3SQVA

Crystal structure of e. coli o157:h7 e3 ubiquitin ligase, nlel, with a human e2, ubch7
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
612
structure length
606
Chain Sequence
QGRACLSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGCTAVLTDMLTEHAKESFPEIFSLYYPVAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of two bacterial HECT-like E3 ligases in complex with a human E2 reveal atomic details of pathogen-host interactions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase/signaling protein
molecule keywords secreted effector protein
total genus 166
structure length 606
sequence length 612
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13979 SopA_C SopA-like catalytic domain
A PF13981 SopA SopA-like central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4140.10 Mainly Alpha Orthogonal Bundle effector protein (NleL) fold effector protein (NleL) 3sqvA04
1.25.40.300 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Putative secreted effector protein 3sqvA02
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3sqvA01
3.40.1850.10 Alpha Beta 3-Layer(aba) Sandwich HECT-like ubiquitin ligase fold HECT-like ubiquitin ligase 3sqvA03
2XT2A 4YEIA 5DNSA 2QZAA 4YC5A 2O6WA 2XTYA 4YDTA 3DU1X 3PSSA 2J8KA 2XTWA 3SQVA 2XTXA 3SY2A 4YFOA 4YCQA 3NB2A 2XT4A 3PSZA 3NAWA 2QYUA
chains in the Genus database with same CATH superfamily
2GRMA 3ZN3A 1CZFA 4AVXA 2NTPA 5KBAA 2P9LG 3E4BA 1JWGA 4RG9A 4Y6CA 2Z8GA 3CEQA 3CSFA 3SZEA 4UWHA 4N5QA 1LLWA 1LF8A 1A17A 3Q5MA 3I5PA 3PNLB 3WG7E 5E75A 2VBEA 3BG0B 1JUQA 4WWPA 4JA7A 2WXPA 4XORA 3ZHEB 2J08A 3SUCA 3EHRA 1KT1A 1Y8MA 4GTVA 1O8LA 3SF4A 4XL9A 2I1JA 3P4GA 3C5RA 2EIJE 5JJTA 3FEXA 2GROB 2NXPA 2YHCA 3ZIMA 4GYWA 3FUFA 3SQVA 3ML9A 5BXOA 4HLEA 4A3VA 2ZISA 4LUNU 5JMND 1SQMA 4FULA 4KT6B 4N5CA 3AK5A 4OM9A 3FU5A 3TWQA 3P2BA 3CHQA 4I2WA 2L6JA 3CKCA 3TWVA 4FA6A 3FP3A 2WXOA 3N6ZA 3PUJA 4U95D 3T9GA 1KTWA 4YZXA 3TJPA 5EIBE 1DC2A 3TWWA 4TUUA 4U0ZA 1TYXA 2X3MA 3F6QA 2FO1E 3FEYA 4J8FA 1JCSA 3X2QE 5BNWA 1FT2A 3G2SA 1PLUA 2F37A 2IOSA 1H80A 4APFA 1WAO1 4K5CA 4H7XA 2O04A 3UUXA 1OY3D 4XI9A 1HZ4A 5G55A 4YDYA 4MS6A 1OWMA 4ZHBA 3SBSA 5FIOA 2OVBA 3DSSA 2B6CA 5B3SE 2BUGA 4IYPA 4YDTA 3CK8A 3OTNA 1UOHA 3ML8A 4K5AB 1H2VC 4YVQC 1NA0A 2UY1B 4FHKA 1IXVA 4U8VD 3OAWA 1E8ZA 4CEMA 2V5QC 2O0WA 3FU3A 2WQ6A 4YZQA 2UVEA 1QNFA 1DBOA 4XKBA 3U4TA 3SZ7A 2DCPA 1MX6A 1QA2A 5FQ8A 1TNBA 4ATGA 5DBKA 5IY5E 2OEWA 1OWPA 2NYJA 2V5FA 2YQ8A 3GZSA 2V4HC 4XKVA 1N4RA 5JHBA 3SBTB 3U64A 1S0PA 2L0TB 3DSWA 2DYSE 2VJ8A 3BUAA 4BESA 4EPZA 1O8GA 4XEIG 2GRQB 1IKND 4I6EA 1TYVA 4XE0A 4GPKA 3VLEA 3GW4A 3GQ7A 3HDXA 2G0YA 3FUJA 2WXIA 5KJLA 4I1AA 3ZRHA 3FTXA 3L6AA 1QYMA 2HYZA 2J4BA 4ATZD 3OXGA 2QZAA 4XN0A 1UJJA 3KAEA 3FUMA 2INVA 2J4DA 3DU1X 2PM6A 2ZXWE 3LJYA 1JPLA 4DPRA 5J08A 4G26A 3RRNB 1U3DA 4N3BA 4XQFA 1RMGA 1QQ1A 1BLXB 2LNIA 1E7VA 2I9CA 1TNOA 1BD8A 5ENRD 1NP7A 3R9MA 3B90A 3AS8A 3LYAA 4RQIA 3VSVA 3JQ1A 1S70B 1HX8A 1OCOE 1U2VG 2IO3C 3EUVA 1H0AA 3QK0A 1D9SA 4F6RD 1OXJA 2WM9A 1ZBPA 2QYUA 2R59A 3NQPA 1EYHA 4OZZA 2FBNA 3T5VA 4P29A 3U9WA 3B13A 5T4YA 2QX3A 4AEZC 3CGHA 1PXZA 4G25A 3B7BA 2KCLA 2O0VA 2X6WA 4GCNA 4U7EB 2DWZA 4XM3A 4UI9K 3G2UA 2PM7A 1E8XA 1OOCA 3FH5A 4XLFA 3QOUA 4L7TA 2LSVA 3NOGD 4U0SA 4ZFHA 5D0OD 3PVLA 1SA5A 4UI9C 3UKUG 3PSSA 1HS6A 1VBLA 2KZTB 1TR4A 2XCBA 1LD8A 1N4QA 1E90A 2HO1A 2X6HA 2XT4A 1OGOX 3L13A 4BSXA 3KEZA 2WXNA 1N54A 3N71A 5CEDB 1KCCA 1IB4A 4HQDA 1FVHA 4J0UA 1OFDA 3P1UA 1DVPA 4G11A 3JXJA 1N0RA 3W9FA 3PREA 2VJIA 3ZU7B 4A1GA 2RKKA 1CLWA 5KNHD 1K4ZA 3CHRA 5LCWJ 3CHMA 1JCQA 2F0YA 2XEVA 5C2YA 4MBGA 2XEHA 4L9PA 5AYWD 3D3MA 3EIJA 3VSTA 3ABME 4FC8A 5EYLA 1K8FA 3Q7FA 4XONA 1EPUA 4CGVA 3R7RA 5FQ4A 1G3NB 2CFZA 4XLEA 4DX2A 3DXMG 1TN6A 4ABNA 3SHFA 3L08A 5EN5D 5LCWC 2P9UG 2KBXA 2P9IG 4ILHB 2XS1A 3CV0A 2YINA 2QY7A 2NT6A 3S7JA 4DJAA 5C1DA 5AAOA 4CRWA 4WUYA 2UWJG 3DSTA 1IA5A 1RWRA 5CCLA 1UN9A 1HH8A 2DVWA 2GRNB 2KXPC 2LAIA 3MEKA 2X6YA 5EILA 4GTRA 3ML3A 2Y1LE 3L17A 2XEEA 4N39A 5ARGA 2KCVA 2RG8A 4GZ5A 3R7QA 4YDOA 4R7LA 2V5IA 3CQCB 3B7TA 2VGYA 4C0MA 5KJNA 4TXQA 1O8HA 3PSZA 4DX6D 2VSXE 4BT9A 4K5BA 4I9CA 2J07A 3EHMA 4URRA 3PZ4A 4I1MA 4GTPA 4DX1A 4WNFA 3TWSA 1UJKA 5CRUA 2L6BA 1DNPA 1OFMA 2WXRA 3MYVA 1IQRA 3KD7A 3UW0A 3QJZA 2B0RA 2W7ZA 2IQCA 4K03A 3JX8A 3TWTA 5JHAA 3ABLE 4PUCA 3APCA 3ESLA 2H6HA 2M63A 1IDJA 1O8KA 4U49A 2WXJA 3T5XA 4GYYA 2VFPA 4GTSA 3FUIA 1OWOA 2XPZA 2AXVA 4XMYA 1K3ZD 1QBQA 3ZNGA 4MLPA 5FZRA 2NSTA 1BPOA 2NTBA 1K5CA 2VTBB 3PE3A 4JPSA 2AWIA 4KZ0A 3IHYA 3FDHA 4Z06A 1N11A 5AN8A 4BT8A 4QFVA 3CVWA 2XGSA 1GW6A 1EA0A 5JJ6A 3ZYLA 3DEPA 3FULA 5AIJA 3Q4AB 4GMRA 4U8HA 3SFYA 3PEVB 2NSZA 4JA9A 3S7DA 3ZVVA 3UI2A 1KPSB 4CDNA 2NZMA 4FJYA 4XR6A 2UY1A 4CYMD 4XOPA 5CMWA 2KC7A 4U07A 1N4PA 3CVXA 3MKQB 3ZYMA 2AXZA 3R9AB 4ACKA 4V3IA 3OXLA 3I3NA 1Z3XA 4BERA 5KJKA 4JRAC 4YCQA 3ZHEA 4NK8A 4JXTA 1V54E 3ABKE 2YUHA 4YEIA 4MR0A 4UQYA 4J8EA 5ITZF 4JEHA 2RFAA 2F8YA 4FLHA 4HB5A 4HRNA 1LLZA 4KVMA 3UPVA 1OFEA 4HOTA 3C3OA 5FZQA 2GRLA 3LCAA 1D8EA 1Z5SC 4ANXA 1SW6A 4CDMA 1K1AA 4HI9A 4GU5A 5ARFA 2F8XK 1QRBA 4W8TA 4F1PA 2AVPA 3V30A 5ENPD 4YNDA 4U63A 4BSZB 1O8DA 3FFLA 4HXIA 3QC1A 4APOA 3Q9NC 1OCRE 2IO2C 5CEAA 4NURA 4I6GA 4CT0A 4I2ZA 5HKPA 2XTYA 2AXUA 2CHWA 3G2VA 2PQNA 4OAUC 2ODLA 1IHBA 2DBAA 2BF0X 4MRUA 3E30A 4J6IA 5M72A 1TNYA 3NB2A 5JJ7A 1WY6A 2HM8A 1X81A 3MKQA 3V79K 3AG4E 3NZUA 2L9BA 3TWRA 3L54A 3FTVA 3ZKJA 1ZU2A 3CVPA 3SNXA 2O6WA 3FH8A 3LVQE 5H7PA 5AQAA 5A6CA 3SGHA 1YA0A 4JB8P 4CZ2D 4FJZA 2ZGDA 4C0EA 5BXUA 3FH7A 1YMPA 3RIQA 2R03A 4B94A 2Y4TA 4OZYA 3MV3B 4JHKA 3MZLB 1QCXA 3ASNE 4YVOA 2IY0C 3HXFA 5HI7A 4HOSA 1A5EA 2DYRE 4WNEA 5FQ7A 1KZOA 1KLXA 2IONA 1BN8A 3FWVA 1OGMX 5CECB 2DZNA 4B8AA 5A7DB 2X6KA 4EBAA 2NC9A 4Q94A 1AIRA 3AU5A 4X8QA 4YZAA 4OAVB 1L5JA 2J49A 2QYJA 2J8IA 1D8DA 2XHEA 1OCCE 4XNFA 3MA5A 3FTSA 4DX7D 4D10C 4PS7A 2IFUA 3CVVA 2VGEA 2PECA 4UUCA 3RO3A 4OJOA 4F1SA 5ANRA 4XKCA 5BT1A 2J8SD 4Z05A 3AG3E 3GZ1A 3UINC 4B0ZA 3S7BA 4OJLA 2FF4A 4OVUA 4GAAA 1MHQA 4JC8A 3ZPPA 3CKBA 2LAHA 2P9NG 4EQFA 2BKKB 1FPPA 4GCOA 3PZDA 4DRXE 3Q7AA 3JUEA 3ZGQA 5CMYA 3APDA 4BEPA 1EDUA 1N0QA 2VBMA 2Y0BG 3GZ2A 3GQ9A 4RG6A 4YFOA 3OXFA 5FTPA 3Q15A 3LXUX 2WXHA 1MYOA 3DPDA 3BEEA 1N94A 4GZDA 5B1BE 4N2QA 1MX4A 2F3LA 3MGBA 4HWVA 2ONDA 2GGFA 1DCEA 3HRAA 2EIME 2FULA 3MCXA 1E96B 3B4NA 4C9BB 3VMVA 4I6JA 3DWLG 2BM5A 5DIZA 4WNGA 3T9KA 3LY9A 3EU5A 4LNGA 4ACLA 3NOCD 3ZSCA 2CG3A 2ETCA 2IOLA 3T8KA 3PS6A 2OVFA 3CHSA 2Y69E 3AG1E 4L2YA 3DSXA 1HF8A 3JCKC 3I4GA 4GA1A 3E33A 3VLFA 1MQSA 3D9HA 3E37A 4Y6WA 3PE4A 2JLBA 2LUHA 2BEDA 4WWOA 4XI0A 3HG0D 3T8MA 1HG8A 4XLAA 3RAUA 5LFAA 5JLVC 5BPPA 3IV0A 3GQ8A 4RSYA 1SA4A 4YDEA 3Q78A 5ENTD 1N9AA 1NFIE 4XKWA 1W3BA 4IN3B 1RU4A 3B7UX 2LSUA 5BUZA 4JHRA 2BTDA 5CBNA 5T3RA 4F53A 2FEZA 3J5PA 3HXDA 2KCKA 2I6HA 3QB2A 3BG1B 2WXQA 4A55A 3URZA 3RSEG 3LDZA 3MX3A 2HR2A 2DIWA 3RRUA 3RO2A 1EZGA 1TNUA 4ILIA 3KSLA 4ANWA 1DBGA 1TJFA 5LX8A 4JZYA 2C0MA 5LP0A 1PE9A 1E7UA 1INZA 4NIKA 3ASOE 3ULQA 1TYUA 4U4BA 4GB9A 3PNTB 4U8YD 2A4ZA 4BX9A 3QWPA 4EZLA 1PY1A 3ULYA 4DLQA 1QA1A 4G24A 5ENNA 1NL4A 3LMWA 3WXXA 4LG6A 4I43A 4GTOA 4LSZE 4U04A 4GTMA 1MX2A 3MJWA 5ENSD 3UM3A 4HRLA 3EHNA 4XZ4A 5EX0A 4XX5A 2R17C 3B7RL 3PZ1A 5DNSA 1OCZE 1FCHA 2PZIA 1PAQA 4LNBA 2J8KA 3UTMA 2BM6A 1JCRA 3G2WA 5EDSA 3TG5A 2E2EA 3L22A 1RW2A 4LCTA 3MV2B 3RJVA 1X0CA 4KVOA 3JQ0A 2DZOA 3ZW3A 4YC5A 4O1OA 2UVFA 2XTWA 3FTUA 3CLJA 1U3CA 4LNUD 2C0LA 5CHEE 2YNQA 2CG2A 4V02C 4EZJA 2ETBA 2QFCA 4PS3A 2E0IA 1TN7A 4HOQA 3B7SA 5EYPF 1S64A 3O4ZA 3UXGA 3TXNA 1YCSB 2OOEA 2PQRA 3JXIA 2XTXA 3SO8A 3QDNA 3SFZA 4AJWA 4LEUA 2VSNA 4EW9A 4J8DA 1KQ5A 3VMWA 3VTYA 4HORA 4O1PA 3V31A 3EJNA 3U3WA 3D9KA 3VTXA 2XC1A 1AP7A 4DI3A 2B0OE 3RIBA 4OPWA 4O6FA 1H6PA 4FU3A 4AM9A 1BU9A 3ONKA 3LKUA 4UWLA 2VTBA 2WXGA 4U96D 3TAXA 4C48B 3KEAA 3RU0A 4L1BA 5T8IA 3SYJA 1OFLA 2EILE 1SZAA 4TUMA 1DABA 2WXFA 1RZ4A 2R2LA 3EHQA 3JYSA 3BH6B 3L82A 3CVQA 1EF1C 5HS0A 5BV1A 4AV7A 3D9PA 1UG3A 1NA3A 3DSVA 4MKTA 1LM1A 4ME2A 3L9TA 2QC9A 3B95A 1ELKA 3NF1A 4IULA 1K8KG 4YZ0A 2R05A 4JD2G 4UWFA 4M3OA 3PDNA 3CVUA 3ASHA 5CCMA 2IF4A 4HNAD 4H7YA 3UQ3A 2PNNA 3LJ3A 2MYOA 3D9IA 2P58C 2VGXB 2XQ0A 3AG2E 1Y6IA 2XZTG 2R02A 1FT1A 4GMJA 3TWUA 2QXZA 3FHEA 1HF2A 2XPIA 5ANLA 4HLLA 4I84A 3UT4A 4FLBA 1H19A 4HBDA 1JRGA 3AJIA 2BM4A 2IEJA 2LXMA 4WWNA 2P9SG 1QQEA 3ZYQA 1V55E 4BTAA 4DLOA 5KJMA 4Q96A 4XLCA 1BI8B 3GQAA 4W9RA 4CCAA 1KCDA 1NHCA 2VJJA 3CSTA 3ESKA 3QNKA 3VSUA 3V2OA 3Q75A 4BX8A 4M7CA 1O8IA 3PH0C 5ENQD 3ISMC 4EBAG 2P9PG 3ULEG 3GYZA 3S2AA 5KWDA 1X5BA 3C3RA 1IQUA 3K9IA 2PYHA 2WQ7A 2MHKA 5AJDA 4OJ5A 3CVLA 2P9KG 2PL2A 4WNDA 4NQ0A 1IYGA 5BW8C 2V8SE 1TN8A 1WM5A 4GZCA 4O60A 1QZ2A 1XG2A 5B1AE 4Q69A 3QWVA 4N3CA 2XCCA 4W8RA 2J09A 2V0PA 4RVBA 4TXRA 4W8SA 2NTQA 4HRMB 3V2XA 3Q47B 2IJGX 1O8EA 3LYCA 4B93B 4UQZA 4GA2A 1SZ9A 3RK6A 3SD5A 1S63A 4EECA 1Z3YA 4XN3A 1UW4B 1IDKA 3FTWA 4I9EA 2IOUG 3E34A 2OEVA 1N95A 4JW1A 4CGWA 4KXKB 5KCMA 3IEGA 2I1KA 3IXEA 2Y3AA 2BKGA 5AJLA 3UIPC 2QY1A 3FUNA 1JTAA 1E8WA 3FTYA 2H6IA 4E85A 4BWRA 2I2OA 4TV3A 2XRZA 4U0UA 1H2TC 2FO7A 1O5MA 5EX3A 1TNZA 3UM1A 1L1IA 4GMLA 4G8KA 3BH7B 3UM2A 4GYOA 3SFXA 5HQ8A 5AARA 3TH0A 1O8MA 3C98A 1LTXA 5FQ6A 3ZXSA 4EZKA 4BY6A 4F7AA 3NAWA 3UKRG 1MZCA 1AWCB 4TXPA 4XIFA 3UT7A 2VFMA 3Q49B 5C1EA 2A5EA 2J9QA 3ENEA 3ONLA 3D9JA 2VSYA 4ANUA 2X38A 3FU6A 1ELRA 3O48A 2PYGA 3DPYA 3D9OA 1GQ8A 1O1TA 5A23A 3DRAA 1KT0A 2JABA 3KSQA 5CBOA 1HE8A 2GRRB 2WQHA 4YDWA 3UM0A 2VFNA 3AU4A 1OUVA 3AS5A 2VGXA 5AENA 5JMCB 3D9NA 3FU0A 5AQ7A 4BFRA 2LXLA 3AAAC 4OYSA 4PDXA 3DSUA 3I4RB 3UMVA 4URKA 5E76A 4BTBA 4NACA 2KATA 2EWEA 1XGWA 3DBSA 3L16A 3IBEA 1QJVA 1KZPA 2VBKA 3Q73A 4A3TA 4AXHA 3HYMB 1UN8A 4GA0A 3EIQC 4AIFA 2AW6A 1BI7B 3CIAA 3HVEA 2WB2A 3ASDA 2EINE 4EHMA 4YEJA 2KZTA 2WXKA 3HXEA 5KNGA 3MKRA 2L0IA 3APFA 3PRZA 3C72A 2XZDG 3CHPA 3CHOA 4JL0A 3ZUVB 3LEWA 4J8YA 2KM4A 3H09A 4I1OB 4NK6A 1ZB1A 3DEOA 2EIKE 2FI7A 3BU8A 1EE6A 2IU1A 4B8CB 3ASGA 4AVZA 5G04C 3QKYA 3ZFWA 1P5QA 1O1SA 3D9LA 2MRIA 2X6IA 1O88A 2RD0A 3HXBA 2MOWA 2ZIRA 1H6KA 4GZ3A 3S7FA 2YHEA 2H6FA 2ILRA 1TYQG 3HVEB 1DCQA 4B89A 4UQXA 4MXNA 5G2NA 2OCCE 3TWXA 3LVRE 2A5UA 2AJAA 4A63B 2LO6A 4OJ6A 4DX5D 3DXKG 3KRGA 2XGMA 5FINA 3N90A 5FT9A 1N52A 4HOUA 1HO8A 4TRQA 4ILGA 2CHZA 2VFQA 5G05C 3TXMA 2Q7FA 3LS8A 4FHJA 4J7WA 4GTQA 4G1TA 1WMRA 2OV8A 1LD7A 5CRVA 3NZSA 2XRYA 1ELWA 5EKQD 5AMVA 3QAQA 3NBNB 5CERB 5G05J 1MJ0A 1K1BA 3PZ2A 4GZ6A 4KBQA 4HVBA 3IKOB 4AY5A 3GRHA 3FUKA 2WXMA 3D9MA 2EQXA 3CVNA 4AOFA 2NT9A 3JURA 4DUIA 2CFUA 3UX4A 4E6HA 4G23A 4G8LA 1HXIA 2C2LA 3CK7A 3EQNA 4YELA 4F3VA 3B8YA 5AQBA 4HS2A 3RRMB 5AQ9A 4XOTA 4LRZA 1HG5A 2O1DA 4QQIA 1SVXA 3Q79A 2BSPA 3FUDA 3ZPJA 4CDRA 2WVIA 1HG2A 3FTZA 3PUKA 1VDYA 1H6OA 3HXCA 3C3QA 1JWFA 1XNFA 3KS2A 1O1RA 4Z68A 4AP2A 2R5SA 4HI8A 4G2VA 5LOZA 2WMNA 3VLDA 4RLYA 3UT8A 3FY3A 1N4SA 3ASFA 5JA4D 3QWWA 3U66A 4LERA 2P2CP 3J5QB 1OWLA 5FWQA 3LPZA 1OT8A 2CHXA 2ZGGA 2X6XA 1PC2A 3SY2A 4IRUA 4UWKA 3JUIA 5D2MC 4I17A 2ZU6B 3CVYA 2JEKA 3WWGA 1HFAA 3ZXPA 1O8JA 3W9GA 1TJCA 2X6JA 5BV0A 2HE0A 1B89A 4FP7A 2X85A 4JVSA 3FUHA 2ETAA 4J8SA 4JHJA 1WDYA 3SI5A 4ANVA 2XT2A 3PZ3A 2XENA 3HIZA 2X6FA 4C2LA 4OVVA 5D66A 1TSPA 3TG4A 2VQ2A 2X3HA 3LY7A 4W8QA 2BX6A 4PS8A 2WMOA 1HU3A 2XGOA 4KYOB 4PH4B 1OWNA 2XS8A 3CK9A 5EIDA 3TGOA 1O8FA 2NSPA 4KZCA 1TEZA 1FVFA 2VFOA 3PEUB 1YYHA 2VSOE 5FJYA 2GRPB 4L23A 1Z6TA 2O17A 4CT4A 4AY6A 4NRHB 5C1CA 4UWGA 3IHVA 4KMOA 3LY8A 4GTTA 3CQGB 4FADA 5HRYA 4KH3A 3CR3A 2XPYA 5G04J 4A1SA 3ZYKA 2WXLA 3FUEA 2INUA 3E32A 3G2TA 1WXRA 1TYWA 1QRCA 5ENOD 3LJNA 2V4LA 4GPMA 1H2UA 2VYIA 5D0QD 2H6GA 3UIOC 4N2SA 3Q9UC 4DI4A 1NZNA 3EU9A 5FZSA 4DK5A 1Q2ZA 3RKVA 3HHMA 5J90A 2GW1A 3ZEFA 2RFMA 2BM7A 3EDTB 3PETA 3BQOA 3AS4A 2WPVA 4L2LA 4JEUA 4XLHA 1QA3A 4UI9J 4WAFA 1WG0A 3EQOA 4Z03A 4BETA 3TL5A 1IHGA 4N3AA 2IQ7A 3QARA 4K0RA 2Y4UA 1BHEA 4HFGA 3FY4A 4OJPA 1NI1A 1E8YA 4PMHA
chains in the Genus database with same CATH topology
2XT2A 4YEIA 5DNSA 2QZAA 4YC5A 2O6WA 2XTYA 4YDTA 3DU1X 3PSSA 2J8KA 2XTWA 3SQVA 2XTXA 3SY2A 4YFOA 4YCQA 3NB2A 2XT4A 3PSZA 3NAWA 2QYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XT2 A;  4YEI A;  5DNS A;  2QZA A;  4YC5 A;  2O6W A;  2XTY A;  4YDT A;  3DU1 X;  3PSS A;  2J8K A;  2XTW A;  3SQV A;  2XTX A;  3SY2 A;  4YFO A;  4YCQ A;  3NB2 A;  2XT4 A;  3PSZ A;  3NAW A;  2QYU A; 
#chains in the Genus database with same CATH topology
 2GRM A;  3ZN3 A;  1CZF A;  4AVX A;  2NTP A;  5KBA A;  2P9L G;  3E4B A;  1JWG A;  4RG9 A;  4Y6C A;  2Z8G A;  3CEQ A;  3CSF A;  3SZE A;  4UWH A;  4N5Q A;  1LLW A;  1LF8 A;  1A17 A;  3Q5M A;  3I5P A;  3PNL B;  3WG7 E;  5E75 A;  2VBE A;  3BG0 B;  1JUQ A;  4WWP A;  4JA7 A;  2WXP A;  4XOR A;  3ZHE B;  2J08 A;  3SUC A;  3EHR A;  1KT1 A;  1Y8M A;  4GTV A;  1O8L A;  3SF4 A;  4XL9 A;  2I1J A;  3P4G A;  3C5R A;  2EIJ E;  5JJT A;  3FEX A;  2GRO B;  2NXP A;  2YHC A;  3ZIM A;  4GYW A;  3FUF A;  3SQV A;  3ML9 A;  5BXO A;  4HLE A;  4A3V A;  2ZIS A;  4LUN U;  5JMN D;  1SQM A;  4FUL A;  4KT6 B;  4N5C A;  3AK5 A;  4OM9 A;  3FU5 A;  3TWQ A;  3P2B A;  3CHQ A;  4I2W A;  2L6J A;  3CKC A;  3TWV A;  4FA6 A;  3FP3 A;  2WXO A;  3N6Z A;  3PUJ A;  4U95 D;  3T9G A;  1KTW A;  4YZX A;  3TJP A;  5EIB E;  1DC2 A;  3TWW A;  4TUU A;  4U0Z A;  1TYX A;  2X3M A;  3F6Q A;  2FO1 E;  3FEY A;  4J8F A;  1JCS A;  3X2Q E;  5BNW A;  1FT2 A;  3G2S A;  1PLU A;  2F37 A;  2IOS A;  1H80 A;  4APF A;  1WAO 1;  4K5C A;  4H7X A;  2O04 A;  3UUX A;  1OY3 D;  4XI9 A;  1HZ4 A;  5G55 A;  4YDY A;  4MS6 A;  1OWM A;  4ZHB A;  3SBS A;  5FIO A;  2OVB A;  3DSS A;  2B6C A;  5B3S E;  2BUG A;  4IYP A;  4YDT A;  3CK8 A;  3OTN A;  1UOH A;  3ML8 A;  4K5A B;  1H2V C;  4YVQ C;  1NA0 A;  2UY1 B;  4FHK A;  1IXV A;  4U8V D;  3OAW A;  1E8Z A;  4CEM A;  2V5Q C;  2O0W A;  3FU3 A;  2WQ6 A;  4YZQ A;  2UVE A;  1QNF A;  1DBO A;  4XKB A;  3U4T A;  3SZ7 A;  2DCP A;  1MX6 A;  1QA2 A;  5FQ8 A;  1TNB A;  4ATG A;  5DBK A;  5IY5 E;  2OEW A;  1OWP A;  2NYJ A;  2V5F A;  2YQ8 A;  3GZS A;  2V4H C;  4XKV A;  1N4R A;  5JHB A;  3SBT B;  3U64 A;  1S0P A;  2L0T B;  3DSW A;  2DYS E;  2VJ8 A;  3BUA A;  4BES A;  4EPZ A;  1O8G A;  4XEI G;  2GRQ B;  1IKN D;  4I6E A;  1TYV A;  4XE0 A;  4GPK A;  3VLE A;  3GW4 A;  3GQ7 A;  3HDX A;  2G0Y A;  3FUJ A;  2WXI A;  5KJL A;  4I1A A;  3ZRH A;  3FTX A;  3L6A A;  1QYM A;  2HYZ A;  2J4B A;  4ATZ D;  3OXG A;  2QZA A;  4XN0 A;  1UJJ A;  3KAE A;  3FUM A;  2INV A;  2J4D A;  3DU1 X;  2PM6 A;  2ZXW E;  3LJY A;  1JPL A;  4DPR A;  5J08 A;  4G26 A;  3RRN B;  1U3D A;  4N3B A;  4XQF A;  1RMG A;  1QQ1 A;  1BLX B;  2LNI A;  1E7V A;  2I9C A;  1TNO A;  1BD8 A;  5ENR D;  1NP7 A;  3R9M A;  3B90 A;  3AS8 A;  3LYA A;  4RQI A;  3VSV A;  3JQ1 A;  1S70 B;  1HX8 A;  1OCO E;  1U2V G;  2IO3 C;  3EUV A;  1H0A A;  3QK0 A;  1D9S A;  4F6R D;  1OXJ A;  2WM9 A;  1ZBP A;  2QYU A;  2R59 A;  3NQP A;  1EYH A;  4OZZ A;  2FBN A;  3T5V A;  4P29 A;  3U9W A;  3B13 A;  5T4Y A;  2QX3 A;  4AEZ C;  3CGH A;  1PXZ A;  4G25 A;  3B7B A;  2KCL A;  2O0V A;  2X6W A;  4GCN A;  4U7E B;  2DWZ A;  4XM3 A;  4UI9 K;  3G2U A;  2PM7 A;  1E8X A;  1OOC A;  3FH5 A;  4XLF A;  3QOU A;  4L7T A;  2LSV A;  3NOG D;  4U0S A;  4ZFH A;  5D0O D;  3PVL A;  1SA5 A;  4UI9 C;  3UKU G;  3PSS A;  1HS6 A;  1VBL A;  2KZT B;  1TR4 A;  2XCB A;  1LD8 A;  1N4Q A;  1E90 A;  2HO1 A;  2X6H A;  2XT4 A;  1OGO X;  3L13 A;  4BSX A;  3KEZ A;  2WXN A;  1N54 A;  3N71 A;  5CED B;  1KCC A;  1IB4 A;  4HQD A;  1FVH A;  4J0U A;  1OFD A;  3P1U A;  1DVP A;  4G11 A;  3JXJ A;  1N0R A;  3W9F A;  3PRE A;  2VJI A;  3ZU7 B;  4A1G A;  2RKK A;  1CLW A;  5KNH D;  1K4Z A;  3CHR A;  5LCW J;  3CHM A;  1JCQ A;  2F0Y A;  2XEV A;  5C2Y A;  4MBG A;  2XEH A;  4L9P A;  5AYW D;  3D3M A;  3EIJ A;  3VST A;  3ABM E;  4FC8 A;  5EYL A;  1K8F A;  3Q7F A;  4XON A;  1EPU A;  4CGV A;  3R7R A;  5FQ4 A;  1G3N B;  2CFZ A;  4XLE A;  4DX2 A;  3DXM G;  1TN6 A;  4ABN A;  3SHF A;  3L08 A;  5EN5 D;  5LCW C;  2P9U G;  2KBX A;  2P9I G;  4ILH B;  2XS1 A;  3CV0 A;  2YIN A;  2QY7 A;  2NT6 A;  3S7J A;  4DJA A;  5C1D A;  5AAO A;  4CRW A;  4WUY A;  2UWJ G;  3DST A;  1IA5 A;  1RWR A;  5CCL A;  1UN9 A;  1HH8 A;  2DVW A;  2GRN B;  2KXP C;  2LAI A;  3MEK A;  2X6Y A;  5EIL A;  4GTR A;  3ML3 A;  2Y1L E;  3L17 A;  2XEE A;  4N39 A;  5ARG A;  2KCV A;  2RG8 A;  4GZ5 A;  3R7Q A;  4YDO A;  4R7L A;  2V5I A;  3CQC B;  3B7T A;  2VGY A;  4C0M A;  5KJN A;  4TXQ A;  1O8H A;  3PSZ A;  4DX6 D;  2VSX E;  4BT9 A;  4K5B A;  4I9C A;  2J07 A;  3EHM A;  4URR A;  3PZ4 A;  4I1M A;  4GTP A;  4DX1 A;  4WNF A;  3TWS A;  1UJK A;  5CRU A;  2L6B A;  1DNP A;  1OFM A;  2WXR A;  3MYV A;  1IQR A;  3KD7 A;  3UW0 A;  3QJZ A;  2B0R A;  2W7Z A;  2IQC A;  4K03 A;  3JX8 A;  3TWT A;  5JHA A;  3ABL E;  4PUC A;  3APC A;  3ESL A;  2H6H A;  2M63 A;  1IDJ A;  1O8K A;  4U49 A;  2WXJ A;  3T5X A;  4GYY A;  2VFP A;  4GTS A;  3FUI A;  1OWO A;  2XPZ A;  2AXV A;  4XMY A;  1K3Z D;  1QBQ A;  3ZNG A;  4MLP A;  5FZR A;  2NST A;  1BPO A;  2NTB A;  1K5C A;  2VTB B;  3PE3 A;  4JPS A;  2AWI A;  4KZ0 A;  3IHY A;  3FDH A;  4Z06 A;  1N11 A;  5AN8 A;  4BT8 A;  4QFV A;  3CVW A;  2XGS A;  1GW6 A;  1EA0 A;  5JJ6 A;  3ZYL A;  3DEP A;  3FUL A;  5AIJ A;  3Q4A B;  4GMR A;  4U8H A;  3SFY A;  3PEV B;  2NSZ A;  4JA9 A;  3S7D A;  3ZVV A;  3UI2 A;  1KPS B;  4CDN A;  2NZM A;  4FJY A;  4XR6 A;  2UY1 A;  4CYM D;  4XOP A;  5CMW A;  2KC7 A;  4U07 A;  1N4P A;  3CVX A;  3MKQ B;  3ZYM A;  2AXZ A;  3R9A B;  4ACK A;  4V3I A;  3OXL A;  3I3N A;  1Z3X A;  4BER A;  5KJK A;  4JRA C;  4YCQ A;  3ZHE A;  4NK8 A;  4JXT A;  1V54 E;  3ABK E;  2YUH A;  4YEI A;  4MR0 A;  4UQY A;  4J8E A;  5ITZ F;  4JEH A;  2RFA A;  2F8Y A;  4FLH A;  4HB5 A;  4HRN A;  1LLZ A;  4KVM A;  3UPV A;  1OFE A;  4HOT A;  3C3O A;  5FZQ A;  2GRL A;  3LCA A;  1D8E A;  1Z5S C;  4ANX A;  1SW6 A;  4CDM A;  1K1A A;  4HI9 A;  4GU5 A;  5ARF A;  2F8X K;  1QRB A;  4W8T A;  4F1P A;  2AVP A;  3V30 A;  5ENP D;  4YND A;  4U63 A;  4BSZ B;  1O8D A;  3FFL A;  4HXI A;  3QC1 A;  4APO A;  3Q9N C;  1OCR E;  2IO2 C;  5CEA A;  4NUR A;  4I6G A;  4CT0 A;  4I2Z A;  5HKP A;  2XTY A;  2AXU A;  2CHW A;  3G2V A;  2PQN A;  4OAU C;  2ODL A;  1IHB A;  2DBA A;  2BF0 X;  4MRU A;  3E30 A;  4J6I A;  5M72 A;  1TNY A;  3NB2 A;  5JJ7 A;  1WY6 A;  2HM8 A;  1X81 A;  3MKQ A;  3V79 K;  3AG4 E;  3NZU A;  2L9B A;  3TWR A;  3L54 A;  3FTV A;  3ZKJ A;  1ZU2 A;  3CVP A;  3SNX A;  2O6W A;  3FH8 A;  3LVQ E;  5H7P A;  5AQA A;  5A6C A;  3SGH A;  1YA0 A;  4JB8 P;  4CZ2 D;  4FJZ A;  2ZGD A;  4C0E A;  5BXU A;  3FH7 A;  1YMP A;  3RIQ A;  2R03 A;  4B94 A;  2Y4T A;  4OZY A;  3MV3 B;  4JHK A;  3MZL B;  1QCX A;  3ASN E;  4YVO A;  2IY0 C;  3HXF A;  5HI7 A;  4HOS A;  1A5E A;  2DYR E;  4WNE A;  5FQ7 A;  1KZO A;  1KLX A;  2ION A;  1BN8 A;  3FWV A;  1OGM X;  5CEC B;  2DZN A;  4B8A A;  5A7D B;  2X6K A;  4EBA A;  2NC9 A;  4Q94 A;  1AIR A;  3AU5 A;  4X8Q A;  4YZA A;  4OAV B;  1L5J A;  2J49 A;  2QYJ A;  2J8I A;  1D8D A;  2XHE A;  1OCC E;  4XNF A;  3MA5 A;  3FTS A;  4DX7 D;  4D10 C;  4PS7 A;  2IFU A;  3CVV A;  2VGE A;  2PEC A;  4UUC A;  3RO3 A;  4OJO A;  4F1S A;  5ANR A;  4XKC A;  5BT1 A;  2J8S D;  4Z05 A;  3AG3 E;  3GZ1 A;  3UIN C;  4B0Z A;  3S7B A;  4OJL A;  2FF4 A;  4OVU A;  4GAA A;  1MHQ A;  4JC8 A;  3ZPP A;  3CKB A;  2LAH A;  2P9N G;  4EQF A;  2BKK B;  1FPP A;  4GCO A;  3PZD A;  4DRX E;  3Q7A A;  3JUE A;  3ZGQ A;  5CMY A;  3APD A;  4BEP A;  1EDU A;  1N0Q A;  2VBM A;  2Y0B G;  3GZ2 A;  3GQ9 A;  4RG6 A;  4YFO A;  3OXF A;  5FTP A;  3Q15 A;  3LXU X;  2WXH A;  1MYO A;  3DPD A;  3BEE A;  1N94 A;  4GZD A;  5B1B E;  4N2Q A;  1MX4 A;  2F3L A;  3MGB A;  4HWV A;  2OND A;  2GGF A;  1DCE A;  3HRA A;  2EIM E;  2FUL A;  3MCX A;  1E96 B;  3B4N A;  4C9B B;  3VMV A;  4I6J A;  3DWL G;  2BM5 A;  5DIZ A;  4WNG A;  3T9K A;  3LY9 A;  3EU5 A;  4LNG A;  4ACL A;  3NOC D;  3ZSC A;  2CG3 A;  2ETC A;  2IOL A;  3T8K A;  3PS6 A;  2OVF A;  3CHS A;  2Y69 E;  3AG1 E;  4L2Y A;  3DSX A;  1HF8 A;  3JCK C;  3I4G A;  4GA1 A;  3E33 A;  3VLF A;  1MQS A;  3D9H A;  3E37 A;  4Y6W A;  3PE4 A;  2JLB A;  2LUH A;  2BED A;  4WWO A;  4XI0 A;  3HG0 D;  3T8M A;  1HG8 A;  4XLA A;  3RAU A;  5LFA A;  5JLV C;  5BPP A;  3IV0 A;  3GQ8 A;  4RSY A;  1SA4 A;  4YDE A;  3Q78 A;  5ENT D;  1N9A A;  1NFI E;  4XKW A;  1W3B A;  4IN3 B;  1RU4 A;  3B7U X;  2LSU A;  5BUZ A;  4JHR A;  2BTD A;  5CBN A;  5T3R A;  4F53 A;  2FEZ A;  3J5P A;  3HXD A;  2KCK A;  2I6H A;  3QB2 A;  3BG1 B;  2WXQ A;  4A55 A;  3URZ A;  3RSE G;  3LDZ A;  3MX3 A;  2HR2 A;  2DIW A;  3RRU A;  3RO2 A;  1EZG A;  1TNU A;  4ILI A;  3KSL A;  4ANW A;  1DBG A;  1TJF A;  5LX8 A;  4JZY A;  2C0M A;  5LP0 A;  1PE9 A;  1E7U A;  1INZ A;  4NIK A;  3ASO E;  3ULQ A;  1TYU A;  4U4B A;  4GB9 A;  3PNT B;  4U8Y D;  2A4Z A;  4BX9 A;  3QWP A;  4EZL A;  1PY1 A;  3ULY A;  4DLQ A;  1QA1 A;  4G24 A;  5ENN A;  1NL4 A;  3LMW A;  3WXX A;  4LG6 A;  4I43 A;  4GTO A;  4LSZ E;  4U04 A;  4GTM A;  1MX2 A;  3MJW A;  5ENS D;  3UM3 A;  4HRL A;  3EHN A;  4XZ4 A;  5EX0 A;  4XX5 A;  2R17 C;  3B7R L;  3PZ1 A;  5DNS A;  1OCZ E;  1FCH A;  2PZI A;  1PAQ A;  4LNB A;  2J8K A;  3UTM A;  2BM6 A;  1JCR A;  3G2W A;  5EDS A;  3TG5 A;  2E2E A;  3L22 A;  1RW2 A;  4LCT A;  3MV2 B;  3RJV A;  1X0C A;  4KVO A;  3JQ0 A;  2DZO A;  3ZW3 A;  4YC5 A;  4O1O A;  2UVF A;  2XTW A;  3FTU A;  3CLJ A;  1U3C A;  4LNU D;  2C0L A;  5CHE E;  2YNQ A;  2CG2 A;  4V02 C;  4EZJ A;  2ETB A;  2QFC A;  4PS3 A;  2E0I A;  1TN7 A;  4HOQ A;  3B7S A;  5EYP F;  1S64 A;  3O4Z A;  3UXG A;  3TXN A;  1YCS B;  2OOE A;  2PQR A;  3JXI A;  2XTX A;  3SO8 A;  3QDN A;  3SFZ A;  4AJW A;  4LEU A;  2VSN A;  4EW9 A;  4J8D A;  1KQ5 A;  3VMW A;  3VTY A;  4HOR A;  4O1P A;  3V31 A;  3EJN A;  3U3W A;  3D9K A;  3VTX A;  2XC1 A;  1AP7 A;  4DI3 A;  2B0O E;  3RIB A;  4OPW A;  4O6F A;  1H6P A;  4FU3 A;  4AM9 A;  1BU9 A;  3ONK A;  3LKU A;  4UWL A;  2VTB A;  2WXG A;  4U96 D;  3TAX A;  4C48 B;  3KEA A;  3RU0 A;  4L1B A;  5T8I A;  3SYJ A;  1OFL A;  2EIL E;  1SZA A;  4TUM A;  1DAB A;  2WXF A;  1RZ4 A;  2R2L A;  3EHQ A;  3JYS A;  3BH6 B;  3L82 A;  3CVQ A;  1EF1 C;  5HS0 A;  5BV1 A;  4AV7 A;  3D9P A;  1UG3 A;  1NA3 A;  3DSV A;  4MKT A;  1LM1 A;  4ME2 A;  3L9T A;  2QC9 A;  3B95 A;  1ELK A;  3NF1 A;  4IUL A;  1K8K G;  4YZ0 A;  2R05 A;  4JD2 G;  4UWF A;  4M3O A;  3PDN A;  3CVU A;  3ASH A;  5CCM A;  2IF4 A;  4HNA D;  4H7Y A;  3UQ3 A;  2PNN A;  3LJ3 A;  2MYO A;  3D9I A;  2P58 C;  2VGX B;  2XQ0 A;  3AG2 E;  1Y6I A;  2XZT G;  2R02 A;  1FT1 A;  4GMJ A;  3TWU A;  2QXZ A;  3FHE A;  1HF2 A;  2XPI A;  5ANL A;  4HLL A;  4I84 A;  3UT4 A;  4FLB A;  1H19 A;  4HBD A;  1JRG A;  3AJI A;  2BM4 A;  2IEJ A;  2LXM A;  4WWN A;  2P9S G;  1QQE A;  3ZYQ A;  1V55 E;  4BTA A;  4DLO A;  5KJM A;  4Q96 A;  4XLC A;  1BI8 B;  3GQA A;  4W9R A;  4CCA A;  1KCD A;  1NHC A;  2VJJ A;  3CST A;  3ESK A;  3QNK A;  3VSU A;  3V2O A;  3Q75 A;  4BX8 A;  4M7C A;  1O8I A;  3PH0 C;  5ENQ D;  3ISM C;  4EBA G;  2P9P G;  3ULE G;  3GYZ A;  3S2A A;  5KWD A;  1X5B A;  3C3R A;  1IQU A;  3K9I A;  2PYH A;  2WQ7 A;  2MHK A;  5AJD A;  4OJ5 A;  3CVL A;  2P9K G;  2PL2 A;  4WND A;  4NQ0 A;  1IYG A;  5BW8 C;  2V8S E;  1TN8 A;  1WM5 A;  4GZC A;  4O60 A;  1QZ2 A;  1XG2 A;  5B1A E;  4Q69 A;  3QWV A;  4N3C A;  2XCC A;  4W8R A;  2J09 A;  2V0P A;  4RVB A;  4TXR A;  4W8S A;  2NTQ A;  4HRM B;  3V2X A;  3Q47 B;  2IJG X;  1O8E A;  3LYC A;  4B93 B;  4UQZ A;  4GA2 A;  1SZ9 A;  3RK6 A;  3SD5 A;  1S63 A;  4EEC A;  1Z3Y A;  4XN3 A;  1UW4 B;  1IDK A;  3FTW A;  4I9E A;  2IOU G;  3E34 A;  2OEV A;  1N95 A;  4JW1 A;  4CGW A;  4KXK B;  5KCM A;  3IEG A;  2I1K A;  3IXE A;  2Y3A A;  2BKG A;  5AJL A;  3UIP C;  2QY1 A;  3FUN A;  1JTA A;  1E8W A;  3FTY A;  2H6I A;  4E85 A;  4BWR A;  2I2O A;  4TV3 A;  2XRZ A;  4U0U A;  1H2T C;  2FO7 A;  1O5M A;  5EX3 A;  1TNZ A;  3UM1 A;  1L1I A;  4GML A;  4G8K A;  3BH7 B;  3UM2 A;  4GYO A;  3SFX A;  5HQ8 A;  5AAR A;  3TH0 A;  1O8M A;  3C98 A;  1LTX A;  5FQ6 A;  3ZXS A;  4EZK A;  4BY6 A;  4F7A A;  3NAW A;  3UKR G;  1MZC A;  1AWC B;  4TXP A;  4XIF A;  3UT7 A;  2VFM A;  3Q49 B;  5C1E A;  2A5E A;  2J9Q A;  3ENE A;  3ONL A;  3D9J A;  2VSY A;  4ANU A;  2X38 A;  3FU6 A;  1ELR A;  3O48 A;  2PYG A;  3DPY A;  3D9O A;  1GQ8 A;  1O1T A;  5A23 A;  3DRA A;  1KT0 A;  2JAB A;  3KSQ A;  5CBO A;  1HE8 A;  2GRR B;  2WQH A;  4YDW A;  3UM0 A;  2VFN A;  3AU4 A;  1OUV A;  3AS5 A;  2VGX A;  5AEN A;  5JMC B;  3D9N A;  3FU0 A;  5AQ7 A;  4BFR A;  2LXL A;  3AAA C;  4OYS A;  4PDX A;  3DSU A;  3I4R B;  3UMV A;  4URK A;  5E76 A;  4BTB A;  4NAC A;  2KAT A;  2EWE A;  1XGW A;  3DBS A;  3L16 A;  3IBE A;  1QJV A;  1KZP A;  2VBK A;  3Q73 A;  4A3T A;  4AXH A;  3HYM B;  1UN8 A;  4GA0 A;  3EIQ C;  4AIF A;  2AW6 A;  1BI7 B;  3CIA A;  3HVE A;  2WB2 A;  3ASD A;  2EIN E;  4EHM A;  4YEJ A;  2KZT A;  2WXK A;  3HXE A;  5KNG A;  3MKR A;  2L0I A;  3APF A;  3PRZ A;  3C72 A;  2XZD G;  3CHP A;  3CHO A;  4JL0 A;  3ZUV B;  3LEW A;  4J8Y A;  2KM4 A;  3H09 A;  4I1O B;  4NK6 A;  1ZB1 A;  3DEO A;  2EIK E;  2FI7 A;  3BU8 A;  1EE6 A;  2IU1 A;  4B8C B;  3ASG A;  4AVZ A;  5G04 C;  3QKY A;  3ZFW A;  1P5Q A;  1O1S A;  3D9L A;  2MRI A;  2X6I A;  1O88 A;  2RD0 A;  3HXB A;  2MOW A;  2ZIR A;  1H6K A;  4GZ3 A;  3S7F A;  2YHE A;  2H6F A;  2ILR A;  1TYQ G;  3HVE B;  1DCQ A;  4B89 A;  4UQX A;  4MXN A;  5G2N A;  2OCC E;  3TWX A;  3LVR E;  2A5U A;  2AJA A;  4A63 B;  2LO6 A;  4OJ6 A;  4DX5 D;  3DXK G;  3KRG A;  2XGM A;  5FIN A;  3N90 A;  5FT9 A;  1N52 A;  4HOU A;  1HO8 A;  4TRQ A;  4ILG A;  2CHZ A;  2VFQ A;  5G05 C;  3TXM A;  2Q7F A;  3LS8 A;  4FHJ A;  4J7W A;  4GTQ A;  4G1T A;  1WMR A;  2OV8 A;  1LD7 A;  5CRV A;  3NZS A;  2XRY A;  1ELW A;  5EKQ D;  5AMV A;  3QAQ A;  3NBN B;  5CER B;  5G05 J;  1MJ0 A;  1K1B A;  3PZ2 A;  4GZ6 A;  4KBQ A;  4HVB A;  3IKO B;  4AY5 A;  3GRH A;  3FUK A;  2WXM A;  3D9M A;  2EQX A;  3CVN A;  4AOF A;  2NT9 A;  3JUR A;  4DUI A;  2CFU A;  3UX4 A;  4E6H A;  4G23 A;  4G8L A;  1HXI A;  2C2L A;  3CK7 A;  3EQN A;  4YEL A;  4F3V A;  3B8Y A;  5AQB A;  4HS2 A;  3RRM B;  5AQ9 A;  4XOT A;  4LRZ A;  1HG5 A;  2O1D A;  4QQI A;  1SVX A;  3Q79 A;  2BSP A;  3FUD A;  3ZPJ A;  4CDR A;  2WVI A;  1HG2 A;  3FTZ A;  3PUK A;  1VDY A;  1H6O A;  3HXC A;  3C3Q A;  1JWF A;  1XNF A;  3KS2 A;  1O1R A;  4Z68 A;  4AP2 A;  2R5S A;  4HI8 A;  4G2V A;  5LOZ A;  2WMN A;  3VLD A;  4RLY A;  3UT8 A;  3FY3 A;  1N4S A;  3ASF A;  5JA4 D;  3QWW A;  3U66 A;  4LER A;  2P2C P;  3J5Q B;  1OWL A;  5FWQ A;  3LPZ A;  1OT8 A;  2CHX A;  2ZGG A;  2X6X A;  1PC2 A;  3SY2 A;  4IRU A;  4UWK A;  3JUI A;  5D2M C;  4I17 A;  2ZU6 B;  3CVY A;  2JEK A;  3WWG A;  1HFA A;  3ZXP A;  1O8J A;  3W9G A;  1TJC A;  2X6J A;  5BV0 A;  2HE0 A;  1B89 A;  4FP7 A;  2X85 A;  4JVS A;  3FUH A;  2ETA A;  4J8S A;  4JHJ A;  1WDY A;  3SI5 A;  4ANV A;  2XT2 A;  3PZ3 A;  2XEN A;  3HIZ A;  2X6F A;  4C2L A;  4OVV A;  5D66 A;  1TSP A;  3TG4 A;  2VQ2 A;  2X3H A;  3LY7 A;  4W8Q A;  2BX6 A;  4PS8 A;  2WMO A;  1HU3 A;  2XGO A;  4KYO B;  4PH4 B;  1OWN A;  2XS8 A;  3CK9 A;  5EID A;  3TGO A;  1O8F A;  2NSP A;  4KZC A;  1TEZ A;  1FVF A;  2VFO A;  3PEU B;  1YYH A;  2VSO E;  5FJY A;  2GRP B;  4L23 A;  1Z6T A;  2O17 A;  4CT4 A;  4AY6 A;  4NRH B;  5C1C A;  4UWG A;  3IHV A;  4KMO A;  3LY8 A;  4GTT A;  3CQG B;  4FAD A;  5HRY A;  4KH3 A;  3CR3 A;  2XPY A;  5G04 J;  4A1S A;  3ZYK A;  2WXL A;  3FUE A;  2INU A;  3E32 A;  3G2T A;  1WXR A;  1TYW A;  1QRC A;  5ENO D;  3LJN A;  2V4L A;  4GPM A;  1H2U A;  2VYI A;  5D0Q D;  2H6G A;  3UIO C;  4N2S A;  3Q9U C;  4DI4 A;  1NZN A;  3EU9 A;  5FZS A;  4DK5 A;  1Q2Z A;  3RKV A;  3HHM A;  5J90 A;  2GW1 A;  3ZEF A;  2RFM A;  2BM7 A;  3EDT B;  3PET A;  3BQO A;  3AS4 A;  2WPV A;  4L2L A;  4JEU A;  4XLH A;  1QA3 A;  4UI9 J;  4WAF A;  1WG0 A;  3EQO A;  4Z03 A;  4BET A;  3TL5 A;  1IHG A;  4N3A A;  2IQ7 A;  3QAR A;  4K0R A;  2Y4U A;  1BHE A;  4HFG A;  3FY4 A;  4OJP A;  1NI1 A;  1E8Y A;  4PMH A; 
#chains in the Genus database with same CATH homology
 2XT2 A;  4YEI A;  5DNS A;  2QZA A;  4YC5 A;  2O6W A;  2XTY A;  4YDT A;  3DU1 X;  3PSS A;  2J8K A;  2XTW A;  3SQV A;  2XTX A;  3SY2 A;  4YFO A;  4YCQ A;  3NB2 A;  2XT4 A;  3PSZ A;  3NAW A;  2QYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...