY6A 1WCBA 4KDWA 1NCWH 4OIIH 3HLAA 3ESUF 4LKXB 2D7OA 4YDLC 1IEBB 4NQEE 1I9IL 1T22B 3HE7B 5HYJA 3RFZC 3HFMH 2FL5A 5LWYH 4PREB 1VB9A 4ZUSB 3ZKNC 1QKZH 3MREB 1SJHA 3RWJB 4XBGA 4NYLA 3HC3L 2HG5B 2H9GB 4NKMB 4MA8L 1R3HA 4P99A 3HNVL 2QR0A 2ITCA 4H5SA 4X7EC 4EZMA 4D9RD 5HHVH 1ACYL 2A9NL 6CGTA 3V6ZB 4MNQB 2R2HA 3RP1A 4LSUL 1CS6A 1E4JA 2AERT 2C26A 1FNSL 1NMBL 3OKLA 4K7PX 4Z7UB 1C5BH 1F3JB 2GCYA 5DJAA 5C08A 3MYZA 1P2CB 5I1AA 1F4XL 4MYWB 1KYOK 3CSGA 2X89A 4Z7OF 2VAJA 1U58A 3B9KC 5EG6C 2R29H 5EWIH 3NTCH 3QDMB 3T0AA 4QOKE 5EBLA 5I9QC 1QSZA 4NBYB 2BX5A 3MRQA 4PB9L 1UXWB 4RFNB 5L2KA 4PGCA 3ULVC 1GOFA 1BVLA 3EFDL 2FEEI 3CMOL 5C08D 5J1TC 1QRKA 4LSSL 3EOAA 3ZKMC 2D9QB 3ZKQD 4S1QH 4DGYL 3RGHA 3FQUA 4JPVL 2HT4D 2X89D 3D1MC 3F7YA 2OK0L 5I1DB 1B0GB 1A8JH 3PHSA 1D5BB 4I0PB 1T04B 2Q76A 3GJFK 1MCWM 4PUBL 3R4DA 3UO1H 4ELMF 4M9OA 2BOBB 3CPLB 4OZIE 3TYFB 2OQJB 1PY4A 4LVEA 1NGZB 5L2KD 2IEPA 4YHKL 2BHZA 4OKVB 3UJJH 3BKML 5M7QA 1NLDL 4YX2H 1FNGB 5HVFB 3NH7H 4XNQA 1I8KB 4IDLA 3IXAA 3SE9H 5JW5A 4DAGH 4F2MB 4P23D 5JHDA 4UT7L 2AJZB 1BZ7B 4JZNA 1HQ4A 4QRPA 3KLHD 4ZOBA 1IKFL 1BBDL 4YR6B 1OL0A 3ROOA 3WJLC 2K3TA 3H0TB 3SCMD 2XZQH 3FT2A 2BRQA 3BZFB 25C8H 1N4XH 1U92A 3LDBC 4X80H 5DJYB 4Z5RA 2VDRH 5DFVC 5IW1A 2YUVA 4PJBE 3WS3A 5JORA 2HH0H 1P5UA 1WAAE 2VMFA 4V1DD 3QHTC 5E6IA 1OAKL 2MOVA 2BNUB 4QRPD 2YD8A 3CFKB 4LCYA 1RJZA 1FIGL 2DQEH 2EO1A 4AY0A 2R2EA 1IGJB 4XVSH 5EZJA 3I84A 3UTSA 2FO4B 5J9PA 2AXFB 1ZA6A 2X1QA 4KY1L 1Q0YH 3P0YH 1H3PL 1T6VN 1CG9A 2JF1A 3M07A 1KB5A 5E5RB 4RNRB 1N5YH 3B3IB 3WFDL 1K2DB 3GK8H 1NKOA 3ECBB 3DTXB 5E6ID 2A0LD 1WFOA 3ZE0E 4HFUH 5DRNA 3S98A 3OKEB 4PDCE 3QUXA 1MJ8H 2PXYD 4X6FB 4M9PA 2X4NA 1C1EH 3W0WB 3STBA 5A1AA 4YDKH 2YA1A 1A7OL 1RUKH 3ET9F 3UTSD 5FK9A 3L7EA 4U3XA 3MX0A 4XGZA 3RL2B 1XCQB 1J9CT 3O3BA 1WF5A 2DJSA 5FO7B 3DO7A 1YYLL 4XCCL 4PBVC 2QSCL 4BZ1L 3QFJA 1I3RA 1J0JA 2WBJC 1S9YB 3LQAH 5DK0A 4J6RL 4R0LA 1J5OH 1D6VH 4L3AA 1G6RL 4EIGB 4J4PA 4FN0A 5C07A 4N9GB 1KTLA 2DWDA 4DN4L 3VFGH 3WNLA 3QULA 1RZKC 2H1PH 2R4SH 1NCCL 2IPKA 2GAZA 3VXUB 5AYUH 5TQ0L 4HGKC 2VSCA 3CDGA 2A1WL 1TFHA 1EHXA 3N1MC 1PKQB 1SYSA 3GI9L 1VEMA 5KS9A 3OF6A 3GSNH 5JPNA 5GZOD 1N7ML 4F57L 1Q94B 4RGMC 2VLLA 4PY7B 5C0BA 5IGXH 1ROWA 4Y19B 5CINL 1NUDA 5J3HD 2FLRT 4J4PD 4L3EE 1U91B 4HUNB 5C07D 2DB8A 2AGJH 5EORH 4L8BB 1ZK9A 4FFEX 4NRYA 2NTFB 3JWDH 3LEYL 5C0RL 5F9AC 3KPLB 5FDWB 3KYMA 5GGSB 5C0EA 3DUHA 3X17A 3OF6D 3QEQB 5SWSB 4KRLB 2LU3A 4HBCH 4WENB 1BVZA 5EC1B 2Q7YB 4P9HL 5DJ6A 4HUMB 2KDGA 3WDHA 1W8NA 3EGSB 4HZLA 4F33B 3O3UN 1QPXA 3H9SB 2DLEA 4Q2ZA 3V0WH 5B38G 3L5XL 3HI1B 4I1NB 5CCKH 3PQYE 4XCYB 3THMH 3U48A 5IFJB 1EMTH 2CLZB 8CGTA 5JXAL 3QH3A 3RU8H 4PRNA 4H1LB 4FQXC 1CR9L 1FL6B 3PWJA 5DJCB 2KKQA 3QNYB 4N8CL 3K8KA 4GSDH 3X13B 1A6ZB 5EBWA 1FH5H 5JIPA 2C3GA 4Y88A 3ULVF 1H8OA 1MVUA 2BNRB 3SDXB 2X70B 3TCLB 2HJLA 4ZXBA 3RDTC 1LO3H 2G60L 1D9KB 5IOPA 4TTGA 4Z7VA 3MBXL 1HQRA 3MNWA 4IOFD 4OBRA 3H3PL 3VFVB 4L8DB 2BVOA 1D5ZA 3SKJH 4PJ8A 1NGQL 1H8SA 3QPQD 2R0WH 3S88H 4JDTL 4CN1A 4HPOH 1LE5B 3FN0H 1A47A 2ZG3A 3VCLA 4JG0H 1NBZA 3O2DL 4P9ML 4ZXBD 2XT1B 2Z4QA 2P5EB 4CW1B 4M48L 3OV6A 2Y07H 4TUKL 4OI7A 3UBXB 4LRNH 3WS6C 1FGNL 1CDHA 4OZFH 4JZOA 2EDLA 1JZ2A 4LNRB 1OT1A 2EICA 3WLBA 4ZO7A 3QQNA 4X6CE 5C9KA 3ARPA 1VFBB 5J6GB 1W8OA 3MRPB 3HUJE 2R1XA 3V52H 3KS0J 2YS4A 4JFPB 3HPJB 2VQUA 1PZ5A 4U6XA 4QRUB 2FCBA 2NX5B 2W9EL 3AS0A 4NM8H 5SX4I 3U30C 3OZ9H 1TJGH 1AO7A 5JOFA 2GJZA 3IS1X 4LVNC 5HI5D 2KQMA 3U9PL 4PREA 1J1XH 2BSSA 3RX5A 4KK8C 1GZPA 3LIZL 3NIDF 1L7IH 1CFNB 2OP4L 3T4YA 3MLRL 3PWLB 4M1DL 3OKOB 4U7KA 5DC0A 4XB8A 4Q0XL 3VXRE 3RTQC 4MAYA 5C0GB 5D6CB 3SDAC 1JNLL 1DEDA 1UGNA 3KHOA 2DBLL 4UNTA 3QUML 4OAWB 4RGNE 5E08L 3A6CH 2HRLA 3GJFH 4JRXE 4RZCB 1NCAL 4Z0BL 3QDMA 4YGVA 1NCUA 2D03L 4U1SA 4AENA 1FLRH 4MAYD 1FNSH 1NMBH 4M6NL 2QEJA 3QJHB 3QAZB 3IJSB 1HHKA 4LLUB 1G7QA 2CUMA 3PE9A 4MA3A 4JPIA 3ABZA 3S96B 5D7KE 4ZYKA 3UTTB 4KTYA 4S0UC 2GI7A 2AXGB 3H8NA 4HUUA 3R8BB 1S7UA 4F9PC 5SWZA 1B0GA 4W70A 4I5BA 4WJ5B 5E70A 1F97A 4XWGH 1QO3A 4KI5D 1PYWA 4LRIC 1G9MH 5E0QA 3QQ3A 2PR4L 4Q9RH 4M7LL 3T0BA 1Q9OB 3UCRA 5KSBE 3CPLA 1KIUA 3KG5A 1NL0H 3OGCB 4G6JH 5J12C 2YPLE 4UIKH 2GT9A 3VXPB 4C56A 1FQ9C 4KPHL 4KRMB 5DD5L 3B9DA 5DD3H 4HSQA 1I3VA 4XNZB 3KPOA 1FNGA 2VXQL 3V4UH 5IB5B 2E6PA 3I6GB 4HJ0C 4ZO9A 1I8KA 2W92A 1NBYB 2DM7A 5HGBA 5J1AA 4K7FB 1MIEL 4PUBH 5SWZD 4N5UA 4GBXC 1CLCA 3IU4L 4IOIB 4QGYA 1JGEB 4JFYA 2VXTH 5I71C 5IVXE 2LU4A 3WJJC 4YR6A 3OXRB 4J1UB 4JKKA 3T0EB 4MJ4A 3NIGE 2ZUWA 4IHOB 4C56D 1N5AA 4NN5B 1B2WL 1P53A 2VZUA 4LASH 5KBNC 5GISH 3T0VA 5D1XB 3D0VB 1RU9L 4Y4KC 1HEZA 3ZTNL 4NHUE 4MCZB 3T08A 4JLRB 5A16B 5DQDH 4PB0H 3CFEB 2H8PB 1BBDH 2OTWB 2XPGA 4N68A 1EAPB 2BNUA 2ZOLA 1YEHL 1O7VA 2ED8A 3P4OA 1G9EA 4PS4L 1HHHA 1N64L 3GDBA 3H3BC 5ERWB 1NFDB 3AS2A 3IRZA 1SYVA 3DSFH 1HI6B 1F2QA 4W6YB 3B3IA 4GS7B 2R23B 4E0RA 4I3SH 1U8HB 4MVBC 4HUWB 4PY8I 3DTXA 1YEIL 4NO5B 4GRMB 4OZ4A 1MCCA 1FIGH 1RD6A 3KYNB 3TBTB 3W0WA 2H2SC 2UUDK 4P5TA 3GJEB 1T21B 2IPTL 3BH8A 5D5MF 1LP9E 1DFBH 2KBGA 1FZMB 3B83A 5C0ND 1T03L 2P8MA 1BEYL 1KPRB 5CEYB 4NQVA 3UZVB 4HCRH 4LF3A 3WE6B 2IBGA 4UUJB 1MRCH 4F58L 2A74B 1NJ9B 3KXFA 2XN9A 4P5TD 4BQBA 4UI2A 5FGBC 5D7IE 1MPAH 1T0NB 2C4XA 1RV6X 1YYLH 4ODSL 4P46A 4BZ1H 5EDXA 1MWAH 1JPTH 5DRXB 3FQRA 3NCBB 5GRZA 1P4LB 3SO3C 2MFNA 5C70A 1KB9J 1KCRH 4FQHB 3L7FA 3NPSB 1IAOA 3GGWB 4PRIA 4WTWA 3W39B 3HAEG 2IH1B 4JGJA 1Q94A 1G84A 3O6LH 2A83A 1ES0A 3JTTA 2DD8L 3KXFD 4ZFOA 2F74A 4EUPH 1Q1JL 2XN9D 1IAKB 1X5YA 3TIEB 1WUNT 2Z8RA 4GLRH 1P7HL 3O3EA 3OQ3B 4XNUL 4P46D 5TQ0H 2VDLH 1U8LB 4URTB 4YK4B 5DRZA 2G2RB 5GGSA 3A6BL 1JZ3A 3G6JB 5JIHA 4DQOL 1AXSA 2P5WE 3EJZC 1X5ZA 4JQVC 4PRID 1J8KA 1EIBA 1UA6H 5FUCE 5C6WH 5EC1A 5JW3H 2BCKA 5MERA 3H9SA 4XVUC 2FLBT 1IGCL 4UAOC 3S5LG 3LPFA 1GOGA 2BSED 5FYLL 2A73A 5IJKA 2ED9A 2DOCA 3HCVA 3MRNA 4ZSOB 5HGHB 4XHJC 1GGUA 1KUMA 3MA7A 2BOCA 3JV0A 2NZIA 1FL6A 1BIIA 1XF2B 1HE7A 4IJ3C 1A7NL 1IM9D 3U7YL 5D1ZC 5L6YH 4LSDA 2FX7H 1E0OB 5DHYB 2X70A 4HG4K 1S9WB 4OD1H 3ULUC 1D9KA 1XCTA 1IM3B 3CXHK 1ADQH 4KMLB 2C4FU 2X41A 4H8WH 1CGTA 2ZZUT 4X6DB 4I2XE 4W68A 3VFUA 1BF2A 1FYTB 5DQJA 1QVOA 4Z78B 4ZODA 3CSYA 3DHMA 3RZCB 2J8UE 4HWZB 4ZUTB 4LEXH 4UB0L 2LFGA 3QO1A 4LVOB 4QTIH 4RAHA 5DWUL 4JFFE 3OB0K 2JB5H 2XWBA 4KJWC 4MWFA 1M05B 4OCWL 5DR5L 2YEZB 1K3ZA 5B8CC 1T2QH 4O5LL 2P5EA 3T1FA 5GS0C 3CNKA 5GS3A 3ARFB 2CR6A 1NGQH 1H15A 1J8HB 3GBNL 1UZ6E 2ESVA 3LKOB 4YFLI 2F53B 5J6GA 3PIQA 1MRFL 3MLZL 4WFGD 4ZUWA 4HIXL 3QI9B 3U0WH 4YLQT 4PJBF 2GITB 4S1DC 2VABA 4HK3J 1R3IL 2D0HA 1X4YA 3NCMA 3V0VA 5ANMB 3MLWH 1WAAF 1Q9LB 2CIKB 2VNCA 4JO3L 4PG2C 5JDSB 4OJFH 3BWAB 4G6FD 1KSRA 2PYEA 3C5JB 3CDYA 1SVZA 1B0WA 1AP2A 3L3OB 1R5WA 3EYSH 2ESVD 3CZJA 2W0LA 3WHE0 3BI9X 4M8QB 1T1YA 4K7PY 4GRLC 2BY3A 3OKOA 4X8JB 1A14H 4Y0GA 3GSOB 4GW5B 5I73B 5J13B 5IROA 4KRPD 4UMGA 1RAMA 4XNYH 3R06B 5D6CA 5F70A 1GPOL 4G80B 1PD6A 4UBDD 1OB1A 3BP4B 2Y06L 2EO9A 1MI5E 1NANH 4JY4A 4PD4K 1IEAA 5SV4A 4MD0B 2CXGA 2PYED 4KTDH 3LIZH 4OCRL 3N85L 5D70L 1FFOA 3RNQB 1QLRA 2A9MH 4DOHB 1F6AA 4XMKL 1HILA 1FN4B 1JHLL 1CL7H 1JIBA 1VERA 3UZEA 3RHWF 3B2UC 3OKDA 4PJDE 4K2UL 2IALA 3KYOA 1QNZH 4GKNA 3AAZB 4QRRB 4NJ9H 3GHBL 5IF0B 1A0QL 1QSFE 4NQDE 3T2NH 1HHGA 3H9ZA 4OGYL 5L0QB 3AFLA 3ZDXF 4OLVL 2NY3C 4NQCB 2X09A 4X8XA 3CZFA 5HY9B 2DKUA 3MLVH 4L8SC 4L8CA 5GGQL 2WBWB 4M43L 4D9RE 1TZGL 2DWEA 1VENA 4YPGA 2AXGA 4O2EA 3FTGA 4OM0L 5DZOA 1N0XL 2D03H 4WUUD 2AEPL 3B6SA 5SV3A 4PJIE 4MD4B 5HYJE 1GAFH 4IRJA 4EDWH 1OAUH 1P69B 4UQ3A 1RIUH 1VSCA 3AMLA 1ONQB 4JO2L 2H6PB 5HHOB 4FA8A 5IBLD 3MNVA 3QXUA 5H2BA 5F7LB 1MAKA 1WWBX 3I6GA 2H3NA 4NKIH 5K9QI 2HTKC 1NBYA 1T1WA 2VISB 5DEFB 4S0SD 4UTAH 4M7KH 1DN2A 4X9BA 4X0KB 3S4SG 2ORBL 1R3KA 2R9HC 2GK2A 1JGEA 3FQWB 4IRJD 5T3ZH 1RZKL 4LOUC 5LGHH 2COQA 5BQ7A 3TPKA 2F5BH 1QEWA 3VFNB 3NFNA 2E7LA 1F4WL 1HZHL 1LO0H 4MJ6A 3WEXA 4LCCA 3ZL4L 5SWQB 2OI9C 1AGCA 1HYRC 2Y72A 2QQKH 4CJ0A 4IIQA 3TBYA 3SE8H 5KSVA 2OZ4L 1KIRA 2PTVA 3MJ8B 3LCYA 4EI5C 4JLRA 3E6HA 1UKQA 5L2KE 5GRJH 4PJXA 1T2XA 4XZUB 1UM6H 2H8PA 5D7JC 4M61B 4KUCD 1I9EA 2ZCKL 1FSKB 5E5MA 4NZTL 1AGEB 4KRNA 3MV11 2NY7H 2UUDH 4HFWA 1WWCA 1P7QB 3QA3A 3GO1H 5HDQL 1YMMB 1XGUB 3LEVH 1KNOB 1WFNA 2YUZA 3GHEH 3HI5H 1JNJA 4PG9B 4NNPH 5DVMA 1WLHA 2ID5A 4HS8L 2UY7A 3GNML 4WW2C 1BM3H 3GRWL 1U8HA 5GRXG 4AK1A 1I7RA 3FO1B 4GRMA 1TZHA 1YEHH 3C6LB 1RZFH 3GSNA 5L8JB 3R1GL 1JE6A 1G6RB 2DBJA 4PS4H 3EFFA 2RCSL 3SY0A 3BW9A 2ICWB 3OG6B 1A21A 2YSSA 4HZAA 5F9OH 4NNXA 4OCMC 5JHDE 3ZT7A 5I75C 3VXSB 3EO9H 4JANB 4QRPE 4ZO6A 1FAIH 5F7EH 3RWFA 4S1SL 1KGCE 3CC5B 3P77B 4MJIA 2X5PA 3K81A 4Y1AB 3M8OH 5IG7A 4OCLC 1P1ZB 3WE6A 1VFUA 3DVIA 5IT2H 4YXLL 3BPLB 4Q6IB 2VZOA 5AEAA 1ZVYA 3EDFA 4X6CF 3BD3A 5KSAC 3PWVA 2NY0C 5J1SC 1Z5LB 4MXQC 4NGHH 1T03H 4DJMA 3UP1A 1TLKA 4QCIB 4DVBA 3OKMA 1DDHA 3ES6B 4Y5YB 2NXYB 2FJGB 5IHZB 2FIRT 4MJID 4PGJA 3UTQA 1LEKB 4TULH 2XTJB 3BMWA 5IKCA 4Y16C 5C7XL 4XCFL 3AMKA 2QQQA 4LPWA 5IMOB 1OGTB 3RVWD 2CUHA 2Z93A 2A2QT 1D5MA 4LGPB 1SQ2N 1ZSDA 3VFMB 1E4XH 2X4QB 4P5KB 5I8KH 2NW2B 5EU6B 3RGVC 4MDIA 3DX9A 4ONOA 5KG9A 1EJOH 2VC2H 4EI6B 1M1SA 5D71L 2ICES 1NLBL 5GJTH 1CDBA 2ZUVA 5DK2B 3R0NA 2FYYB 3PGDB 3NABH 3MRJA 3QFJE 1F90L 3TH4T 4H0GA 4YDVB 5BVJB 3CFDA 4QXTA 2DS4A 5D9SB 3VFPA 3C60A 3DO3A 4Z0XA 4P4RA 1M7IB 2XACC 4ZFZB 5C07E 3OB0H 3T04D 3UPAA 3LN9A 1RHHA 4HKXB 5FYKE 5T5NF 4TVPH 3HPLB 4XH2A 3EJJX 4Y89A 4JM4L 5KS9E 2B0SL 2IQ9H 3L3DA 4GRWH 4BQ8A 4HUVB 3MGTA 1BJ1H 5C0BE 3C60D 4U1JB 4N0CD 3J8F7 4YE4H 3MRGA 5D6DC 3QPXH 3LH2H 1JF5A 3SE3A 2B1HL 3TNNB 1DQMH 4GMSH 1FZKA 4TNWK 1HDMA 1M05A 4Y4FC 3FRUB 3DECA 4R2GD 4HV8B 2ADGB 4AEEA 1MUJB 5GRVK 2MTPA 4JHAH 4OZGB 1KG0B 3FN9A 4JFHD 1OTUC 2WZPD 5AD0B 1WT5A 3VWJA 2VH5L 5HYQB 4LU5L 3NIGF 4JRYA 1GOHA 2F53A 3TVMB 3EYQC 1BVKA 1CD1A 4KVNL 3ULVH 4QKXB 3GJFA 2GK0A 1GYAA 4Y7MA 3KPSA 2ZP0T 1KJ3H 4O9HH 4XP9L 3NIFE 5HYIA 5C2BL 5T1DL 3IAQA 3QUMB 1UC6A 3F7VB 1VDGA 3L3IA 4HJGA 4XMLH 5JDSA 4F7PA 3GBNH 3BXNB 4DEPB 1MRFH 1KFAH 1BGXL 3VWJD 3MV9E 3D9AH 1LQSR 4JRYD 4P2QA 5GRWA 1EGJL 4F80A 2C9AA 4OD3L 1N6UA 3BVNA 2QQNL 1BLNA 4AEIH 3BH9B 3KPSD 1Y6NR 3ZYIA 1R3IH 1IQDA 3GSXB 3MRLA 3R06A 4I4WB 3FB8A 4A6YH 2BFVL 2HFFA 1I8MA 1VEPA 2VITA 3LHPL 3ZTJG 4WW2F 4E41B 5MHSE 3MJ9L 1FFNB 5JOPD 3PXHA 5ABDE 3CFBB 1FV1B 1MREL 3RRQA 1RIVL 1K4DB 2Z8VC 3Q0HA 4P2QD 3HZKA 3CVIL 5EU7E 1LP9F 3N0PB 4PJHB 3T65B 4AG4L 1DQLH 1LILA 2YPVL 4N0UA 4KKLC 1R6VA 1RIHL 5J6HB 5FHBH 1J1PL 2VAAB 1RULL 3TPUB 4JR9H 3GSRB 1YNKH 2P46B 4QHKI 4KROB 4PY8J 3V2AR 5D70H 3D2UA 4NQCA 1A6TB 2OR9L 1BAFL 1J1OL 2NYYD 3IB4A 2DIAA 4OLZL 1B6UA 3HRZA 1AO7E 2DQHL 2IADB 5D7IF 5EB9A 1A6VL 5IFAH 1QBBA 5GGTL 4MD4A 1MIMH 4XPHH 1QBLH 5D7LD 5C0FB 1A9EB 5A43C 3O45B 3I2CL 5DEGA 4JFEA 3QHFL 4EKXA 1N3NA 5EU4B 3O2VL 1KPUB 2KUTA 4LIQL 4YEFA 3D2UD 1RZ8B 2NW3A 5ID0B 3L1OH 3IDGA 3FRPA 3LEXA 1WJ3A 2XQBH 5DUPL 3X3FH 5E1AB 1T0PB 1SJEA 1DQDH 2M2DA 3O2WL 1MCFA 5IFHL 2HN7A 2YWZA 2JELL 3WO3B 1CXLA 4G5ZH 4WHCA 4OM1L 1JMZA 4Y2OA 1DLFH 2JCCF 2IG2L 4JFED 4HW6A 3H9HB 2W0FB 4DK6A 3VFNA 1II4E 3D5OF 2FSEA 1Z9MA 3QCVH 5SWQA 1KPVB 4AMKL 5JXEA 3QDME 2YXMA 1IT9H 4UOW0 1FDLL 1DEEB 2Q8AL 2BVEA 3JTSB 3RPKA 5KANI 3NACL 3MV8A 4J8RA 4HCRA 2D0FA 4XZUA 5ADOH 3TNMB 2D3VA 2HJFB 2PTTB 1VPOH 1YUHA 4Y4HB 4PJGB 3QBTB 1YMMA 3PG2A 3VWKB 2E27L 2XWJA 4K7PL 2NR6D 5SWZE 2IMNA 1ZT7A 4N5EA 1VGEH 5JXED 3DV4A 4XCNA 1NBVL 1ZMYA 1XIWB 5HI4C 1CDCA 1YECH 3DRTB 1GGYA 1MWAA 4F7CB 1NH6A 1QFWH 3DYPA 5IP4A 4QHNA 5CJXA 4PJ9A 5FHAH 2N1KA 3AREB 3MV8D 3SBWA 4P4KB 2ZNXA 4NZTH 2VZVA 1KJMA 4HS3A 1YEJH 4RWHA 4AYFA 2VQ1A 3O3AB 1G7JB 32C2A 2R69L 4X9GA 2CDGB 1KELL 1QBAA 3ARGB 2CO7B 3E1F1 2ICWA 1VADA 3X11A 4ETYA 4OGAC 4JFDA 3I3BA 4N5ED 4HS8H 2AJYL 4TRPL 4JANA 4FQQB 2DQGL 3U46B 1D5IL 3WO4B 5KVGH 1F13A 4RA3A 4U1LB 4KK6C 4YDIL 1BBJA 2IFFH 2O26U 4PJ9D 1RUPL 4L9LC 4CGTA 4APQB 4PJ7A 5KTEL 4WFFD 3ULUL 5INDB 1CE1H 2YC1B 3MA9L 1XMWA 3UBXG 3WXVL 1UZ6F 2DKSA 4Y5XA 3B2VH 1C12A 2Z8SA 1L9MA 4KKBC 4S1SH 4JFDD 2FIKB 3BEWB 4N8PA 4W6XB 2VIRA 4PR5A 2XZCH 5F97E 5LCVH 5GZNC 5CEZE 1OM3L 1I75A 4P5MA 2ED7A 5F3BA 2FEDD 3DGGB 3VXQB 4OSUL 1R5VA 4R97B 4YDLB 2BRRH 3UTPE 2FX8L 4NZUH 3OSKA 4LHUG 2P42B 4JFQA 5GS0L 5E99L 1DVFC 4M62L 5JUEH 4LCWB 2V5MA 1P6AB 1TQCC 1UQSB 2R1YB 1HXMB 2OYPA 3WIFA 3WFBL 2XKNB 3FOMA 4NOBA 3W0WE 4EI6A 1N59B 2IAND 3C5ZA 1MFAL 3C9NA 4LMQE 2NY4C 2AQ2A 3WV0A 2H26A 1MJUL 1OQOA 3TYGL 3PGCA 4IS6B 5D8JH 2FNBA 4ODHL 3VXOB 2EIZB 2GTZA 3FL7A 3PGDA 3C09B 4OFKA 3V5DA 2NY5H 5I1HL 4YDVA 4K3EH 3P4NB 2CRMA 4D9QD 3MR9B 2B4CC 4PRBB 2HMIC 4WV1C 5F7YC 4MX7B 1NLBH 3LMJH 5I9QB 5MI0C 3C5ZD 1M7IA 1ORQA 3OR7A 3QDJA 5HHNA 5BOZG 3H7LA 4G8GA 4IM8A 3O2DA 4DUXA 1CLOL 4UQ2A 4PP8C 3GI8L 3VXUE 5EOCJ 3S36H 2ICWI 3BIAX 2GFBB 3F7QA 3KPNA 3WN5A 2YMXH 5E8EB 4GLRI 4KKCD 1PKQE 5FO9A 1CGWA 1CZ8H 5FYJL 4CUCA 1NGYB 3CDFA 1UZ8A 3L5HA 3MROB 4PJIF 3WNNA 1FCCA 4PRIE 3FMGL 2FZ3A 4PJFB 4YHZL 4NCDA 4NOFA 2B1AH 4OCSL 1FFPB 5CD3B 3W11D 1I85A 3GMPB 2AKRB 4YXHL 3QDJD 1ZT4B 4G8GD 1BP3B 1CDUA 1KV3A 1W0YT 1J0IA 3CFIC 1NC2A 1GHFL 1NUFA 2NMSA 4AEHL 3U0TB 2Z0BA 4XPAH 5EO9A 3MXWH 3OKKA 5I0ZA 4RISH 3RY5A 5EBMB 1OGAA 3VRJB 3QEQE 5SWSE 4X6BB 4CNIA 1Q8MA 2XQYG 1EAJA 3H9SE 1FJ1A 4N8VG 2NCMA 3KPRA 3TVMA 5I8EA 3BQUD 1Z6JT 1TIUA 4X4ZA 4YIQA 4UILL 3LDBB 3IDNB 4S1RH 3QIUA 1NC2D 4GW4B 5FA4B 4TPRL 2YD9A 3WFEL 1A7QL 2AEWA 1I1FA 1IC1A 4HK0B 3G5XA 1OGAD 2CKBL 5IR1B 4NCC2 1LO2L 4ZO8A 1AHWC 2PO6C 3SDXE 4I3GA 2MHAA 2Z35A 3KPRD 4GAJL 3WHE1 5T1LA 4U1HB 4YQXL 4R3SA 1NDGB 3O11B 4S11A 5FB8B 4R26L 4Z77A 5JZ7D 3QIUD 5F88B 2WIMA 3GEWB 3IKKA 3MUY1 3Q6GL 8FABB 1M7DB 5D1QC 3HN3A 4E41A 4WFEE 4ZD3H 3O81A 4ZFGL 5I1IL 5CGYC 1T7YA 2HLFD 5KVDH 4FTVD 5GGVY 1WBXA 4UT9L 1MFCH 4Y5VC 2PYFA 5T1LD 4KV5F 2P5EE 1QRNB 3T65A 3ARDA 3U4BL 4M8VA 4U49A 4YBQD 5IBTL 4DZBA 2HFGH 1HXYB 4K3JH 1H0DA 3MRHB 4HEME 2P44B 3FZUC 1AR2A 1ODAA 4B7IA 5MEPB 4H88L 2WBJB 2A6KB 3KNBB 3P2TA 3EDKA 2Z92B 5CBAA 4NO3B 4WY7L 3QB7C 2NX5E 4ZNEA 1QFWM 3T4AB 5FUZL 4O51A 5EUKA 5FO8B 2YPVH 4GKSB 3ARDD 3TFKC 1S5HB 1AGBB 3PDGA 4B5EA 4ELMA 1UM4H 3P73A 4CRPA 4BSVA 3MUGB 1I1RA 2QSQA 5T3ZD 2R2CA 4ZQKA 2Q86B 1NANI 1A6UH 2DQJL 3TIDB 1D5XB 2W91A 4QYOB 3V6FB 1J1OH 5L7XL 4PRPB 4N90E 4X4YB 1WZLA 4RGMB 3RVXC 5CJQH 4O2FB 2AEQL 5L8LB 1S7VA 1CL7I 4JO4H 2FR4B 3BKCH 2HJKB 3DUUB 4DW2L 1T3FA 3LKRA 3VG0H 2VE6A 3FONB 5BCAA 2ZUQB 1WGOA 5F9JA 4CVXA 3GSVB 1IE5A 4HX1B 1KPVA 1QR1B 2X4RA 4QHLA 2DL9A 2G9HB 3QP3A 1DEEA 3DGCR 1CCZA 1M6OA 2X2YA 2K1MA 3WL9A 1F02I 4QXGH 1T6WA 4OM1H 3NA9H 1J11A 4XBEH 1ZV5A 4XCEB 3NA4A 4OBSA 4ZS7L 4IMKC 3TNMA 4G6ML 5KW9H 3UTTE 4Y4HA 4WU7B 3VWKA 2PCPA 4ONGL 4YHLL 4P2OB 3VE0B 4FQCL 1SY6L 3DVFA 3QNXB 3WLWC 4F3FA 1FBIH 3AS1A 4BFIB 2GTWA 2XZZA 5T1MB 2YD2A 4U3CA 4NP4H 1KCVH 3AREA 4D8PB 3BKJL 3TO4C 2YD4A 5GS2H 3RDTB 3S34L 1KCGC 1GGTA 4EDXB 3RA7L 43CAB 5B39B 3LB6D 4L4TD 4O02H 3ROLB 5B21A 4ZTOL 3O3AA 5AUMB 1G7JA 4LQ1A 4POZC 3ARBB 3RWCA 5F3HA 2FJHB 4QWWD 5ISZB 2DQFA 3UPRA 4Z95H 3L3GB 1XZ0B 4JAMB 4CN4A 1U3HC 1XGQB 3B5GA 2FH6A 5E8PA 2X4TA 5LXGH 3EOYG 2BXZA 2E7LE 5DUBA 5BMFL 5IEHA 3FKUS 4JO1H 3WUWB 4JPWL 3VXNB 4WWID 3RUGB 1ZXQA 1LO4H 2ZWLT 1KELH 3O8XD 1MY7A 1S9VB 1EERB 3DPBA 3GMMA 3SDDD 5HHPB 1ZVSA 3CXDL 4GH7B 2AJYH 4TRPH 1IKNC 1ZGLP 2DQGH 4G42B 3TEUA 3CLEH 1QLFA 1NMAL 4KUZH 1U8NB 5IJVB 4P57A 3QO0B 3DVGA 3NIFF 1G9NC 4OI9A 1WEJL 4QRQA 4D0DA 3QXAB 2EIDA 1MAJA 2W9DH 3RX7A 2W60B 3WXVH 1F6FB 1T7XA 1WIUA 5JHLL 3ARVA 1E4WH 1ZS8A 2HFTA 4R7NB 12E8H 1RUMH 4GUPA 2EDNA 4LKCA 5DFTA 3F58H 3MXVL 5E56A 4LPXA 4GAFB 3MNZB 4JREB 4RX4A 3PNWA 4HH9B 1U6AL 5C09A 1NUGA 1OM3H 2LU7A 3TV3H 4WFHD 2CUIA 5E2WH 5EOTA 3RTQB 3QDGB 2AQ3A 5IHUH 3SDAB 4YDJB 3P9MB 1EO8L 1IGTA 1T1XA 3QUZC 4RRPA 3VXTA 3BWUC 5CGMA 1FC2D 2OMBA 3QG6B 4M62H 2FATH 4TVPD 5ICZA 3HMWH 3EO1B 3ZKND 1K8DA 3WFZA 4NQTA 1KLGB 3GSWB 3SPVA 1FVDA 4JFOB 3QUYC 2VLMD 3B9KA 4RX4D 5C09D 2AV7B 1GGIH 5D2NC 1OARH 4Z8FL 4OV5A 4X9HA 4ALAH 3WMSA 2EIBA 4LLAA 5I66B 1AJ7L 1MHHA 3BZEB 5DD1L 1DQQB 4ODHH 3N1GC 5GRYA 4PP2B 1H3XA 1QZ1A 1INEH 2LQRA 1Q72H 4WI5A 4TOYH 4U0QB 2P8LA 5JW4R 1KENH 1E4XI 5EU3A 3WDIA 4DGIH 3B9KD 4HD9A 5J11C 5C71A 1T4KB 3NN8A 4ZPVA 4CADB 2K7QA 1YY8A 1YQVL 5EO0B 1FFPA 1CT8B 1BQSA 35C8H 2R2BB 3A67H 3GMPA 4QHKJ 3GBML 1DBAL 3ULVD 1CLZH 1QP1A 1JYWA 4OFYA 5FYJH 1P5VA 5DD0H 1RFDH 1N6VA 3OKNA 1JHTA 3ZKMD 4A6YA 3BYYA 2DTMH 1PSKH 3FMGH 3G6JE 4Z7UF 5IESH 2IBZX 3LKQB 4HUKB 5F72S 4GBXB 2HYMA 3V4PL 2XRAH 1YY9C 5KSUA 2MQ0A 5I71B 2V2TB 4TUOB 1A7PH 5E2UH 4FQPA 4EN3A 3MRKA 3WJLA 2RIKA 2NXZD 3MV7B 5C0AA 1GSMA 4D94A 5DYOA 4Z18A 5K59F 4OFYD 5ESAA 1U42A 2P24A 3BEVA 1P9MC 4ZSOE 4ISVB 4QTHB 1JGUH 4PJAF 4Y4KB 1FO0H 1WTGT 2VLJA 3BP6A 3IFOB 5ITFB 2EXWC 2PW2B 3TZVC 4J7RA 1XGPB 4U2ZA 1YPZB 3ISWA 2Z91B 4QT5A 4IBLT 4NO0A 3CX5J 4X9FA 2FD6H 4EN3D 4PV9B 3FFDA 4U1HA 1SEBA 2OTUA 5C0AD 1NDGA 1IGYB 4XP1L 3MFGB 3CFCH 3O6KL 1FFRA 3MRIB 1FRGH 5DFVD 5FIEA 3GKZA 2C1PA 5INCB 2VLJD 1M7DA 1LO2H 5IIEA 1INQA 1FL5A 3FO9A 4NO0D 2F15A 2OJZH 3SGDH 1RUAH 5KAQF 5CBEB 3SKNA 1FC1A 3INUH 1QRNA 1UT9A 3MC0A 3RL1B 4KVCL 3U0PA 3QCTL 2A6JB 3BD4A 1YEEH 1J8HE 4JPKH 1JUFA 2F53E 2D7QA 2CMRH 5J06A 4KC3B 4AIZB 3QG7H 5HHMA 2Z92A 3WFCL 1YEGH 4PJEF 4Q9BA 5CKGA 1X7QB 3U4BH 3MFFA 5ANME 2GY5A 1JGDB 1FPTL 4H25A 1IQWL 5J57B 1S5HA 5JOPE 2J8HA 4Q97A 5DJ0A 1T1ZB 4JKPL 1UWGL 4OCNC 4HS6A 4YWGL 4Z76A 4P2QE 1Q9WB 5GGRA 4ZUVA 2VLKA 3OHXB 1MCOL 1CICC 3MRDA 3AM8A 4HMDA 1MAML 5LKNA 4DGVH 2QHLA 4XC3H 4PRPA 1EXUB 4TYUA 1S7TB 4IRSD 1TJHL 5ALCH 1KF9B 4D0CB 3KDMA 5FM5M 5C9JB 4ODWA 1MCEA 3QHZH 3E3QE 2RGSA 4LLWB 4HUXB 4DOHE 2ZUYA 1RK1A 3G5YA 4NJAH 4NWUH 1UEMA 2VLKD 4EVNB 1OAXH 3FCTB 1HSBB 5KN5B 2UV3A 2HT3D 3EO0A 4N0UE 3QAZC 4QRRE 1V7ML 5D72H 2G9HA 1GZQB 4UOW1 4KI1A 3C2AL 2WQ8A 4P0DA 4DW2H 2DLFL 1QHOA 3MLUL 1AQKH 5ITBL 2AJUL 3V6OC 4NQCE 3KYKL 1E27A 2JK5A 5GS1A 2D4FA 4D2NA 4F7MB 2NY6C 3PHQB 3BPNC 3KHQA 4PV8A 4CJ1A 1JK8B 2ENYA 5DJDA 4ZAKA 5FCUL 4JQIL 2CRZA 4FQXA 4K23L 3LKPA 1AD0A 1CQKA 4V3DB 4BKLB 2R56H 5ICXA 4OFIA 4BFIA 2QKIB 3AY4C 2XY2A 3S35H 5IVOA 4P3DB 5EC2B 2JTDA 1OSPL 5DTFB 4XNZC 1CU4H 4D8PA 3IAGC 5MP6H 4I9WE 4KJQD 5HHOE 5A3IC 5DSCA 1ACZA 1I1YB 5AUMA 3UYRH 5KVMC 1RUQL 1CTNA 1MQKL 2B4CL 4MB4A 5C8JB 4FQCH 5D5MA 4ZAKD 1T20B 4U3HA 2FJHA 4R90L 3W5NA 4FQXD 3L3GA 3T0EC 4JAMA 3RVTC 1L0QA 3DURA 4XPBL 5JPMB 1XGQA 2CIIB 2ICWJ 5E7BA 3TBWB 1C5CL 2YRLA 3DJ9A 4LPYA 4ELKA 2I5YL 3WSQH 4ZTOH 2O61B 5D1XC 2X4OB 5B8CB 1S8DB 5FAAA 4U31A 3WS6A 5CLWA 5HYSA 1BQUA 3IDXH 4OF5A 3P0VH 3GMRB 3OXSB 4UIMB 3HG1B 5DRWA 5DQ9B 2AK1L 3LN4B 1ETZA 2XXCB 1I3GH 5EOQL 1G0XA 2SEBA 1QFWI 4JPWH 4KAQL 2CD0A 4KHXL 4NQEA 1EEUA 1KTDB 5A2FA 1DUYA 1YMME 4Y2DC 4NKDA 2R0LL 4ORGB 5BRZA 1TITA 3STZB 3I9GH 1QYGL 1NGWB 1V05A 1PG7H 2VZTA 4IMLB 1E6OL 3S3SA 3SDXF 5KZCB 4OLXL 1G6VK 1G7HA 3BUYB 3RWGB 1FE8L 3JVGC 4YPJA 4GRLB 4WFFE 4XVTH 3SDCC 4M5ZH 1WEJH 1JWUB 1MY5A 1OAZL 2FX9L 4MMZC 1FL3B 4NQED 2QJDA 3QIBA 3HB3D 1KBGH 1HN1A 5C0DB 3MOBH 5CUSL 3AS3A 3DIFB 5FA3A 3SQOL 5H94A 1ZWIB 4QGTA 4PJ5B 4NZRH 3KPQB 5I17B 1A6AA 3ZT5A 4MDJB 5ETUB 5FYKU 4PJ7E 4JFOA 3FB7B 2DQTH 2I9LB 1RZJC 1LO5A 1TZIA 2AV7A 2LV4A 3DXAA 2A77L 1EO8H 4D3CH 3QIBD 2KPNA 4ERSL 4ZOEA 3F7RA 2EEDA 3B5HA 4X5XB 3F5WA 2WW8A 4ZPTA 4L8SB 3NPSC 1FP5A 2XTJE 3G5VB 4U1IB 2X6MA 2VXVL 4FQ2L 4G8EB 1B4RA 1U8KB 2Y4SA 3IJYA 4QOKD 1I7UA 4FQLH 4F9PA 1F2XK 3GB7B 5I30H 4LRIA 4R4ND 4KK9C 1UM5L 1LD9B 1YN6A 2V2XA 4NSKB 2R2BA 1S78C 3ILQC 1WCQA 3H6JA 1EZVX 4HIJB 3OL2A 4JHWH 1CFTA 4QNPE 3MACL 4HKZA 2VQTA 3ZYZA 4U0RC 2ZOKA 1AIFB 5JR1H 2CKBB 4GFTB 4KMTH 1JI1A 3LKQA 4DN3L 4BSWB 1XGRB 2YD7A 4GBXA 4LCUB 2R0KL 4ZMAT 4UU9A 1EGJA 5K9OA 2BVTA 3ARZA 5TFSH 4KU1A 4I77L 3MV7A 2IF7A 4N0FA 2AJVL 5DHVH 5EZLB 4C4KO 2OI9B 1W72H 4PJBA 2HTLC 3EJYC 5L88H 1QA9B 3R0MA 1X5FA 1QBMH 2WINB 4QTHA 2WSKA 1WAAA 3B8YA 4W4OA 4EI5B 5TQ2H 3IFOA 2ZCLL 3LKSB 4FXKB 1NCNA 3OX8B 4PLJC 3O6FA 1XGPA 4NZDA 3W2DL 3UYPA 2VUYA 5D7JB 3I02B 3D85A 1HNGA 4Z7NE 3KWWB 2BVPB 4LSTL 1XGYH 3VXMB 3BP5B 1M7XA 4GKZB 3TA3A 4M6OL 4XBPA 3RZCC 3V4VL 2GSGB 4LLQB 4JZJB 3BIKA 2CK2A 1HH9B 5E7FA 1KCSL 5F1IB 3E6FB 1IL1A 2WQRA 2CPCA 2BY1A 1LMKA 5INCA 5EIIB 1A9BB 1MHEA 3DVNB 1KN4H 3SJVA 1G7LA 4E42B 1AC6A 3IU3A 3O6FD 4CAGA 1PLGL 5BO1H 3ARQA 3D85D 3ZDZE 4W81A 3NCYS 2CXKA 3DRQA 3ARFC 1XF1A 3KLDA 5GGTA 3LKNB 3ZSTA 1AFVL 4OZGE 3TA3D 2ENSA 4NM4L 5I75B 3V5KB 4NPYA 2VDKH 1JNNL 2WWMC 1KIQA 4XX1E 4UT6H 5DA4A 3FHAA 5TDPB 1WIOA 4BSJA 5EUOB 5I1EL 4M93B 5HDLA 1OP3K 3QI9C 4RQQA 3SJVD 1IC7L 1IAIL 4AH2A 1QSVA 4G7YL 4HKBA 1BFTA 1AR1D 5C0IA 1ZANL 3PJSB 2GSIB 1X7QA 4ODVL 3MBEA 3MRBB 3SKOB 2QADB 1AE6H 4KHTL 1JV5B 4X5LA 4F7EA 4E5XA 4NQSA 1NAKH 5A40E 3SOBH 5FGBA 4LDEB 1K8IA 2L7UA 4G9DB 3K4ZA 3ZDYE 2ZKHH 3LS4H 5HVHC 4AM0B 4S2SB 5C6TH 3G5ZA 1AC0A 1P4BL 1LEIB 3M45A 1EBAA 1NCBL 4U7MA 5I73C 4NRXA 2DQIH 3AU1B 5FECA 3WFCH 3LQZB 2BERA 3ZO0A 1NFDF 5KOVC 1YDPA 3MBED 1IQWH 4E41E 1VKXB 1EFXB 4MHHG 3RY4A 1F11B 4O2CB 4YWGH 1CXFA 1XF3B 2XI9A 2JCCB 5DUMH 1UH4A 2ITDB 5EBGA 1MCOH 4Z7OE 1MAMH 1C5DA 3IJHB 1A22B 4DZ8B 4FNLH 5KN5A 1KJVB 3D39B 3F65A 2JJTC 1JRHL 3VFTA 4JQVA 1Y6KR 3F6IA 1HINH 1LE9B 1JGLL 4M7JH 3PQYA 5CAYB 3TPUE 1TXKA 5CIPB 2BVYA 3M1BB 5IQ9B 5JQ6H 2EDQA 2VXSL 5GS2D 5ELIA 3O4LB 2Q3ZA 5CLTA 1BMGA 4O58L 4ZNEE 4MNGA 4RMUA 4LPTA 2Y5EA 3I75A 3L95A 5DI8A 4ELME 4BJLA 5D1ZA 4NUGH 1WBZA 5BVPH 2P8PB 1A3RH 1I8IA 5E2VH 3H42L 1S5IH 3TH2T 5ITBH 1RK0B 3PQYD 3QEHB 4LGRB 4XVUD 2BJML 2VDOH 2NNAA 5I1JH 2VDNH 4WHTA 1N0LA 2X4PB 2EH8L 4U2YA 3SGJC 3IDMB 3OR6B 4P23C 2XZAL 1OOAA 1FGVH 4K23H 4G3YL 3KLHC 3BKYH 1TETH 2MMXA 2HVKA 5FKPA 5I8OL 3CUPA 3SCMC 5CP7A 5D1ZD 2H32H 5JPMA 3C5SA 4F8TA 1ED3A 2DYPB 5DJ8A 4KK5D 3G6JF 2O61A 2X4OA 3TWCH 5B8CA 5GGVH 3EUUA 1G7IA 1HHIA 4HT1H 4X6CA 3OKYA 3EBAA 5C3LD 2AK4A 1BD2B 2O5XL 5TF1H 2OSLB 5FYKH 3MGAA 3CLFL 3RI5F 1GGCL 3HUJA 4GMTH 5AWNH 3FQXB 1FSKC 5HPMB 5T1KD 5ACMA 3UTOA 1TJIH 5I0DA 4HG4J 1GVIA 1QQDA 1PY9A 2I5YH 4X7TA 3CXHJ 1HKLH 2ADFH 4Z7WB 3KPMB 2AJXH 1RVFH 1KJ2H 1UH3A 5IB2B 4NFDA 4ORGA 1XR8B 5J56B 1K9TA 2UWEB 1NGWA 4PG2A 1RZGB 2HKFH 1ZHBB 4U1GB 4HAFA 4YHIB 1B4JL 2AK4D 2V7NB 2YKLL 2A0LC 3O9WB 3B8SA 3IKCB 3C6LC 3RWGA 3SEPA 1KC5H 3RWEA 2PXYC 3MGOB 4D0BB 4PGEA 4X6DF 3O6MH 4BH7B 3VXRA 4GRLA 1I7ZB 1B0RB 4GG8A 1DUZA 2OL3H 2R0LH 4S1DD 3MOAL 3QEUA 5TH2A 3UTZA 3IDUA 5I19H 5BZWA 1CDGA 1MNUL 3FFCB 3WKMH 5D2LB 4FABL 1RURL 1N6QL 4XP5L 1BJ1J 4MZ2A 1ZWIA 3EKCA 5I17A 3KPQA 2HKHH 4I3RL 3KPPB 3RIFF 5ETUA 5JO5A 4LEOB 5DURB 4XMPL 3VXRD 3WHXB 2FX9H 4JFXB 3WXWH 1T5XB 4CMMB 3RVUC 5CHNA 4JCMA 4BFGA 2E9IA 5F89B 5CUSH 5IEKA 4FXGA 4RGND 2F19H 4WWKA 4F37F 5L2JA 3DX6B 3ZT6A 2WUCL 5J0BA 1BX2B 1VACA 3HAEB 5FYJD 2QHRL 4NNYA 5GZOC 2F8XC 4JRXD 3QXDB 4J3OC 1AD9A 1U8KA 1ZTXH 4X5WB 3CH1B 2E7BA 2EH7L 4QRTA 5J3HC 3GB7A 4J4PC 2C3VA 5HGAB 3E2HB 4ERSH 3OAYK 2ERJB 3OJ2C 1IFHL 2YPLA 5GSRB 4LCWE 3C8HA 3TN0A 1PEZA 2GKIA 2HLAA 4UTBL 5HHXL 5MENA 5FYLE 4OLWL 4OT1L 2IBZY 4HIJA 2AI0H 2L7JA 2VLME 3QZWA 4WWKD 5J7CC 3X14B 2NY3D 4HKJA 1ZT1B 2HRPL 1HHJA 2VL5A 4FFZL 5TE4H 5B38A 5C92A 1T7ZA 3S9DB 1UM5H 4DCQA 1U8PA 3FB6B 2J88L 4UINH 5IB1A 3S5LB 5F8RC 5BJTA 1OY3B 3VGBA 4GAGL 3T0XA 5DMKA 4BELD 4P2RB 2YPLD 5CZVL 3TN0D 3EOBA 3C8KA 5MEND 3MUZ1 5B4MC 3MACH 2AV1A 3IYLW 3L6FA 5A2IH 1RZ7L 4LSPH 1REIA 4NHUA 3VRLE 2E7CA 5JLZB 2ADJA 1Y18B 3PWPB 5E4EB 1W2KT 1XF4A 4G59A 3KYAA 3VW3H 4PRHB 1P7KB 2BSTA 4TTDD 2D31A 2KH2B 2CJUL 3ULVE 2EYRA 1C16B 5D7JA 4ZFFA 1FVEB 3ZHDA 1JPSH 4POYA 5T3XL 1X5JA 4U6TA 3VXMA 3E0GA 4GKZA 4MA7H 2VLRB 1AY1L 4LLQA 3QPQC 3BRDA 1KT2A 1L0XA 5F1IA 3IDJB 3DMMB 4NHCH 2FBOJ 1OP3H 3K7UA 3DHJA 1H3UA 3KLAB 4WW2A 4MCYB 2YBRA 4GOSA 2AJSH 3OJDA 5EZIL 1XGTA 4YUEL 4UDUA 4MD5B 5LGJB 5GSVA 2CGRL 3PP4H 4OLUL 5BW7A 3WD5H 5B39G 3T3ME 5CJOL 1J05A 1LP9A 4HIEA 3QUKA 1S3KL 1G7MB 4L5FL 3DYMA 3L3HA 2C7UB 3BRFA 1YYML 2FECL 3VJ6A 2ZPKH 4FFYL 3GSQB 5A2LH 3JUZA 3UC0H 5K9JL 5ICYB 4LAQL 3U4AA 4L9LB 5F7UA 5C0AE 3HZMA 3WIIL 3FQNA 5DVKA 2WIIB 4NWTL 4FZ8L 2BMKA 3D3VB 3FT3A 3PJSA 3CMGA 2B2XH 5HI5C 3MRBA 5D7IA 4L4VB 5BXFB 1W0WB 5KSAA 4WO4A 2FGWL 1LGVA 4XNMB 3U6RB 4DEPC 4MXQA 5DDHA 2LE9A 2XG5A 4YNYB 5HYFA 3N50A 1UCBL 4XAWH 3ORJA 5K33A 1QFUL 4DKEH 1A2YB 4N0YL 1DBKH 4H26B 3PGFH 3GIZH 4N1HB 4LBEA 1YN7A 6FABH 3JV4B 2R8SL 2J4WL 2O5YL 1B3JA 2B5IC 1LDPL 4Y16A 5DC4B 5I1CL 1S7SA 4MJ5B 5EO1B 4RIRB 3SGDI 2Z31D 1U8OB 1DVFB 5D7SH 2PW1A 1GH7A 5KSAD 4WO4D 1TQCB 2NY0D 2OMNA 1A4JB 4MXQD 2G5BB 2O5ZL 1NCDL 5IB4B 5MEOB 1SEQH 2JCCA 1S9XB 3X3GL 1CLYH 3RGVA 1U95B 2ITDA 5GGUA 4HWEH 4HQQL 1BZQK 2P5WA 3QCUL 4BM7A 4MNHA 3IJHA 5IB3B 4JVPA 5I1GL 1QRNE 4HWNA 1CD8A 1SY6A 3NFPB 2I9TB 2EDKA 5TGBA 2BVUA 4Y16D 3WIHL 3O3DA 1LE9A 2M26A 2R0ZH 4MXWL 2XQYK 4HPYH 3U2SB 1JYVA 2Q7NA 5CEZH 2XIDA 1JGVL 4QY8B 5HHME 4LSQH 5A2JH 4WI3A 4XPFH 4MAUH 1G9NH 4KI5C 4GXUN 2P5WD 1R5IA 3HE6D 4XWOD 5MI0B 5KJRL 4KTEL 3CD4A 4MLIA 1EEYB 4CVUA 1CE6B 4LCIH 5F44A 1UJ3C 2JB6A 5I8CB 1V7NH 2VXSH 2GYSA 1X44A 3MLTA 3T3PE 4OUUB 4I2XA 2BNQA 4NKQB 2VLKE 4LLDA 5E2TH 1OW0A 1U8IB 1PZUB 3OAUL 2AABH 3HC4H 1Y0LB 4PP1D 1ZHNB 4PRPE 3D0LB 1ZGLM 3QQ9C 3IRPX 1RZJL 2MPAH 1F8TH 4OZFG 2FJFB 4G9FB 5EPMB 3QWOA 4U6VH 5LGKA 4HXBL 5D6DA 1HSAB 3HC0B 3MLYH 4NBXB 4QNPF 3FJTA 5DVNA 1MQ8A 3KR3H 1J0KA 2X10A 4Y4FA 1Z9SA 4ONFH 5C0JA 1YMHB 4XP6H 4KZEL 3G08B 5TDNB 1QFOA 4OCXL 4NQUA 4A2LA 4QRSB 5TE6L 4OQTL 2HVJA 3FB5A 3MZGB 1MCRA 4UNUA 1N2RB 3B4NA 1HKFA 1MCPL 2BHUA 5EZOL 3KPMA 3ZHKA 3MRMB 4WUKH 1B6DA 4Y4FD 3D18A 3K2UH 3N06B 3IXTA 1K4CA 3FQTA 4Y8AA 3W9DA 3NCYP 1JWMA 4M4RA 5BS0A 3I50L 4P4KC 2YZ8A 4Z7NF 1PX4A 3JV5A 4H0HB 1AHWB 3X12B 3MJ7B 4NRZA 4PGDA 2F5AL 2R4RL 3IFLH 5JOEA 4HULB 1B0RA 4NIKB 1ZVHA 1DTUA 4TUJA 4YHOL 5IQ7L 2Y36L 1DL7L 3BN9D 4XPTH 4HJJL 4MQ7B 5D5ME 1VFAB 5ISZE 3FFCA 5D1QB 3NZ8B 4WCYH 5BS0D 5FGRA 2QSVA 3ZDZF 3MMEA 4APQC 1MCSA 1NFIA 2EDRA 2LVCA 4HHAA 4K8RH 4FQ1L 1L4IA 4BZ2H 1PQZA 4OZGF 3WHXA 3QIWD 3HMXL 3DBXA 3OAYH 1YEDA 1K6QH 2ZUTA 3DETD 1AGFB 4WW1B 3MUJA 4H1LH 3VG9C 3TESA 4JFXA 2R1WB 4NQDA 1MI5D 5EA0H 3RAJH 2BSRA 1RJCA 4GXVH 1AGDB 1T5WB 2MJWA 2RFXA 3BIBX 3SO5A 3B43A 3KJ4C 3U9UB 3PL6A 4U1NB 3BSZL 5DHVA 1W72A 3FOLB 4FZEL 4ZG1A 2CDEA 3DX8B 4R97C 4UV7L 3RI5K 5BV7C 1DQTA 2D7NA 4PJIA 5BRZE 4X5WA 3VFSA 1EZVY 4P2YA 3CH1A 2C1OA 5HHQB 1S7RA 3KJ6L 3ZDYF 1QSFD 1ZKAA 4NQDD 4KKLD 4J2XA 1FFQA 1KCLA 4LHQB 2DI9A 1F58L 2WP3O 5HVGB 1CXHA 3QFDA 3X14A 3PL6D 3TF7A 1LK2A 3BE1L 2KQNA 3T8XB 3QDGE 2EH7H 3L3KA 3P9LB 1MF2L 4KZDL 2LAGB 4MA1C 4U1KA 5HYJD 4OQ1A 1BF8A 4OZHF 5F96L 1TVHB 2YR3A 3C09C 4LARH 4OZIB 3Q48A 3GKWH 5DS8B 4PRAB 5DD6B 5DZNA 4WI4A 5H8DA 1YNTB 4DKDC 5K9KB 3IFPB 1J0ZA 4PJHF 3UJTL 4RAVB 3V8CA 2H2PD 4K94H 1GC1C 1UJTA 3Q3GA 3GMLA 1MCBA 3DXAE 4HGWA 1NAML 2P45B 1L7TH 4FFZH 4PJAB 3QR2A 1RJLB 2J88H 5BOPA 1P7KA 3CSPA 3P11H 1E6JL 2BC4A 2ATKA 5HI3D 3LV3A 1C08A 2ZCHL 1JN6A 3WFHA 4LFHD 2WBKA 4C59B 3VMNA 1E4KA 3T77B 1HH6A 1RZIB 3CCHB 1FZOA 4XVJH 1RZ7H 1CYGA 1Z2KA 1WBYB 4KI5F 4PJCB 1S7XB 3MLXL 4LLMB 4EOWH 4F37K 4KDTA 3T1WA 3TJHA 3HNSH 2VLRA 1CK0L 1IGMH 2D4DA 2LABA 3STLB 5E8DL 3CX5K 4RDQG 5ENWB 3UYOD 4MCYA 1CFQA 4JN1L 2Y25A 3TO4B 5H35B 2E3VA 3JUYA 1I1AB 1DSFH 4U6YB 3S37H 1S7QA 1I9JH 4NBZB 3A6OA 2GJ6B 1AI1L 3PABB 5TE7H 3REVB 2AW2A 5E9DA 3TJHD 2FBJL 2IAMB 5DJ2B 1EX0A 1AKJB 5F9DC 5CMAA 5HI4D 1H8NA 1U3HB 5FGCE 4PGBA 2J5LC 2CRIA 4JDZA 4P3CL 3MV7E 4LQFL 1JF1B 2DQCH 2E7MA 3F12B 5EFIA 2YXFA 3GIVA 2NY1B 4NDMB 1N26A 4ODTH 4OLUH 4PJEB 3TBSA 1MHPH 1IC5L 5I1LA 5JHDD 5FCSH 1ZHKA 5BXFA 3G6DH 4MS8C 2X44D 4GW1B 1YYMH 1YNLH 3CU7A 1KGCD 5E9DD 5HGGS 5F7DB 4EUPG 2ICEA 3HZVA 4XRCB 1A2YA 3RWHA 4BFEA 4H26A 4PJGF 4QHUB 1ZLUK 3P40A 2HFEB 4KGJA 3QJFA 4NWTH 1JTOA 1YC8A 4XTRC 4UBDC 4GAYA 3TBVA 1MFDL 3MUHL 1UYWH 5T5FH 2A6DB 4JFZL 3VDBA 1DVFA 1TQBB 2NZ9C 4I18B 2F9BT 5B3NA 1H5BC 2P4AB 1A7RH 4KQ3L 3SJVE 1A4JA 3JV6B 1EUUA 5E8OA 1IGIH 1S9XA 2Q3AA 1U95A 2F54B 3HS0A 3REWA 4DTGL 4I0CC 5FOBB 1KLUA 2EYTB 4LSVH 1ZEAL 3PV6B 2NLJB 4X4MA 4U6HA 3QUZB 3UAJD 1MH5A 2GHWB 1KEML 4NFBA 1OF2B 4L3EB 1NC4B 5HDOA 2ADIA 1UXSB 1A3LL 2H32A 1Q9KB 2BZDA 2V5YA 1WV7T 4RGOL 3LN5B 1JPGA 2ARJB 3ZDXE 1JHKL 4FQIH 1DANU 3QUXD 3IGAA 4MSWA 3EYFB 4HQQH 1D3CA 1RMFH 3QUYB 5M94B 4M6ML 4CKVX 4Q9QH 4M3KB 1MFBH 5D2NB 1FNEB 1AXTH 1UACH 2VO5A 7FABH 2XWTA 4WV1A 1PGRB 2F58L 3UDWC 1QG3A 4G6KH 2WY3A 2ZSVB 2APXA 2DMCA 2EYSA 2NY4D 4ODUB 4QLRA 5EU5A 3ARSA 1KB5L 3HR5B 2VDPL 1OPGH 3QFJD 4ZNCD 2ZUXA 4JN2A 1IC4H 3LZFH 5CWSB 4UV4L 2EDBA 1CI5A 3PWNB 4OUUA 1KJ2A 1U8IA 3G6AB 3VDAA 4M1CD 3ZKXC 3S4SA 5DJZA 2CH8A 5J11B 1FORL 4YO0A 1DR9A 3MLSH 4X6EB 5I16A 1YZZA 3EW3B 4KTEH 2HMID 3FT4A 1MJ7L 5DMJB 2NY2D 3L9RB 4GQ9L 4HLZH 5FYKD 4DKFH 4IRJC 1T80A 4G9FA 2C4FT 4J3XA 2ZUQC 1HSAA 2GUOA 2VDQL 3QNZB 2E9JA 3QT2A 1JPFB 5MEQB 1DCLA 2FWOB 1OAYH 3BP7B 5GJSL 2DM2A 3MCKA 2OL3A 2D7TL 5IHLB 1MRDH 4NKOB 5I74B 1CFSB 1YMHA 4JG1H 3G04A 4NT6B 4O4YH 1RZJH 5C0BD 5I15H 1JNHA 5FKAA 4OF7A 1CBVH 3QEGH 1ZGLA 4NQXB 4XP4H 3HNTH 1KN2H 2AVGA 4IDJL 5CZXD 3OB8A 1N2RA 1MLBA 5GPRA 3M17A 3VRLF 4LCCC 2W1NA 4CDHA 2I24N 4HIHB 4P2OC 4YXKL 4MNGE 2LTQB 4IIQC 2JIXB 1MCDA 2FB4H 4YAQB 4TSCH 3L3JA 3TZVB 1BQLH 3MV9A 1MEXL 1CFVL 1KIPA 1HCVA 1WITA 4H20L 1Q0XL 1AHWA 1CF8L 2OXHA 2PO6A 3LD8C 3LQAC 4JM2B 3ULUE 2WP3T 1WZ1L 2VWEC 3C08L 3ARBC 4PJFF 5FF6A 1NEZB 2GQHA 2HWZL 1F42A 4XXDA 5AZ2H 1X5AA 3RWIA 2YRZA 3VRIB 1R0AL 3UJIH 3TO2B 2V6HA 5D1QA 3HI6L 3LRSB 4K9EH 5IWLC 5DMIH 1JJUA 3MV9D 3BGMB 1N8ZB 2I07A 2IQAB 2X4SA 3T3MF 4YHML 1K5NB 3MRRA 2PO6D 2J6EH 1U8MA 4WNQB 4KJPD 4Y5VA 4C83B 4R7DA 1P4IL 4G7VH 2UZXB 1EHLL 4FP8L 4EIZC 4PJ8D 4JDVA 2AK4E 3QRGH 3PHOB 2WK2A 4X4XB 5MHSD 2EKSA 1QLEL 1U3JA 1UVQA 3VFWA 4YZFF 1CD0A 2V17L 3JWDC 1R3JB 3ELAT 3MCLH 3U9UA 4B7LA 2DQUL 3ILPB 1BJ8A 4LKXA 4LHUB 1EH9A 1IEBA 5C0CB 1T22A 4U1MB 3NZHL 3HE7A 3JTCA 4JB9H 3BJLA 4ZUSA 1M71B 3RVWC 4J23A 3MREA 3RWJA 1NSNH 3MODH 4X7SL 4R4FL 3NCJL 2HG5A 2H9GA 3DLQR 4JREC 4NKMA 5LBSL 4R4BB 5FOJA 5F7KC 4M4PA 2AP2A 1CICB 3FZUD 1TNMA 1A7BA 1I9IH 3V6ZA 4MNQA 3RVVD 4WEBL 3WKNA 1AO7D 3T8XA 4Z7UA 3P9LA 1OCWL 3HE7D 1F3JA 2VXUL 1P2CA 1YC7A 4CMHB 1MCIA 5KSBB 3HC3H 4HIIB 4MA8H 3MRCB 5DS8A 3HNVH 5FYJE 43C9B 5CSZB 1XH3B 2X7LB 1F5WA 1ACYH 2A9NH 4RAVA 4RAUB 1TDQA 4OB5L 2QLVB 4LSUH 3U1SL 5D93C 1A1OB 1MF2H 1A5FL 4MNQD 4PJAA 1UB5B 4F9LA 1UXWA 3C2SA 2CLRB 1MLCB 1F4XH 5IVXB 1EEZB 1AQDB 4M1GL 4M03A 3U7WL 4IMKA 5I18L 2NY6B 5I1DA 3BPNB 3DROB 3T77A 3N1QC 1D5BA 1VFMA 3QDMD 4I0PA 1T04A 3C60C 2VTFA 1S7XA 4N0CC 4PB9H 1HYSD 2BOBA 2B39A 4G43B 3TYFA 2OQJA 3EFDH 3CMOH 2VOTA 1NGZA 3STLA 4LSSH 3T3PF 4LPVA 5MENE 1T66C 2Y5TB 5JMRA 4OKVA 1EDQA 4DGYH 1G0DA 4JPVH 1S7WB 2OK0H 2EECA 3WNMA 4R2GC 5ALBL 5BZDB 5T33L 2BDNL 4GXUM 4F2MA 5CEXB 3MZTA 2AJZA 1BZ7A 3ARYA 4N8VB 4I0PD 3PWUB 3PABA 4NCC1 4G8IB 1I4FB 1IBGL 4EBQL 3LRHA 4YHKH 1AKJA 3H0TA 1ZLUH 4DFHA 5F6IB 3WLWD 3SE3C 4YHNB 2Z9TA 3BKMH 3BZFA 4M7ZC 2QQLL 1A02N 1NLDH 1R24B 1FNHA 2GEEA 5DJYA 2I26N 1JF1A 3RWDB 5HJ3B 4UT7H 4JQXC 4CU7A 1HOCB 3UROR 1I7TB 1IKFH 3CFJB 1PG7W 3CFKA 4GW1A 5F7FA 3VWJC 4GT7A 2VSDA 5AG9A 1LNUB 4OCYL 3QSKB 1IGJA 3JZ7A 4FMFA 2APTA 2FO4A 2AXFA 4AQ1B 3VXME 4Y2DB 5JIKA 1T83C 4LLYB 4F15B 1X4ZA 4RNRA 2EC9U 1GIGL 2Z31B 1OAKH 4AL8L 3OBAA 5CILL 1K2DA 4PTTB 1U8JB 3ECBA 3OKEA 2V5SA 4X6FA 2IBBA 5CEZD 2C5DC 1UWEL 2F54A 4KY1H 3SDCB 5FOBA 4WU5B 1H3PH 5IBUB 1EUTA 3K4AA 4MZ3A 3PV6A 1G9MC 3UTPD 3RL2A 2YPKB 1XCQA 1RSFA 3QUZA 3PP3K 3WFDH 5FO7A 3ME0A 3P30L 2Q8BL 3LN5A 4HWBL 1S9YA 5EUOE 2ZG1A 3O0RL 3C6SB 1ZHLB 4ZTPL 3RUGF 2NYYC 1QACA 1A7OH 2CDFB 3EYFA 3QUYA 3BDYL 4PLKD 3W0WD 3P4LA 4J3UA 3RKDD 3LSOB 3QYCA 2W65B 4N9GA 1QTYT 1KEGL 4XCCH 1FNLA 2QSCH 3BAEL 4K3DL 3VXUA 2I60L 3HR5A 4RFOL 2EIEA 1PKQA 2KL6A 4J6RH 1FVCB 1P84K 1F3DH 1G6RH 3UXFA 4OGXL 3RNKB 3SDYL 4PY7A 4DN4H 4Y19A 4RMRA 3VDCA 1U91A 2X1XR 3L9RA 4J3WA 4L8BA 1NCCH 3PV7A 2BVQB 4YHYB 4PRDB 3T09A 2DTSA 2QTEA 3PDOB 3NAAL 2A1WH 5ILTL 2NTFA 3VXUD 5KVEL 3GI9H 1HIML 2JCCE 3KPLA 1M4KA 5FDWA 4AT6B 1WFTA 1N7MH 1WWWX 4F7TB 1TVBB 2KZ1B 4U0RB <