3SQVA

Crystal structure of e. coli o157:h7 e3 ubiquitin ligase, nlel, with a human e2, ubch7
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
612
structure length
606
Chain Sequence
QGRACLSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGCTAVLTDMLTEHAKESFPEIFSLYYPVAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords secreted effector protein
publication title Crystal structures of two bacterial HECT-like E3 ligases in complex with a human E2 reveal atomic details of pathogen-host interactions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase/signaling protein
total genus 166
structure length 606
sequence length 612
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13979 SopA_C SopA-like catalytic domain
A PF13981 SopA SopA-like central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4140.10 Mainly Alpha Orthogonal Bundle effector protein (NleL) fold effector protein (NleL) 3sqvA04
1.25.40.300 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Putative secreted effector protein 3sqvA02
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3sqvA01
3.40.1850.10 Alpha Beta 3-Layer(aba) Sandwich HECT-like ubiquitin ligase fold HECT-like ubiquitin ligase 3sqvA03
2XT4A 4YDTA 2J8KA 4YCQA 5DNSA 2XTYA 2O6WA 2QZAA 3SY2A 3DU1X 3PSZA 4YC5A 3SQVA 4YFOA 2QYUA 3PSSA 3NAWA 3NB2A 4YEIA 2XT2A 2XTXA 2XTWA
chains in the Genus database with same CATH superfamily
2X3HA 3TG4A 3VMWA 3EHQA 1JWGA 2WXFA 4ZFHA 2NT9A 1O1TA 3F6QA 4EPZA 4YDEA 2DBAA 5FZQA 3QAQA 2WXQA 3CSTA 3MYVA 4XN3A 3V79K 2XEVA 4JHJA 1UG3A 1E7VA 1TYQG 1AP7A 4OZZA 3UT7A 4OJ6A 1IDJA 4JA9A 4U07A 3HXFA 2CHXA 1X81A 2OVFA 4KMOA 3ZRHA 3L22A 2KZTB 4DK5A 2P9IG 4OJLA 3LVRE 3RU0A 1Y6IA 4U0SA 4TUMA 3L13A 4L9PA 3NF1A 3B8YA 3FEYA 3UM2A 4GTMA 4BWRA 2QZAA 3L9TA 1BD8A 5E76A 3PNTB 2OVBA 3DXKG 1TYUA 2PECA 5HI7A 4I43A 3ASNE 3IHVA 1O8JA 2DIWA 4U49A 2HM8A 4K5CA 3R9AB 1ZBPA 3WWGA 3KEZA 1FT1A 1N4RA 5EKQD 4XLFA 2VSXE 2JLBA 2WB2A 1HFAA 2O17A 2BF0X 4YEJA 1MJ0A 2G0YA 2WMOA 3TWRA 1OT8A 1WG0A 5BNWA 2XT4A 2I2OA 3AJIA 3LCAA 2NTQA 3RIQA 2LNIA 4N39A 1O8IA 3L82A 1V55E 1QQEA 2V0PA 5BT1A 1V54E 4XIFA 3CVXA 5EN5D 2CFZA 4LEUA 4LNUD 4E6HA 1QA3A 1IXVA 2WMNA 2ZIRA 3U66A 2CG2A 5FTPA 4YELA 4I2ZA 1U2VG 3P1UA 2XEHA 1HE8A 5EILA 3SBSA 2XCCA 3FY3A 1NI1A 3EQOA 2V5QC 4URRA 3Q9NC 4GMLA 5C1EA 5CECB 4UWFA 2WXHA 3CEQA 3FTXA 1SA5A 1BPOA 1OWPA 2VYIA 1B89A 1PLUA 1HZ4A 1WY6A 3ZNGA 1JPLA 1AIRA 2X6KA 1OWNA 2BSPA 5LFAA 1IQRA 3BH7B 2P9NG 5A6CA 3TXNA 3FH5A 2VSYA 3ASDA 4XORA 3DEOA 1ELRA 4BERA 2H6IA 4OVVA 4GTQA 2NYJA 4NIKA 2XTYA 4JL0A 2VGXA 3NOCD 4CT4A 4GZ3A 1O5MA 4N2SA 2INVA 1GQ8A 3FUNA 5BV0A 3CKCA 3AG2E 2NSTA 2IF4A 4Y6CA 4GTVA 4UWKA 4FU3A 2IOLA 2VJJA 2WXJA 3T8KA 4I6GA 3KRGA 3HYMB 4FC8A 4DX5D 1H2UA 1HG5A 4D10C 3HHMA 4W9RA 4IN3B 3T9KA 3RO3A 2BM6A 2PQNA 3MA5A 3CK7A 4CZ2D 4F1SA 2CHWA 3C5RA 4O60A 1TN8A 2O0VA 3MKRA 5G05C 3QARA 3JYSA 1RU4A 4JB8P 1K3ZD 4JW1A 3W9FA 4L23A 4ME2A 3I3NA 3Q73A 4L2YA 4PDXA 3X2QE 3QB2A 1LD8A 2IO2C 1HS6A 1O8LA 2R2LA 2WXRA 4XI9A 4K5BA 3ZYMA 4ACKA 2WVIA 1JUQA 2J07A 3N71A 3BEEA 3TGOA 3APDA 5FT9A 4M3OA 4YDYA 1E8XA 3OXFA 4WNEA 3FU5A 4YDTA 3PZ1A 2R02A 1YA0A 3ZFWA 3T9GA 4YZQA 5C2YA 4EZLA 4GPKA 5CCLA 3FU6A 2BM7A 3I5PA 5G04J 5LOZA 5FINA 2LAHA 4WWPA 4WWNA 4EZKA 5ARGA 1O8KA 2AW6A 2VQ2A 4FHJA 4Q69A 3EQNA 4OAVB 4GTSA 1OGMX 3B13A 1X5BA 1OFDA 1QZ2A 4CDMA 3ZPJA 4TV3A 5ARFA 4JC8A 4O1PA 5AQ9A 3E33A 4NQ0A 4RG6A 4BX8A 4GB9A 2EIME 2VTBA 2VBMA 5A7DB 5JHBA 3LJNA 3QNKA 2WQ6A 3DPDA 3CHRA 3MX3A 3OXLA 4B89A 1U3DA 2V4LA 4BY6A 3LS8A 1OFMA 3TG5A 3AU4A 3ZEFA 4GTPA 1QA1A 4BT8A 4EQFA 2WXPA 1HF8A 3FTVA 2XPZA 4X8QA 2JABA 3FDHA 2L6BA 1OCZE 4XEIG 2R59A 2XS1A 2XZTG 1PXZA 2IEJA 3GZSA 2XTWA 4TXQA 3UMVA 3DBSA 4NK6A 4YZ0A 5JJ6A 2IU1A 5G55A 3R7RA 4BX9A 4U8YD 4A3VA 2P9UG 4WNGA 2MYOA 4CGWA 4MS6A 4LSZE 4WNDA 1NZNA 2BUGA 4F7AA 4DX7D 3ABME 2IOSA 2BM4A 4U4BA 2GRQB 4Q94A 5HQ8A 3PE4A 1H80A 1U3CA 4NACA 2YHCA 5CHEE 1WAO1 3RAUA 2OV8A 4XI0A 1O8DA 4APOA 1H19A 2F3LA 1TR4A 3O48A 1EF1C 3QKYA 4FULA 3LVQE 2J9QA 1Z3XA 4DX1A 4HLLA 4B8AA 1S63A 3CHOA 1TN6A 1H6PA 3QWVA 3LY7A 2FEZA 3AG3E 2QXZA 2LAIA 2WM9A 4YEIA 1L1IA 4ANVA 4ANXA 3FUFA 3ZSCA 4G23A 4J0UA 2J8KA 1DBOA 3C3OA 1IQUA 4I9CA 4I84A 1E90A 4J8YA 3PEUB 3DPYA 1BLXB 1HU3A 4Z05A 2L9BA 1WDYA 3SQVA 1K1BA 1IB4A 3EDTB 3VTYA 1GW6A 3HVEB 5EYPF 2GRLA 3V30A 1IA5A 3E32A 4J6IA 4GA1A 2NSPA 5JLVC 4L1BA 5EIDA 4OJPA 1NFIE 2VSOE 5C1DA 1AWCB 4CT0A 5AYWD 3C3RA 1TNZA 2XS8A 3ZYQA 4ACLA 3SNXA 5FQ7A 4GYOA 4XONA 2EQXA 3ZN3A 4B8CB 2FI7A 1DNPA 3NZSA 1TSPA 2PYHA 4HFGA 4EBAG 3MV2B 2ZGDA 5KCMA 3D3MA 4YNDA 2ODLA 2LXMA 2R5SA 4UQYA 1TJFA 2VGYA 4BFRA 2VSNA 3NOGD 4I2WA 3D9NA 5T8IA 5FZSA 3CV0A 3NB2A 1BN8A 3U64A 2NZMA 3RJVA 3SI5A 3B4NA 5C1CA 2B0OE 1SW6A 3GQAA 4W8QA 4XR6A 5FQ8A 3FEXA 4ANWA 4CDNA 3EHMA 1Q2ZA 3FUHA 2BX6A 3PSZA 4HOSA 3URZA 3RKVA 4OYSA 2QYJA 4KXKB 5CRUA 3ONKA 3H09A 4UI9J 4DX2A 4Z06A 5FWQA 4LRZA 3ONLA 1TNBA 2A4ZA 2ETAA 2GRPB 4GZDA 4Y6WA 3TWTA 3MJWA 2GW1A 4FJYA 2FF4A 3FTYA 4JZYA 1S70B 5ENSD 2HR2A 1XNFA 3ZU7B 4HOUA 4KYOB 4DI3A 3HXDA 5CCMA 2IQCA 2XGSA 3NZUA 5D0OD 3UQ3A 2Q7FA 3EIQC 3IHYA 2X6IA 4U63A 5KJMA 1BHEA 3UX4A 1O8HA 1N4QA 4L2LA 3UW0A 4IRUA 3JXIA 3SGHA 5CMYA 3VLFA 3J5PA 2XENA 3MZLB 2J09A 3BQOA 4KBQA 1N11A 3HXCA 2P9SG 1MYOA 5A23A 1UW4B 1N0RA 2A5UA 2P58C 3UTMA 3T5VA 3D9LA 3ASFA 4N3BA 3CK8A 4UI9K 2LO6A 3FU3A 1KPSB 2VGEA 5AQ7A 2EINE 4YCQA 3TWSA 2P9KG 4AIFA 1FT2A 2UY1A 5AN8A 4BT9A 5KJNA 3CKBA 4AOFA 4U04A 3HXBA 5J08A 2ZISA 2EWEA 2Y1LE 2LXLA 1RW2A 4DI4A 3ASOE 3UT4A 2XRZA 1LTXA 2X38A 3DSWA 3ZHEA 3P4GA 2QY7A 4C48B 1EZGA 2V5IA 4R7LA 4MBGA 4LNBA 4U96D 3AS5A 3UIPC 3UM0A 4H7XA 3D9KA 4HQDA 2F8YA 1RMGA 4EBAA 3FHEA 4W8RA 3LDZA 4YDWA 3FUEA 3CLJA 2LSVA 3ABKE 1KCCA 4XLAA 3TAXA 3LY8A 3E37A 4RG9A 2I9CA 2HO1A 4UWLA 2WXMA 3L16A 1PY1A 3BG0B 3V31A 4W8SA 4J8EA 3D9IA 3B95A 3MV3B 2IONA 5ENPD 2KXPC 2Y4UA 4DJAA 3CK9A 3AS4A 1WXRA 2UY1B 1QRCA 2IJGX 5ENTD 3FTSA 1H0AA 2EILE 5EX3A 4DLOA 4PMHA 2XPYA 3G2UA 3RRUA 3L08A 4TXRA 3SZEA 4XOTA 1NHCA 2JEKA 3MCXA 2X3MA 2GRNB 4CYMD 3CIAA 3DXMG 4ABNA 4HORA 3JUEA 3PZ4A 5D66A 3ZHEB 4ILIA 2HE0A 3ML8A 3PH0C 3PREA 4ILGA 3Q9UC 1O8GA 2BTDA 3G2TA 4UUCA 1NA0A 4RVBA 1NA3A 4FP7A 1LLZA 3UPVA 4KVOA 3JXJA 4ATGA 4I1MA 3AG1E 5AIJA 3PUJA 2J49A 3ZXPA 1HF2A 2C2LA 4I1OB 4B94A 3TXMA 5BXUA 1E96B 1TNOA 4TUUA 1N9AA 2X6YA 4G8LA 3ESKA 4LUNU 2RKKA 2DZNA 4Z68A 4YDOA 3SBTB 1SVXA 4GCNA 2I1JA 3JQ0A 3CVYA 1MZCA 2AXUA 3ZKJA 5EYLA 4GPMA 1TYXA 3FWVA 2X6JA 4U0UA 1JCSA 1S0PA 2FO1E 2XCBA 4QQIA 1H2VC 1QRBA 3VSVA 1L5JA 3GQ8A 2VFMA 3ULEG 4IYPA 2XEEA 3BG1B 4FJZA 4OJ5A 1K5CA 4ZHBA 3ZVVA 5DNSA 3AS8A 5ENOD 2VGXB 4I6JA 2IFUA 5B1AE 1CLWA 2B0RA 4GZ5A 3GZ2A 2NXPA 1N0QA 3LPZA 5FQ4A 3B7SA 2BM5A 3FTZA 4ILHB 1INZA 4XNFA 4OJOA 3ZYKA 3UUXA 4ANUA 1K4ZA 2X6FA 4HLEA 1H6OA 4V3IA 4WAFA 5FZRA 3C98A 3EUVA 3PNLB 3PS6A 4RLYA 1K8FA 3ZYLA 4A1SA 4J8SA 4XLCA 1H2TC 2ZXWE 3FH8A 3O4ZA 2PZIA 4JVSA 2GROB 4TRQA 4OVUA 3L54A 2FULA 2FO7A 4XOPA 4RSYA 2WPVA 1X0CA 4J7WA 2VBKA 3W9GA 1MQSA 1S64A 5LCWJ 3DU1X 3B7TA 3GQ9A 4LNGA 3U3WA 3CVNA 4XKBA 3NAWA 1ELWA 3FP3A 4C2LA 4UQXA 3S7FA 2E2EA 2XPIA 5AENA 2BKKB 3GYZA 3B7RL 2DCPA 1IHBA 4YVOA 3SFXA 1RWRA 1TJCA 2YHEA 4PUCA 4JXTA 2AXZA 1O1SA 4DPRA 2EIJE 3UIOC 5AQBA 4EW9A 1WM5A 2P9PG 5BPPA 3TJPA 3K9IA 5JJ7A 2NC9A 5KBAA 3FTWA 4NK8A 5G2NA 1FVFA 4GTRA 2QX3A 4AY6A 2Z8GA 3KAEA 4N2QA 3PETA 5B1BE 3RO2A 4U0ZA 3U9WA 3EU5A 3JCKC 4O1OA 3UXGA 2H6GA 5ENRD 4YZAA 3CVLA 4I6EA 4K0RA 3V2XA 4B0ZA 1EA0A 4QFVA 4XE0A 2ILRA 3FUDA 4KVMA 3L17A 2YQ8A 3UINC 1VBLA 4GZCA 5HS0A 2VTBB 1LF8A 2C0MA 3S7BA 4AM9A 4FLHA 5KWDA 3LJ3A 2PL2A 2ZU6B 4XKWA 1OFLA 1JCRA 1OWOA 5EDSA 2ZGGA 3B7BA 4WNFA 4F3VA 3IV0A 4F53A 2KBXA 3Q75A 4FLBA 4PH4B 1LD7A 3DSTA 3D9JA 2XQ0A 1E8YA 3TWXA 4MKTA 1HG8A 3RRNB 2E0IA 2OCCE 2PM7A 3FH7A 4XX5A 2DWZA 4AXHA 3CHPA 3QC1A 2XZDG 5EX0A 3PE3A 1OCOE 5G04C 4IULA 4AP2A 5FJYA 4FHKA 3GRHA 3PRZA 4GAAA 4HOQA 4XMYA 5ENNA 2I1KA 4OPWA 2CFUA 5LP0A 3HDXA 4JEUA 1MX4A 5BXOA 1YCSB 4AVXA 2XTXA 3FUKA 5DBKA 2Y4TA 3T5XA 2BKGA 4UQZA 3CHSA 4H7YA 2IY0C 5KNHD 1ZB1A 2P2CP 3ISMC 1N52A 3CVUA 3TWWA 2WXKA 1G3NB 3RK6A 5JJTA 2VBEA 3FTUA 3KSLA 3FUIA 3VLEA 3ZW3A 1ELKA 1CZFA 3APCA 4UWGA 3GW4A 4GYYA 2VFOA 4GZ6A 4KT6B 1OCCE 2I6HA 2AVPA 3TH0A 1BU9A 2RFAA 3PSSA 3G2WA 4J8DA 5CMWA 1KCDA 4KZ0A 4N3AA 5E75A 1PC2A 5M72A 1QCXA 1TNUA 4HB5A 3ZXSA 5CEAA 2KC7A 1YMPA 2M63A 5ENQD 2DYSE 3AU5A 1RZ4A 1QQ1A 5DIZA 3GQ7A 3WXXA 3GZ1A 4YC5A 4XLEA 3CQCB 1OFEA 4UWHA 1TN7A 2X6XA 2ETCA 1OY3D 4E85A 1PAQA 4HRMB 1HO8A 2CG3A 2VJ8A 2RFMA 5ANLA 1DCEA 3JURA 3CQGB 1WMRA 4PS8A 4B93B 3LEWA 5JA4D 4KH3A 3VMVA 5AMVA 3QWWA 3AG4E 1SZ9A 1KZOA 3OTNA 4GMRA 1KLXA 1MHQA 3G2VA 3CVVA 3Q5MA 3AAAC 4K03A 4HWVA 2R03A 3KSQA 5BV1A 3ML3A 1MX6A 4DLQA 2R05A 3LJYA 1D8DA 1K1AA 3SF4A 2R17C 4HVBA 2B6CA 3ZUVB 5CBOA 1JCQA 2EIKE 3UM3A 1EYHA 1SQMA 4LG6A 3JUIA 5AJDA 3RRMB 2KCVA 4U7EB 3VSUA 4Q96A 4GA0A 3PVLA 5AARA 2DVWA 1KTWA 3UM1A 1KQ5A 1QA2A 3C3QA 3CSFA 3ZIMA 4CGVA 2WXLA 1DC2A 3CR3A 4G2VA 1H6KA 2WXOA 3ZPPA 3C72A 2NTPA 4GU5A 4XN0A 4U8HA 3Q4AB 4PS3A 3BH6B 3MKQA 3DSUA 1W3BA 1JTAA 3LMWA 1FVHA 1P5QA 1E8ZA 4EZJA 2J8SD 2C0LA 5G05J 3DSVA 1EPUA 4G25A 1Z3YA 4F6RD 4MXNA 1XG2A 2PNNA 2WXNA 4A1GA 1HXIA 5JMND 4GA2A 2L0IA 2L6JA 3JQ1A 4M7CA 4CDRA 4YVQC 4G11A 3S2AA 1N4PA 3D9MA 4BESA 3LXUX 1O8FA 2MRIA 3TL5A 3KD7A 3HG0D 1Z6TA 3V2OA 2IO3C 4RQIA 1HX8A 3ULYA 2WQHA 5CRVA 2QFCA 1KT0A 2XRYA 5HRYA 2X6HA 4EECA 1EE6A 1E7UA 3ML9A 2F0YA 5LX8A 4HNAD 4N5CA 3TWQA 2HYZA 3FFLA 3VTXA 5CBNA 4FADA 1HH8A 4DRXE 4XQFA 2XGOA 3PUKA 2ONDA 2PM6A 3D9HA 3PZ3A 2RD0A 4XZ4A 1A5EA 3N6ZA 4MLPA 5ANRA 4AEZC 1N95A 4P29A 5CEDB 4UI9C 4NRHB 5JMCB 1OWMA 3MKQB 5FIOA 3P2BA 4JPSA 3ASHA 4XLHA 2MHKA 1IKND 3CVWA 1IYGA 2YINA 1OUVA 1LLWA 4BEPA 2BEDA 3QJZA 4XM3A 3IBEA 1VDYA 4TXPA 2UWJG 3MGBA 3PZDA 3R7QA 2P9LG 4O6FA 1UOHA 1JWFA 4I1AA 3Q15A 3HRAA 3SO8A 5CERB 1UN8A 5H7PA 4G8KA 4G26A 4HOTA 2XC1A 5D2MC 3ABLE 2VFQA 4C9BB 4GCOA 4Z03A 3OXGA 3S7JA 1OGOX 3FUMA 3EIJA 4ATZD 2OEWA 3I4GA 4I17A 3UI2A 4CEMA 3MEKA 1OCRE 2MOWA 4HRLA 4BSZB 2Y69E 2OOEA 3LYAA 3WG7E 3RIBA 2GRMA 2V4HC 2RG8A 3VLDA 3UT8A 3L6AA 3ENEA 4LERA 4PS7A 3Q47B 2V5FA 3FY4A 5HKPA 3SY2A 1UJJA 5FQ6A 1FCHA 1Y8MA 4XKVA 1QYMA 3E30A 3SFYA 4HRNA 3DSXA 1MX2A 5AAOA 3SZ7A 4A63B 1Z5SC 2O04A 3SYJA 1YYHA 3R9MA 4G1TA 2QY1A 4HXIA 3TWUA 1N94A 4JEHA 2Y3AA 4AVZA 4HBDA 5KJKA 1OXJA 3CHQA 2O6WA 4MRUA 4BSXA 4JA7A 4JHKA 3J5QB 3AK5A 3LYCA 3Q7AA 4BETA 4DUIA 2J4BA 3B90A 2V8SE 1O1RA 4N3CA 3IKOB 4BTBA 4A3TA 1TYVA 1K8KG 5BUZA 3U4TA 3KS2A 3ULQA 2XGMA 4WWOA 1TYWA 2VFPA 3LY9A 2DZOA 2J4DA 3T8MA 3Q49B 5D0QD 4L7TA 2PQRA 2X85A 2L0TB 2A5EA 1D9SA 3FU0A 2LUHA 1DABA 4LCTA 1IHGA 1O8MA 4U8VD 3HXEA 4G24A 4CCAA 4HI9A 4F1PA 1O88A 4JD2G 1UJKA 3DEPA 3SHFA 4V02C 1UN9A 4J8FA 2X6WA 2WXGA 3FUJA 3JX8A 3NQPA 1SA4A 4YZXA 3DWLG 4JHRA 1DBGA 3QK0A 2O0WA 2VJIA 3QOUA 5IY5E 3CVQA 2AJAA 3E34A 2AWIA 5T3RA 3D9OA 2GRRB 1OWLA 5AJLA 4CRWA 4XL9A 1TNYA 2O1DA 4K5AB 4C0MA 3HVEA 2QC9A 2J08A 1ZU2A 2PYGA 3G2SA 1DVPA 3OAWA 5J90A 2UVEA 1NL4A 2Y0BG 3UKUG 2XHEA 2YUHA 5KNGA 3RSEG 4AY5A 1PE9A 1N54A 2QYUA 2WXIA 1JRGA 2GGFA 2KCKA 4N5QA 2WQ7A 4FA6A 4A55A 3ESLA 3IXEA 3S7DA 1D8EA 5ITZF 3DSSA 2H6FA 2FBNA 3IEGA 2YNQA 4I9EA 4GTOA 4HI8A 3VSTA 3CVPA 3EHNA 5AQAA 3EHRA 1OOCA 4KZCA 5B3SE 4OM9A 4YFOA 3BU8A 2DYRE 3SFZA 2H6HA 3BUAA 1E8WA 1HG2A 2NTBA 1QNFA 2ETBA 1DCQA 3CHMA 1QBQA 3APFA 3HIZA 1BI8B 3CGHA 3LKUA 3N90A 4GYWA 4GTTA 2LSUA 2AXVA 4MR0A 2KM4A 3SD5A 1KT1A 2NT6A 3E4BA 4AV7A 5LCWC 1QJVA 3PZ2A 2IQ7A 2UVFA 5T4YA 3ASGA 2F37A 3ZGQA 1IDKA 3Q7FA 4HS2A 1NP7A 3UKRG 5KJLA 2KATA 3D9PA 2W7ZA 3FULA 2IOUG 1KZPA 3QWPA 3B7UX 1BI7B 5EIBE 1FPPA 3DRAA 1N4SA 1O8EA 2NSZA 1TEZA 2INUA 3TWVA 3PDNA 2KCLA 2J8IA 5JHAA 3Q79A 2VFNA 1XGWA 5BW8C 1EDUA 3NBNB 4BTAA 1LM1A 3EJNA 3PEVB 2KZTA 3SUCA 1A17A 2F8XK 3I4RB 4EHMA 3Q78A 4URKA 4JRAC 4OAUC 4C0EA 4XKCA 3KEAA 4AJWA 4GMJA 1SZAA 4NURA 4DX6D 4W8TA 3QDNA 4U95D 2OEVA 3EU9A 2CHZA 4OZYA 4APFA 2XT2A 4WUYA
chains in the Genus database with same CATH topology
2XT4A 4YDTA 2J8KA 4YCQA 5DNSA 2XTYA 2O6WA 2QZAA 3SY2A 3DU1X 3PSZA 4YC5A 3SQVA 4YFOA 2QYUA 3PSSA 3NAWA 3NB2A 4YEIA 2XT2A 2XTXA 2XTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XT4 A;  4YDT A;  2J8K A;  4YCQ A;  5DNS A;  2XTY A;  2O6W A;  2QZA A;  3SY2 A;  3DU1 X;  3PSZ A;  4YC5 A;  3SQV A;  4YFO A;  2QYU A;  3PSS A;  3NAW A;  3NB2 A;  4YEI A;  2XT2 A;  2XTX A;  2XTW A; 
#chains in the Genus database with same CATH topology
 2X3H A;  3TG4 A;  3VMW A;  3EHQ A;  1JWG A;  2WXF A;  4ZFH A;  2NT9 A;  1O1T A;  3F6Q A;  4EPZ A;  4YDE A;  2DBA A;  5FZQ A;  3QAQ A;  2WXQ A;  3CST A;  3MYV A;  4XN3 A;  3V79 K;  2XEV A;  4JHJ A;  1UG3 A;  1E7V A;  1TYQ G;  1AP7 A;  4OZZ A;  3UT7 A;  4OJ6 A;  1IDJ A;  4JA9 A;  4U07 A;  3HXF A;  2CHX A;  1X81 A;  2OVF A;  4KMO A;  3ZRH A;  3L22 A;  2KZT B;  4DK5 A;  2P9I G;  4OJL A;  3LVR E;  3RU0 A;  1Y6I A;  4U0S A;  4TUM A;  3L13 A;  4L9P A;  3NF1 A;  3B8Y A;  3FEY A;  3UM2 A;  4GTM A;  4BWR A;  2QZA A;  3L9T A;  1BD8 A;  5E76 A;  3PNT B;  2OVB A;  3DXK G;  1TYU A;  2PEC A;  5HI7 A;  4I43 A;  3ASN E;  3IHV A;  1O8J A;  2DIW A;  4U49 A;  2HM8 A;  4K5C A;  3R9A B;  1ZBP A;  3WWG A;  3KEZ A;  1FT1 A;  1N4R A;  5EKQ D;  4XLF A;  2VSX E;  2JLB A;  2WB2 A;  1HFA A;  2O17 A;  2BF0 X;  4YEJ A;  1MJ0 A;  2G0Y A;  2WMO A;  3TWR A;  1OT8 A;  1WG0 A;  5BNW A;  2XT4 A;  2I2O A;  3AJI A;  3LCA A;  2NTQ A;  3RIQ A;  2LNI A;  4N39 A;  1O8I A;  3L82 A;  1V55 E;  1QQE A;  2V0P A;  5BT1 A;  1V54 E;  4XIF A;  3CVX A;  5EN5 D;  2CFZ A;  4LEU A;  4LNU D;  4E6H A;  1QA3 A;  1IXV A;  2WMN A;  2ZIR A;  3U66 A;  2CG2 A;  5FTP A;  4YEL A;  4I2Z A;  1U2V G;  3P1U A;  2XEH A;  1HE8 A;  5EIL A;  3SBS A;  2XCC A;  3FY3 A;  1NI1 A;  3EQO A;  2V5Q C;  4URR A;  3Q9N C;  4GML A;  5C1E A;  5CEC B;  4UWF A;  2WXH A;  3CEQ A;  3FTX A;  1SA5 A;  1BPO A;  1OWP A;  2VYI A;  1B89 A;  1PLU A;  1HZ4 A;  1WY6 A;  3ZNG A;  1JPL A;  1AIR A;  2X6K A;  1OWN A;  2BSP A;  5LFA A;  1IQR A;  3BH7 B;  2P9N G;  5A6C A;  3TXN A;  3FH5 A;  2VSY A;  3ASD A;  4XOR A;  3DEO A;  1ELR A;  4BER A;  2H6I A;  4OVV A;  4GTQ A;  2NYJ A;  4NIK A;  2XTY A;  4JL0 A;  2VGX A;  3NOC D;  4CT4 A;  4GZ3 A;  1O5M A;  4N2S A;  2INV A;  1GQ8 A;  3FUN A;  5BV0 A;  3CKC A;  3AG2 E;  2NST A;  2IF4 A;  4Y6C A;  4GTV A;  4UWK A;  4FU3 A;  2IOL A;  2VJJ A;  2WXJ A;  3T8K A;  4I6G A;  3KRG A;  3HYM B;  4FC8 A;  4DX5 D;  1H2U A;  1HG5 A;  4D10 C;  3HHM A;  4W9R A;  4IN3 B;  3T9K A;  3RO3 A;  2BM6 A;  2PQN A;  3MA5 A;  3CK7 A;  4CZ2 D;  4F1S A;  2CHW A;  3C5R A;  4O60 A;  1TN8 A;  2O0V A;  3MKR A;  5G05 C;  3QAR A;  3JYS A;  1RU4 A;  4JB8 P;  1K3Z D;  4JW1 A;  3W9F A;  4L23 A;  4ME2 A;  3I3N A;  3Q73 A;  4L2Y A;  4PDX A;  3X2Q E;  3QB2 A;  1LD8 A;  2IO2 C;  1HS6 A;  1O8L A;  2R2L A;  2WXR A;  4XI9 A;  4K5B A;  3ZYM A;  4ACK A;  2WVI A;  1JUQ A;  2J07 A;  3N71 A;  3BEE A;  3TGO A;  3APD A;  5FT9 A;  4M3O A;  4YDY A;  1E8X A;  3OXF A;  4WNE A;  3FU5 A;  4YDT A;  3PZ1 A;  2R02 A;  1YA0 A;  3ZFW A;  3T9G A;  4YZQ A;  5C2Y A;  4EZL A;  4GPK A;  5CCL A;  3FU6 A;  2BM7 A;  3I5P A;  5G04 J;  5LOZ A;  5FIN A;  2LAH A;  4WWP A;  4WWN A;  4EZK A;  5ARG A;  1O8K A;  2AW6 A;  2VQ2 A;  4FHJ A;  4Q69 A;  3EQN A;  4OAV B;  4GTS A;  1OGM X;  3B13 A;  1X5B A;  1OFD A;  1QZ2 A;  4CDM A;  3ZPJ A;  4TV3 A;  5ARF A;  4JC8 A;  4O1P A;  5AQ9 A;  3E33 A;  4NQ0 A;  4RG6 A;  4BX8 A;  4GB9 A;  2EIM E;  2VTB A;  2VBM A;  5A7D B;  5JHB A;  3LJN A;  3QNK A;  2WQ6 A;  3DPD A;  3CHR A;  3MX3 A;  3OXL A;  4B89 A;  1U3D A;  2V4L A;  4BY6 A;  3LS8 A;  1OFM A;  3TG5 A;  3AU4 A;  3ZEF A;  4GTP A;  1QA1 A;  4BT8 A;  4EQF A;  2WXP A;  1HF8 A;  3FTV A;  2XPZ A;  4X8Q A;  2JAB A;  3FDH A;  2L6B A;  1OCZ E;  4XEI G;  2R59 A;  2XS1 A;  2XZT G;  1PXZ A;  2IEJ A;  3GZS A;  2XTW A;  4TXQ A;  3UMV A;  3DBS A;  4NK6 A;  4YZ0 A;  5JJ6 A;  2IU1 A;  5G55 A;  3R7R A;  4BX9 A;  4U8Y D;  4A3V A;  2P9U G;  4WNG A;  2MYO A;  4CGW A;  4MS6 A;  4LSZ E;  4WND A;  1NZN A;  2BUG A;  4F7A A;  4DX7 D;  3ABM E;  2IOS A;  2BM4 A;  4U4B A;  2GRQ B;  4Q94 A;  5HQ8 A;  3PE4 A;  1H80 A;  1U3C A;  4NAC A;  2YHC A;  5CHE E;  1WAO 1;  3RAU A;  2OV8 A;  4XI0 A;  1O8D A;  4APO A;  1H19 A;  2F3L A;  1TR4 A;  3O48 A;  1EF1 C;  3QKY A;  4FUL A;  3LVQ E;  2J9Q A;  1Z3X A;  4DX1 A;  4HLL A;  4B8A A;  1S63 A;  3CHO A;  1TN6 A;  1H6P A;  3QWV A;  3LY7 A;  2FEZ A;  3AG3 E;  2QXZ A;  2LAI A;  2WM9 A;  4YEI A;  1L1I A;  4ANV A;  4ANX A;  3FUF A;  3ZSC A;  4G23 A;  4J0U A;  2J8K A;  1DBO A;  3C3O A;  1IQU A;  4I9C A;  4I84 A;  1E90 A;  4J8Y A;  3PEU B;  3DPY A;  1BLX B;  1HU3 A;  4Z05 A;  2L9B A;  1WDY A;  3SQV A;  1K1B A;  1IB4 A;  3EDT B;  3VTY A;  1GW6 A;  3HVE B;  5EYP F;  2GRL A;  3V30 A;  1IA5 A;  3E32 A;  4J6I A;  4GA1 A;  2NSP A;  5JLV C;  4L1B A;  5EID A;  4OJP A;  1NFI E;  2VSO E;  5C1D A;  1AWC B;  4CT0 A;  5AYW D;  3C3R A;  1TNZ A;  2XS8 A;  3ZYQ A;  4ACL A;  3SNX A;  5FQ7 A;  4GYO A;  4XON A;  2EQX A;  3ZN3 A;  4B8C B;  2FI7 A;  1DNP A;  3NZS A;  1TSP A;  2PYH A;  4HFG A;  4EBA G;  3MV2 B;  2ZGD A;  5KCM A;  3D3M A;  4YND A;  2ODL A;  2LXM A;  2R5S A;  4UQY A;  1TJF A;  2VGY A;  4BFR A;  2VSN A;  3NOG D;  4I2W A;  3D9N A;  5T8I A;  5FZS A;  3CV0 A;  3NB2 A;  1BN8 A;  3U64 A;  2NZM A;  3RJV A;  3SI5 A;  3B4N A;  5C1C A;  2B0O E;  1SW6 A;  3GQA A;  4W8Q A;  4XR6 A;  5FQ8 A;  3FEX A;  4ANW A;  4CDN A;  3EHM A;  1Q2Z A;  3FUH A;  2BX6 A;  3PSZ A;  4HOS A;  3URZ A;  3RKV A;  4OYS A;  2QYJ A;  4KXK B;  5CRU A;  3ONK A;  3H09 A;  4UI9 J;  4DX2 A;  4Z06 A;  5FWQ A;  4LRZ A;  3ONL A;  1TNB A;  2A4Z A;  2ETA A;  2GRP B;  4GZD A;  4Y6W A;  3TWT A;  3MJW A;  2GW1 A;  4FJY A;  2FF4 A;  3FTY A;  4JZY A;  1S70 B;  5ENS D;  2HR2 A;  1XNF A;  3ZU7 B;  4HOU A;  4KYO B;  4DI3 A;  3HXD A;  5CCM A;  2IQC A;  2XGS A;  3NZU A;  5D0O D;  3UQ3 A;  2Q7F A;  3EIQ C;  3IHY A;  2X6I A;  4U63 A;  5KJM A;  1BHE A;  3UX4 A;  1O8H A;  1N4Q A;  4L2L A;  3UW0 A;  4IRU A;  3JXI A;  3SGH A;  5CMY A;  3VLF A;  3J5P A;  2XEN A;  3MZL B;  2J09 A;  3BQO A;  4KBQ A;  1N11 A;  3HXC A;  2P9S G;  1MYO A;  5A23 A;  1UW4 B;  1N0R A;  2A5U A;  2P58 C;  3UTM A;  3T5V A;  3D9L A;  3ASF A;  4N3B A;  3CK8 A;  4UI9 K;  2LO6 A;  3FU3 A;  1KPS B;  2VGE A;  5AQ7 A;  2EIN E;  4YCQ A;  3TWS A;  2P9K G;  4AIF A;  1FT2 A;  2UY1 A;  5AN8 A;  4BT9 A;  5KJN A;  3CKB A;  4AOF A;  4U04 A;  3HXB A;  5J08 A;  2ZIS A;  2EWE A;  2Y1L E;  2LXL A;  1RW2 A;  4DI4 A;  3ASO E;  3UT4 A;  2XRZ A;  1LTX A;  2X38 A;  3DSW A;  3ZHE A;  3P4G A;  2QY7 A;  4C48 B;  1EZG A;  2V5I A;  4R7L A;  4MBG A;  4LNB A;  4U96 D;  3AS5 A;  3UIP C;  3UM0 A;  4H7X A;  3D9K A;  4HQD A;  2F8Y A;  1RMG A;  4EBA A;  3FHE A;  4W8R A;  3LDZ A;  4YDW A;  3FUE A;  3CLJ A;  2LSV A;  3ABK E;  1KCC A;  4XLA A;  3TAX A;  3LY8 A;  3E37 A;  4RG9 A;  2I9C A;  2HO1 A;  4UWL A;  2WXM A;  3L16 A;  1PY1 A;  3BG0 B;  3V31 A;  4W8S A;  4J8E A;  3D9I A;  3B95 A;  3MV3 B;  2ION A;  5ENP D;  2KXP C;  2Y4U A;  4DJA A;  3CK9 A;  3AS4 A;  1WXR A;  2UY1 B;  1QRC A;  2IJG X;  5ENT D;  3FTS A;  1H0A A;  2EIL E;  5EX3 A;  4DLO A;  4PMH A;  2XPY A;  3G2U A;  3RRU A;  3L08 A;  4TXR A;  3SZE A;  4XOT A;  1NHC A;  2JEK A;  3MCX A;  2X3M A;  2GRN B;  4CYM D;  3CIA A;  3DXM G;  4ABN A;  4HOR A;  3JUE A;  3PZ4 A;  5D66 A;  3ZHE B;  4ILI A;  2HE0 A;  3ML8 A;  3PH0 C;  3PRE A;  4ILG A;  3Q9U C;  1O8G A;  2BTD A;  3G2T A;  4UUC A;  1NA0 A;  4RVB A;  1NA3 A;  4FP7 A;  1LLZ A;  3UPV A;  4KVO A;  3JXJ A;  4ATG A;  4I1M A;  3AG1 E;  5AIJ A;  3PUJ A;  2J49 A;  3ZXP A;  1HF2 A;  2C2L A;  4I1O B;  4B94 A;  3TXM A;  5BXU A;  1E96 B;  1TNO A;  4TUU A;  1N9A A;  2X6Y A;  4G8L A;  3ESK A;  4LUN U;  2RKK A;  2DZN A;  4Z68 A;  4YDO A;  3SBT B;  1SVX A;  4GCN A;  2I1J A;  3JQ0 A;  3CVY A;  1MZC A;  2AXU A;  3ZKJ A;  5EYL A;  4GPM A;  1TYX A;  3FWV A;  2X6J A;  4U0U A;  1JCS A;  1S0P A;  2FO1 E;  2XCB A;  4QQI A;  1H2V C;  1QRB A;  3VSV A;  1L5J A;  3GQ8 A;  2VFM A;  3ULE G;  4IYP A;  2XEE A;  3BG1 B;  4FJZ A;  4OJ5 A;  1K5C A;  4ZHB A;  3ZVV A;  5DNS A;  3AS8 A;  5ENO D;  2VGX B;  4I6J A;  2IFU A;  5B1A E;  1CLW A;  2B0R A;  4GZ5 A;  3GZ2 A;  2NXP A;  1N0Q A;  3LPZ A;  5FQ4 A;  3B7S A;  2BM5 A;  3FTZ A;  4ILH B;  1INZ A;  4XNF A;  4OJO A;  3ZYK A;  3UUX A;  4ANU A;  1K4Z A;  2X6F A;  4HLE A;  1H6O A;  4V3I A;  4WAF A;  5FZR A;  3C98 A;  3EUV A;  3PNL B;  3PS6 A;  4RLY A;  1K8F A;  3ZYL A;  4A1S A;  4J8S A;  4XLC A;  1H2T C;  2ZXW E;  3FH8 A;  3O4Z A;  2PZI A;  4JVS A;  2GRO B;  4TRQ A;  4OVU A;  3L54 A;  2FUL A;  2FO7 A;  4XOP A;  4RSY A;  2WPV A;  1X0C A;  4J7W A;  2VBK A;  3W9G A;  1MQS A;  1S64 A;  5LCW J;  3DU1 X;  3B7T A;  3GQ9 A;  4LNG A;  3U3W A;  3CVN A;  4XKB A;  3NAW A;  1ELW A;  3FP3 A;  4C2L A;  4UQX A;  3S7F A;  2E2E A;  2XPI A;  5AEN A;  2BKK B;  3GYZ A;  3B7R L;  2DCP A;  1IHB A;  4YVO A;  3SFX A;  1RWR A;  1TJC A;  2YHE A;  4PUC A;  4JXT A;  2AXZ A;  1O1S A;  4DPR A;  2EIJ E;  3UIO C;  5AQB A;  4EW9 A;  1WM5 A;  2P9P G;  5BPP A;  3TJP A;  3K9I A;  5JJ7 A;  2NC9 A;  5KBA A;  3FTW A;  4NK8 A;  5G2N A;  1FVF A;  4GTR A;  2QX3 A;  4AY6 A;  2Z8G A;  3KAE A;  4N2Q A;  3PET A;  5B1B E;  3RO2 A;  4U0Z A;  3U9W A;  3EU5 A;  3JCK C;  4O1O A;  3UXG A;  2H6G A;  5ENR D;  4YZA A;  3CVL A;  4I6E A;  4K0R A;  3V2X A;  4B0Z A;  1EA0 A;  4QFV A;  4XE0 A;  2ILR A;  3FUD A;  4KVM A;  3L17 A;  2YQ8 A;  3UIN C;  1VBL A;  4GZC A;  5HS0 A;  2VTB B;  1LF8 A;  2C0M A;  3S7B A;  4AM9 A;  4FLH A;  5KWD A;  3LJ3 A;  2PL2 A;  2ZU6 B;  4XKW A;  1OFL A;  1JCR A;  1OWO A;  5EDS A;  2ZGG A;  3B7B A;  4WNF A;  4F3V A;  3IV0 A;  4F53 A;  2KBX A;  3Q75 A;  4FLB A;  4PH4 B;  1LD7 A;  3DST A;  3D9J A;  2XQ0 A;  1E8Y A;  3TWX A;  4MKT A;  1HG8 A;  3RRN B;  2E0I A;  2OCC E;  2PM7 A;  3FH7 A;  4XX5 A;  2DWZ A;  4AXH A;  3CHP A;  3QC1 A;  2XZD G;  5EX0 A;  3PE3 A;  1OCO E;  5G04 C;  4IUL A;  4AP2 A;  5FJY A;  4FHK A;  3GRH A;  3PRZ A;  4GAA A;  4HOQ A;  4XMY A;  5ENN A;  2I1K A;  4OPW A;  2CFU A;  5LP0 A;  3HDX A;  4JEU A;  1MX4 A;  5BXO A;  1YCS B;  4AVX A;  2XTX A;  3FUK A;  5DBK A;  2Y4T A;  3T5X A;  2BKG A;  4UQZ A;  3CHS A;  4H7Y A;  2IY0 C;  5KNH D;  1ZB1 A;  2P2C P;  3ISM C;  1N52 A;  3CVU A;  3TWW A;  2WXK A;  1G3N B;  3RK6 A;  5JJT A;  2VBE A;  3FTU A;  3KSL A;  3FUI A;  3VLE A;  3ZW3 A;  1ELK A;  1CZF A;  3APC A;  4UWG A;  3GW4 A;  4GYY A;  2VFO A;  4GZ6 A;  4KT6 B;  1OCC E;  2I6H A;  2AVP A;  3TH0 A;  1BU9 A;  2RFA A;  3PSS A;  3G2W A;  4J8D A;  5CMW A;  1KCD A;  4KZ0 A;  4N3A A;  5E75 A;  1PC2 A;  5M72 A;  1QCX A;  1TNU A;  4HB5 A;  3ZXS A;  5CEA A;  2KC7 A;  1YMP A;  2M63 A;  5ENQ D;  2DYS E;  3AU5 A;  1RZ4 A;  1QQ1 A;  5DIZ A;  3GQ7 A;  3WXX A;  3GZ1 A;  4YC5 A;  4XLE A;  3CQC B;  1OFE A;  4UWH A;  1TN7 A;  2X6X A;  2ETC A;  1OY3 D;  4E85 A;  1PAQ A;  4HRM B;  1HO8 A;  2CG3 A;  2VJ8 A;  2RFM A;  5ANL A;  1DCE A;  3JUR A;  3CQG B;  1WMR A;  4PS8 A;  4B93 B;  3LEW A;  5JA4 D;  4KH3 A;  3VMV A;  5AMV A;  3QWW A;  3AG4 E;  1SZ9 A;  1KZO A;  3OTN A;  4GMR A;  1KLX A;  1MHQ A;  3G2V A;  3CVV A;  3Q5M A;  3AAA C;  4K03 A;  4HWV A;  2R03 A;  3KSQ A;  5BV1 A;  3ML3 A;  1MX6 A;  4DLQ A;  2R05 A;  3LJY A;  1D8D A;  1K1A A;  3SF4 A;  2R17 C;  4HVB A;  2B6C A;  3ZUV B;  5CBO A;  1JCQ A;  2EIK E;  3UM3 A;  1EYH A;  1SQM A;  4LG6 A;  3JUI A;  5AJD A;  3RRM B;  2KCV A;  4U7E B;  3VSU A;  4Q96 A;  4GA0 A;  3PVL A;  5AAR A;  2DVW A;  1KTW A;  3UM1 A;  1KQ5 A;  1QA2 A;  3C3Q A;  3CSF A;  3ZIM A;  4CGV A;  2WXL A;  1DC2 A;  3CR3 A;  4G2V A;  1H6K A;  2WXO A;  3ZPP A;  3C72 A;  2NTP A;  4GU5 A;  4XN0 A;  4U8H A;  3Q4A B;  4PS3 A;  3BH6 B;  3MKQ A;  3DSU A;  1W3B A;  1JTA A;  3LMW A;  1FVH A;  1P5Q A;  1E8Z A;  4EZJ A;  2J8S D;  2C0L A;  5G05 J;  3DSV A;  1EPU A;  4G25 A;  1Z3Y A;  4F6R D;  4MXN A;  1XG2 A;  2PNN A;  2WXN A;  4A1G A;  1HXI A;  5JMN D;  4GA2 A;  2L0I A;  2L6J A;  3JQ1 A;  4M7C A;  4CDR A;  4YVQ C;  4G11 A;  3S2A A;  1N4P A;  3D9M A;  4BES A;  3LXU X;  1O8F A;  2MRI A;  3TL5 A;  3KD7 A;  3HG0 D;  1Z6T A;  3V2O A;  2IO3 C;  4RQI A;  1HX8 A;  3ULY A;  2WQH A;  5CRV A;  2QFC A;  1KT0 A;  2XRY A;  5HRY A;  2X6H A;  4EEC A;  1EE6 A;  1E7U A;  3ML9 A;  2F0Y A;  5LX8 A;  4HNA D;  4N5C A;  3TWQ A;  2HYZ A;  3FFL A;  3VTX A;  5CBN A;  4FAD A;  1HH8 A;  4DRX E;  4XQF A;  2XGO A;  3PUK A;  2OND A;  2PM6 A;  3D9H A;  3PZ3 A;  2RD0 A;  4XZ4 A;  1A5E A;  3N6Z A;  4MLP A;  5ANR A;  4AEZ C;  1N95 A;  4P29 A;  5CED B;  4UI9 C;  4NRH B;  5JMC B;  1OWM A;  3MKQ B;  5FIO A;  3P2B A;  4JPS A;  3ASH A;  4XLH A;  2MHK A;  1IKN D;  3CVW A;  1IYG A;  2YIN A;  1OUV A;  1LLW A;  4BEP A;  2BED A;  3QJZ A;  4XM3 A;  3IBE A;  1VDY A;  4TXP A;  2UWJ G;  3MGB A;  3PZD A;  3R7Q A;  2P9L G;  4O6F A;  1UOH A;  1JWF A;  4I1A A;  3Q15 A;  3HRA A;  3SO8 A;  5CER B;  1UN8 A;  5H7P A;  4G8K A;  4G26 A;  4HOT A;  2XC1 A;  5D2M C;  3ABL E;  2VFQ A;  4C9B B;  4GCO A;  4Z03 A;  3OXG A;  3S7J A;  1OGO X;  3FUM A;  3EIJ A;  4ATZ D;  2OEW A;  3I4G A;  4I17 A;  3UI2 A;  4CEM A;  3MEK A;  1OCR E;  2MOW A;  4HRL A;  4BSZ B;  2Y69 E;  2OOE A;  3LYA A;  3WG7 E;  3RIB A;  2GRM A;  2V4H C;  2RG8 A;  3VLD A;  3UT8 A;  3L6A A;  3ENE A;  4LER A;  4PS7 A;  3Q47 B;  2V5F A;  3FY4 A;  5HKP A;  3SY2 A;  1UJJ A;  5FQ6 A;  1FCH A;  1Y8M A;  4XKV A;  1QYM A;  3E30 A;  3SFY A;  4HRN A;  3DSX A;  1MX2 A;  5AAO A;  3SZ7 A;  4A63 B;  1Z5S C;  2O04 A;  3SYJ A;  1YYH A;  3R9M A;  4G1T A;  2QY1 A;  4HXI A;  3TWU A;  1N94 A;  4JEH A;  2Y3A A;  4AVZ A;  4HBD A;  5KJK A;  1OXJ A;  3CHQ A;  2O6W A;  4MRU A;  4BSX A;  4JA7 A;  4JHK A;  3J5Q B;  3AK5 A;  3LYC A;  3Q7A A;  4BET A;  4DUI A;  2J4B A;  3B90 A;  2V8S E;  1O1R A;  4N3C A;  3IKO B;  4BTB A;  4A3T A;  1TYV A;  1K8K G;  5BUZ A;  3U4T A;  3KS2 A;  3ULQ A;  2XGM A;  4WWO A;  1TYW A;  2VFP A;  3LY9 A;  2DZO A;  2J4D A;  3T8M A;  3Q49 B;  5D0Q D;  4L7T A;  2PQR A;  2X85 A;  2L0T B;  2A5E A;  1D9S A;  3FU0 A;  2LUH A;  1DAB A;  4LCT A;  1IHG A;  1O8M A;  4U8V D;  3HXE A;  4G24 A;  4CCA A;  4HI9 A;  4F1P A;  1O88 A;  4JD2 G;  1UJK A;  3DEP A;  3SHF A;  4V02 C;  1UN9 A;  4J8F A;  2X6W A;  2WXG A;  3FUJ A;  3JX8 A;  3NQP A;  1SA4 A;  4YZX A;  3DWL G;  4JHR A;  1DBG A;  3QK0 A;  2O0W A;  2VJI A;  3QOU A;  5IY5 E;  3CVQ A;  2AJA A;  3E34 A;  2AWI A;  5T3R A;  3D9O A;  2GRR B;  1OWL A;  5AJL A;  4CRW A;  4XL9 A;  1TNY A;  2O1D A;  4K5A B;  4C0M A;  3HVE A;  2QC9 A;  2J08 A;  1ZU2 A;  2PYG A;  3G2S A;  1DVP A;  3OAW A;  5J90 A;  2UVE A;  1NL4 A;  2Y0B G;  3UKU G;  2XHE A;  2YUH A;  5KNG A;  3RSE G;  4AY5 A;  1PE9 A;  1N54 A;  2QYU A;  2WXI A;  1JRG A;  2GGF A;  2KCK A;  4N5Q A;  2WQ7 A;  4FA6 A;  4A55 A;  3ESL A;  3IXE A;  3S7D A;  1D8E A;  5ITZ F;  3DSS A;  2H6F A;  2FBN A;  3IEG A;  2YNQ A;  4I9E A;  4GTO A;  4HI8 A;  3VST A;  3CVP A;  3EHN A;  5AQA A;  3EHR A;  1OOC A;  4KZC A;  5B3S E;  4OM9 A;  4YFO A;  3BU8 A;  2DYR E;  3SFZ A;  2H6H A;  3BUA A;  1E8W A;  1HG2 A;  2NTB A;  1QNF A;  2ETB A;  1DCQ A;  3CHM A;  1QBQ A;  3APF A;  3HIZ A;  1BI8 B;  3CGH A;  3LKU A;  3N90 A;  4GYW A;  4GTT A;  2LSU A;  2AXV A;  4MR0 A;  2KM4 A;  3SD5 A;  1KT1 A;  2NT6 A;  3E4B A;  4AV7 A;  5LCW C;  1QJV A;  3PZ2 A;  2IQ7 A;  2UVF A;  5T4Y A;  3ASG A;  2F37 A;  3ZGQ A;  1IDK A;  3Q7F A;  4HS2 A;  1NP7 A;  3UKR G;  5KJL A;  2KAT A;  3D9P A;  2W7Z A;  3FUL A;  2IOU G;  1KZP A;  3QWP A;  3B7U X;  1BI7 B;  5EIB E;  1FPP A;  3DRA A;  1N4S A;  1O8E A;  2NSZ A;  1TEZ A;  2INU A;  3TWV A;  3PDN A;  2KCL A;  2J8I A;  5JHA A;  3Q79 A;  2VFN A;  1XGW A;  5BW8 C;  1EDU A;  3NBN B;  4BTA A;  1LM1 A;  3EJN A;  3PEV B;  2KZT A;  3SUC A;  1A17 A;  2F8X K;  3I4R B;  4EHM A;  3Q78 A;  4URK A;  4JRA C;  4OAU C;  4C0E A;  4XKC A;  3KEA A;  4AJW A;  4GMJ A;  1SZA A;  4NUR A;  4DX6 D;  4W8T A;  3QDN A;  4U95 D;  2OEV A;  3EU9 A;  2CHZ A;  4OZY A;  4APF A;  2XT2 A;  4WUY A; 
#chains in the Genus database with same CATH homology
 2XT4 A;  4YDT A;  2J8K A;  4YCQ A;  5DNS A;  2XTY A;  2O6W A;  2QZA A;  3SY2 A;  3DU1 X;  3PSZ A;  4YC5 A;  3SQV A;  4YFO A;  2QYU A;  3PSS A;  3NAW A;  3NB2 A;  4YEI A;  2XT2 A;  2XTX A;  2XTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...