3SQVA

Crystal structure of e. coli o157:h7 e3 ubiquitin ligase, nlel, with a human e2, ubch7
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
612
structure length
606
Chain Sequence
QGRACLSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGCTAVLTDMLTEHAKESFPEIFSLYYPVAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of two bacterial HECT-like E3 ligases in complex with a human E2 reveal atomic details of pathogen-host interactions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase/signaling protein
molecule keywords secreted effector protein
total genus 166
structure length 606
sequence length 612
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13979 SopA_C SopA-like catalytic domain
A PF13981 SopA SopA-like central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4140.10 Mainly Alpha Orthogonal Bundle effector protein (NleL) fold effector protein (NleL) 3sqvA04
1.25.40.300 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Putative secreted effector protein 3sqvA02
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3sqvA01
3.40.1850.10 Alpha Beta 3-Layer(aba) Sandwich HECT-like ubiquitin ligase fold HECT-like ubiquitin ligase 3sqvA03
3SY2A 3PSZA 2O6WA 2XT2A 3SQVA 3NAWA 3PSSA 5DNSA 4YC5A 2XTWA 3NB2A 4YEIA 2QZAA 3DU1X 2XTXA 4YDTA 4YCQA 2QYUA 4YFOA 2J8KA 2XT4A 2XTYA
chains in the Genus database with same CATH superfamily
1XNFA 3EQNA 5CMYA 4DK5A 4HVBA 2BKKB 4HWVA 2ZIRA 4DJAA 4AEZC 1WDYA 3D9PA 4J8YA 3DU1X 3PZ3A 3MKRA 4HOTA 4M3OA 3QWWA 2C0MA 2XEEA 4ACKA 3SD5A 2GRNB 4AM9A 3AU5A 4GTTA 4CDMA 4FC8A 3FDHA 4CEMA 2J4DA 3D9NA 1TJFA 1IQRA 2EIME 3UKRG 4BX9A 4FLHA 2FF4A 4R7LA 3CHSA 3VTYA 3JXJA 4U8YD 1KZPA 4G2VA 5EIDA 2I1JA 5ENOD 1KCCA 3FFLA 3JQ1A 2VGXB 4BEPA 1QA2A 4UWGA 3ZYMA 2VFNA 2FULA 2LNIA 3TWWA 2BTDA 3IEGA 2WM9A 3CSFA 1HO8A 4BWRA 2VJJA 3HDXA 2HO1A 1MX2A 1HF8A 3DSSA 3GW4A 4O1OA 4GTRA 5M72A 2NT6A 1O8GA 4U8HA 5AIJA 4YDEA 3SYJA 3G2WA 4V3IA 2KM4A 3UT4A 2IEJA 5D2MC 3TAXA 4CT0A 4PS7A 4YEIA 1DNPA 2YHEA 4XKBA 3MKQA 4L2LA 4GB9A 2KCVA 3DXKG 1JWFA 5AMVA 3T9GA 2AXUA 3V2OA 1LD8A 3SQVA 4NK6A 2YNQA 3SUCA 1FT2A 3HXEA 2XQ0A 3ZYKA 4I1AA 4XIFA 3C72A 4AOFA 3UPVA 1Q2ZA 5BXOA 4APFA 3B90A 1NL4A 2XEHA 4XMYA 2FBNA 3LS8A 3VLEA 1JPLA 5ARFA 5ENNA 4NQ0A 4DX5D 3ZIMA 1N54A 2O0VA 1IXVA 4N2SA 2ONDA 4KYOB 2WMNA 1OUVA 4ACLA 3SNXA 5JJ7A 2H6IA 3D9OA 3PNTB 2VSYA 3JURA 5T8IA 2LSVA 1WM5A 3BU8A 2J49A 1DBGA 4EBAA 3BG1B 5G04J 5LFAA 1IDKA 4XI9A 3NQPA 3VMVA 4EQFA 2GRMA 4N2QA 3KD7A 2LAIA 4IRUA 2IQ7A 1Y6IA 3ASHA 1HE8A 4FHJA 1IYGA 2X38A 2IO3C 4DX6D 4ZFHA 2PYHA 4HNAD 4J8FA 2XPZA 3VSUA 3E4BA 2AXZA 2HR2A 4YZQA 1IQUA 3EU5A 1OOCA 2PYGA 1BHEA 3ONLA 2V5FA 4UI9J 4U07A 2OOEA 1D9SA 4URRA 2GRPB 3CQCB 4K5CA 1MX4A 4HRMB 4K5BA 3SI5A 3FTSA 1AP7A 3APDA 4TV3A 2X6YA 3BQOA 4WWOA 3V31A 4ILHB 4OPWA 1WG0A 1DABA 1BU9A 1H6OA 4KMOA 2NZMA 3LCAA 2Y4TA 2BM6A 3IV0A 3HVEB 3EDTB 5T3RA 3DRAA 2IO2C 2KZTB 4E6HA 3Q78A 2OCCE 1N52A 3TXNA 2NYJA 2I9CA 3OXLA 3W9GA 1N4SA 2XPIA 5J90A 1O8EA 5KJLA 2H6HA 3CGHA 3EJNA 4BSZB 4K0RA 1SZAA 1OGOX 4UQZA 2P9NG 2DZNA 5JJ6A 4ILIA 2XPYA 3ZNGA 4OVVA 3G2VA 2HYZA 1H2TC 4GYYA 3ZHEB 1BN8A 1YCSB 2WXLA 3DPDA 2J8SD 3PS6A 4UWLA 4F1PA 3T8MA 1TNOA 3B13A 3EHNA 2R03A 3ML8A 3AK5A 4Q69A 2Y0BG 1TYUA 3NB2A 1KZOA 2E0IA 2P9UG 4FULA 3C98A 4E85A 3ZW3A 4GCOA 2EIKE 2WXHA 1N11A 4YZAA 2BF0X 1N4QA 5AN8A 3CIAA 1E8YA 4I1OB 4O6FA 2BEDA 4MBGA 1OFDA 3QJZA 2H6FA 2QXZA 4F6RD 1PE9A 2BX6A 2IF4A 2A4ZA 5H7PA 2J09A 1O8JA 4N3AA 4J8DA 4FADA 5CRUA 2DVWA 4YVOA 3ML9A 2IJGX 4L23A 4NK8A 2R02A 2FI7A 3L82A 2FO1E 4WWNA 3V2XA 3UUXA 2V4HC 1HZ4A 3O48A 2KCLA 5BXUA 2BM4A 1UW4B 3MA5A 1D8EA 4I2ZA 4EZLA 4JVSA 5AENA 1O8FA 4IULA 4KVMA 3B8YA 5LCWJ 3SFXA 3QWPA 3B7TA 4LSZE 4L1BA 3IXEA 4XLHA 2VJ8A 3FH8A 2B6CA 3RU0A 4TUUA 4I17A 5AQBA 4JHKA 2DZOA 3FU5A 1NFIE 3ESKA 4D10C 1OFEA 5FIOA 3HXFA 2UWJG 4AVZA 1AWCB 1TN8A 2BUGA 3FU6A 1TNBA 2QYUA 1H6KA 2P9KG 2IOSA 5FWQA 2DCPA 4TXRA 1TJCA 3PVLA 5HKPA 1OCOE 1Z3YA 4GZDA 3CQGB 4N5CA 1TR4A 1KCDA 2V5IA 1KT1A 4OAUC 1VBLA 2WB2A 4U0ZA 3HYMB 2W7ZA 3NBNB 1SW6A 3TWSA 4YZ0A 2ILRA 3ABLE 3S7JA 4JPSA 2R5SA 1O88A 2XZDG 4Y6CA 1QRCA 4C0MA 5DIZA 4KVOA 2X6XA 2J4BA 3QOUA 2P9LG 3CVYA 2P9IG 3ASOE 4TUMA 2WQHA 4WAFA 5FT9A 3GQAA 2LUHA 3MYVA 5BNWA 2XENA 2J8IA 2O04A 3Q47B 5EYLA 3KAEA 1HS6A 4J6IA 4BX8A 4URKA 3NOGD 3CK8A 1KT0A 3B7BA 2O17A 3LMWA 4U63A 3L54A 3LJNA 2Y4UA 2X6FA 3DEOA 1IDJA 4NACA 3GRHA 4I6JA 3PZ1A 3J5QB 4KH3A 3AS4A 2G0YA 3CLJA 1TYQG 3FUDA 2O0WA 5JMND 1DCQA 2GW1A 3N90A 1LF8A 2RFAA 3QNKA 3CVUA 4JA7A 5E76A 4I1MA 4XLFA 1O8LA 1N9AA 1NHCA 4ANWA 2WXFA 2VGXA 5FQ7A 4K5AB 2CHXA 3U66A 4XL9A 3C3QA 4KXKB 1CZFA 3RAUA 4O1PA 4OJ6A 2DIWA 2JEKA 1E7UA 4ATZD 1WAO1 3DPYA 3I4RB 3OXFA 3E37A 3JCKC 4HLEA 2XZTG 3N71A 3TG5A 5JMCB 3Q7FA 3RIQA 3L22A 5D66A 1QQEA 4CT4A 5EN5D 4ILGA 4PUCA 2XTXA 1AIRA 3FTUA 4XOTA 2M63A 2RFMA 3GZ2A 1UN9A 2ZGDA 3EQOA 4FJZA 3OTNA 4NURA 3ZXPA 1O1RA 3QWVA 3NZSA 2R59A 1S70B 3DSXA 5AYWD 4U96D 2IOUG 2X3HA 3JQ0A 5ITZF 3G2SA 3CHMA 2A5EA 1WMRA 3UW0A 1K3ZD 2WMOA 3FU3A 3DSWA 3U64A 4UUCA 3FUIA 2X6HA 3FUJA 1TYXA 3DSTA 1OWNA 3RRUA 4APOA 4Y6WA 3LJ3A 2BSPA 2GGFA 3C3RA 2NTQA 3CK7A 3LVQE 4XM3A 3S7DA 4XN3A 4UQYA 2L0TB 2VFMA 3ULYA 3QK0A 4AJWA 1K4ZA 4H7YA 4XZ4A 3SGHA 5C2YA 3H09A 4W8TA 3VLFA 3UT7A 2PNNA 3DSVA 1OCZE 3T5VA 1N4RA 1O8IA 1Z3XA 3URZA 4U95D 5B1AE 5G2NA 1JWGA 3B7SA 2VBKA 3ZN3A 5G05C 2L6JA 5FZSA 5C1DA 4YDOA 2VSOE 5C1EA 2UY1B 4J8SA 1B89A 5HRYA 3UXGA 4WNDA 3U4TA 1MZCA 4GZ6A 5DBKA 1HF2A 3ZUVB 4AY5A 3UKUG 1QCXA 3FULA 4A3TA 3MJWA 4JHJA 3FTZA 4LRZA 1EE6A 4BT8A 3B7RL 3LYAA 4HXIA 4ZHBA 1N94A 3MGBA 1HFAA 3TG4A 1N0QA 1K5CA 1OWMA 3CKCA 3UQ3A 4U04A 3ZRHA 4MXNA 4HRLA 2LO6A 1DCEA 1IHGA 3HXDA 3L6AA 3AG3E 4G26A 4UI9C 1MYOA 4J0UA 5CBNA 4OAVB 2L9BA 3SY2A 3RRMB 1MJ0A 1U2VG 3L16A 4HOSA 1IKND 3MZLB 4CGVA 1TYVA 4HI9A 5JJTA 4MR0A 4LEUA 5KJKA 2OEWA 4YZXA 1N95A 1VDYA 2RD0A 1DVPA 4HS2A 1K8FA 1TNYA 2Z8GA 2XEVA 3SZ7A 3F6QA 2INVA 3ZGQA 4W8SA 4Q94A 3RJVA 3ESLA 3E32A 3ASGA 2ZU6B 3AS8A 4FP7A 3FUHA 3LVRE 3JUIA 2C0LA 4PS8A 2B0RA 3PE3A 2VBEA 3GQ9A 5ENTD 1QYMA 4PDXA 5CEDB 4H7XA 3ASFA 4ANVA 3VSVA 1TN7A 1DC2A 1NA0A 5AJLA 1SVXA 5FZQA 5AQ7A 3AG4E 3CVQA 3CHQA 3FHEA 4BESA 3RRNB 3UIOC 3ZPJA 5FJYA 3GQ8A 2XCBA 3RO3A 3UI2A 3V79K 2AWIA 1OFMA 4MLPA 4GA1A 2ETAA 3ZU7B 1JUQA 2XCCA 5KJNA 4J7WA 4RSYA 3LJYA 1BI8B 4GTQA 4CYMD 4XEIG 4Z03A 3Q9UC 2R05A 4KZCA 4WNFA 4XX5A 4C0EA 5J08A 1K8KG 1Y8MA 3TGOA 3JX8A 2XS1A 2VTBB 1HG2A 2PQRA 4DI4A 4G11A 3R7QA 2NC9A 2P58C 3AAAC 2NTPA 4RVBA 1OGMX 2P9PG 2VSXE 2E2EA 3S7FA 1RW2A 3PDNA 3CR3A 2WQ7A 2NSTA 4F3VA 3JYSA 4RG9A 2ODLA 2IFUA 2ZXWE 1S0PA 5G04C 1XG2A 5CBOA 4Z05A 2RKKA 4LG6A 1A5EA 5LCWC 1EDUA 2QY1A 3PREA 3R9AB 2LXLA 3KRGA 3PH0C 2J07A 1PAQA 2O1DA 3QB2A 5B1BE 3SFYA 3FUEA 2EQXA 5KWDA 4XR6A 5AQ9A 3EIQC 2XGMA 2F8XK 4JB8P 4XLAA 5D0QD 3AG1E 3TWTA 3PUJA 4GZ5A 3ZKJA 1H19A 2UVEA 3HRAA 4YEJA 3ZYLA 4TRQA 4DPRA 2Y69E 4YCQA 5B3SE 4J8EA 2WXIA 4WNEA 4V02C 4PMHA 1TN6A 5C1CA 3Q4AB 3MEKA 4DUIA 3UTMA 3ZFWA 4U8VD 4HB5A 3ULEG 4WNGA 3BEEA 1LD7A 4OM9A 1FVHA 4HQDA 1TYWA 2XT2A 4XN0A 3IHYA 1SA4A 1CLWA 5E75A 1QQ1A 1KLXA 4GMJA 2I2OA 1N0RA 1GW6A 3NZUA 3AG2E 5HQ8A 2KZTA 1K1AA 1FCHA 4RQIA 3Q5MA 5ARGA 4ANUA 4LCTA 3LKUA 1BD8A 2XGOA 5ENPD 2LAHA 3C3OA 4HFGA 1JCRA 3UX4A 5ANLA 3WG7E 2LSUA 1OXJA 3FP3A 5BW8C 3JUEA 2ETCA 3DEPA 4JHRA 4OZZA 2F8YA 4YELA 1OFLA 4GTPA 1JTAA 4JRAC 4I9CA 5EIBE 1RWRA 2NSZA 5KBAA 5HI7A 1HH8A 4G8LA 3B95A 1EF1C 2F37A 4AVXA 4GYWA 1RZ4A 3DWLG 2WPVA 3SO8A 2Y1LE 3TWUA 4DRXE 3HXCA 3K9IA 2VGEA 1MHQA 4XKWA 3X2QE 1QA1A 1U3CA 2INUA 3U3WA 5T4YA 4LNGA 1LTXA 5EDSA 2VTBA 3Q9NC 4GCNA 3GQ7A 4YC5A 3VSTA 1H80A 4L9PA 1BPOA 2XGSA 3LPZA 1NI1A 4JA9A 5LP0A 2WXGA 4Z68A 3OXGA 4JC8A 5KCMA 2KCKA 4AIFA 5BPPA 1OWLA 5KNHD 4B93B 4ANXA 2R2LA 1KTWA 3MV2B 2X6JA 5AARA 2NXPA 3CHRA 3ASDA 4JL0A 3L9TA 4B8AA 3RKVA 1QNFA 5JHAA 3V30A 3LY7A 2BM5A 3EHRA 3JXIA 5LOZA 3TWQA 3MX3A 5ENSD 5EKQD 1O5MA 3HXBA 1E8WA 3FUFA 4XLEA 4QQIA 3D9HA 4JW1A 4N39A 5AJDA 4DLQA 2F0YA 3KSQA 2X6IA 4LERA 3SBSA 4I2WA 3CV0A 3ENEA 3SFZA 4XKCA 3FUMA 4GZ3A 1OCRE 3CVWA 3N6ZA 5FZRA 2GRQB 2CFUA 2J08A 4F53A 2MRIA 1KQ5A 3PRZA 5CERB 2YUHA 3HG0D 3UM0A 2DWZA 5FQ8A 3GYZA 3D3MA 3FH7A 2XTWA 3RO2A 2WXJA 4G25A 2QYJA 4FJYA 4AY6A 3HVEA 2NTBA 1L1IA 1X0CA 4QFVA 4PS3A 2F3LA 3QKYA 1MQSA 3ZHEA 3FU0A 3KSLA 2AW6A 3Q79A 4ATGA 1PLUA 4B89A 2FEZA 3UM1A 4JEHA 4XNFA 2VFOA 3AJIA 1GQ8A 4YDWA 3C5RA 1S64A 2KBXA 1PY1A 4Z06A 1PC2A 3U9WA 4AP2A 1BI7B 2FO7A 4G24A 2YHCA 4KBQA 2MYOA 1XGWA 2YQ8A 3MKQB 1E90A 1KPSB 3CKBA 4HI8A 1RMGA 3Q75A 1TEZA 1IB4A 1LLZA 2PZIA 4GA2A 2QY7A 3EHMA 2IONA 4AV7A 3I4GA 2WXPA 2VFPA 1H2UA 1HXIA 4G23A 4EZKA 4U4BA 2BM7A 3LY9A 2WXQA 1JCSA 3FUKA 3NF1A 2JABA 1L5JA 2HE0A 1MX6A 5CMWA 4XONA 2I1KA 5HS0A 4I6EA 4GTSA 2JLBA 3ZEFA 4MKTA 3TWRA 4A55A 3TJPA 3BG0B 5CCMA 4G8KA 3G2TA 4Q96A 4DX2A 3PZ4A 1YYHA 4F7AA 5CCLA 2CG2A 4UWKA 2XC1A 3Q73A 4A1GA 5AQAA 2CG3A 4A3VA 2L6BA 4MRUA 5FQ4A 4UWHA 2IOLA 3RIBA 2IY0C 1HG5A 4CGWA 4DX1A 3DSUA 2AJAA 4JXTA 2J9QA 1OCCE 4UWFA 4DI3A 4YDTA 1UN8A 4A1SA 1PXZA 3CVVA 4O60A 3ONKA 4GTMA 4A63B 3BUAA 1QRBA 1QA3A 2WXMA 3EHQA 4L7TA 2WQ6A 3UM2A 1NZNA 2IQCA 3QDNA 1O8HA 3ZSCA 5JLVC 1V55E 3PETA 3EUVA 3IKOB 5FINA 3IHVA 1K1BA 5ANRA 4YDYA 3FY3A 2KATA 5FTPA 3EIJA 4MS6A 1X81A 4NRHB 3CEQA 4I43A 3ZXSA 1O8KA 2WXOA 4C9BB 4OYSA 2VFQA 2WXRA 5G55A 3D9LA 3B4NA 2KXPC 2X6WA 2ZGGA 4YFOA 3S7BA 4CDNA 4C2LA 3SZEA 3TL5A 1EYHA 1O1SA 4M7CA 3D9KA 3PNLB 2NSPA 1SA5A 4OJPA 2R17C 4NIKA 4XI0A 3CVXA 5CEAA 5BV0A 2VQ2A 3PEUB 5DNSA 4IYPA 5IY5E 3R7RA 3HHMA 5KNGA 5LX8A 1O1TA 4BT9A 3TH0A 2PQNA 2ZISA 3LXUX 2OEVA 3ISMC 3QAQA 2L0IA 3UT8A 3DXMG 5G05J 1ZU2A 2X3MA 4X8QA 4HOUA 4LNUD 3ABKE 1ZBPA 2ETBA 5A6CA 3PSZA 4WUYA 1YA0A 3WWGA 2O6WA 3PSSA 4EW9A 5CHEE 3UM3A 4LNBA 2QZAA 4GMRA 3FEYA 3SF4A 4U7EB 1S63A 3Q15A 1EZGA 1DBOA 2MHKA 3P4GA 2PECA 1HG8A 1P5QA 4RLYA 2VGYA 3P1UA 4GTOA 1ELKA 1X5BA 3S2AA 2X6KA 2KC7A 2V0PA 2XS8A 3T5XA 4PH4B 3ABME 4U0SA 3SBTB 3BH6B 3CHOA 2QX3A 3QC1A 2I6HA 3VLDA 3ML3A 3ZYQA 4FU3A 2YINA 2AVPA 3ZVVA 2OVBA 1QZ2A 4UQXA 3TXMA 3FTVA 4DLOA 4YVQC 2XRZA 4YNDA 4XORA 3ULQA 3Q49B 4HRNA 4TXPA 1E8ZA 1D8DA 4XQFA 3CVLA 3LDZA 2AXVA 2GRRB 3UIPC 1V54E 2CHZA 4F1SA 4XOPA 4EECA 4L2YA 1EA0A 3RSEG 4W8RA 4ME2A 1OWPA 2EILE 5AAOA 3RK6A 1WXRA 1OY3D 1YMPA 1JCQA 1LLWA 4OZYA 3PE4A 1TNUA 4HLLA 1FT1A 1ELRA 4CZ2D 3FEXA 4N3BA 4W9RA 4B8CB 2XRYA 2UVFA 4KZ0A 2OVFA 3SHFA 3TWXA 2VJIA 4U0UA 1SZ9A 1WY6A 1HX8A 1IHBA 3UINC 4KT6B 2P9SG 3FTYA 3R9MA 4B94A 1E8XA 2V5QC 4EBAG 5JHBA 3E33A 1JRGA 3MV3B 3TWVA 4GYOA 3QARA 1UOHA 4HBDA 2XHEA 4EPZA 1TNZA 3E34A 3L08A 1ELWA 4FLBA 1TSPA 1FPPA 2Q7FA 4CRWA 2J8KA 2OV8A 3PUKA 2QFCA 2MOWA 4XLCA 2A5UA 5FQ6A 3D9IA 2CHWA 1E96B 3I3NA 4BERA 3MCXA 3LYCA 2DBAA 5JA4D 2PM6A 3FWVA 4GAAA 4JZYA 4OJOA 3EU9A 3KEZA 4I6GA 2UY1A 4JEUA 4EHMA 4C48B 3AU4A 2EIJE 3CHPA 2NT9A 3FTWA 2EINE 3VTXA 4WWPA 4AXHA 1QBQA 2VSNA 2PM7A 1H0AA 3CSTA 2V8SE 2VYIA 1LM1A 3L13A 3T9KA 3UMVA 2WXNA 1FVFA 2P2CP 4EZJA 3W9FA 4CCAA 4RG6A 3CVNA 2QC9A 3APCA 4W8QA 3WXXA 4IN3B 2GROB 1UJKA 1EPUA 2DYRE 4HOQA 5ENRD 2EWEA 4BTAA 4FHKA 4LUNU 1RU4A 4OJ5A 1SQMA 3O4ZA 1W3BA 4XKVA 1O8DA 4I84A 1U3DA 4CDRA 5KJMA 3BH7B 3DBSA 1UG3A 2IU1A 2BKGA 3FTXA 2VBMA 3Q7AA 4K03A 4FA6A 3NOCD 3CVPA 4UI9K 1OT8A 4GA0A 5BUZA 1OWOA 4GPKA 2V4LA 3D9MA 1Z6TA 3P2BA 2B0OE 1INZA 2Y3AA 4N5QA 5EILA 5ENQD 1E7VA 3I5PA 3L17A 3E30A 1A17A 4BETA 4ABNA 4BSXA 5EYPF 1ZB1A 3GZ1A 2GRLA 5D0OD 5CRVA 5A23A 2DYSE 4GMLA 2X85A 3KEAA 2WVIA 4BY6A 2XTYA 4U49A 3IBEA 3FH5A 3KS2A 4GU5A 1NA3A 3B7UX 3NAWA 3GZSA 1G3NB 3OAWA 3HIZA 3PZDA 3PZ2A 4G1TA 3T8KA 4GPMA 4I9EA 5CECB 4B0ZA 3VMWA 1H2VC 5BT1A 1N4PA 4DX7D 3FY4A 3D9JA 1UJJA 5A7DB 3ZPPA 1HU3A 4N3CA 4BTBA 4BFRA 2H6GA 1H6PA 2CFZA 3APFA 5EX0A 2XT4A 4JD2G 3J5PA 4HORA 1O8MA 3CK9A 1Z5SC 5BV1A 5EX3A 2C2LA 2LXMA 1QJVA 3ASNE 1IA5A 4OVUA 4OJLA 4P29A 2RG8A 3LEWA 1NP7A 1BLXB 3PEVB 2HM8A 2PL2A 3G2UA 3LY8A 4XE0A 4TXQA 4GTVA 4GZCA 2WXKA 3FUNA 3AS5A
chains in the Genus database with same CATH topology
3SY2A 3PSZA 2O6WA 2XT2A 3SQVA 3NAWA 3PSSA 5DNSA 4YC5A 2XTWA 3NB2A 4YEIA 2QZAA 3DU1X 2XTXA 4YDTA 4YCQA 2QYUA 4YFOA 2J8KA 2XT4A 2XTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SY2 A;  3PSZ A;  2O6W A;  2XT2 A;  3SQV A;  3NAW A;  3PSS A;  5DNS A;  4YC5 A;  2XTW A;  3NB2 A;  4YEI A;  2QZA A;  3DU1 X;  2XTX A;  4YDT A;  4YCQ A;  2QYU A;  4YFO A;  2J8K A;  2XT4 A;  2XTY A; 
#chains in the Genus database with same CATH topology
 1XNF A;  3EQN A;  5CMY A;  4DK5 A;  4HVB A;  2BKK B;  4HWV A;  2ZIR A;  4DJA A;  4AEZ C;  1WDY A;  3D9P A;  4J8Y A;  3DU1 X;  3PZ3 A;  3MKR A;  4HOT A;  4M3O A;  3QWW A;  2C0M A;  2XEE A;  4ACK A;  3SD5 A;  2GRN B;  4AM9 A;  3AU5 A;  4GTT A;  4CDM A;  4FC8 A;  3FDH A;  4CEM A;  2J4D A;  3D9N A;  1TJF A;  1IQR A;  2EIM E;  3UKR G;  4BX9 A;  4FLH A;  2FF4 A;  4R7L A;  3CHS A;  3VTY A;  3JXJ A;  4U8Y D;  1KZP A;  4G2V A;  5EID A;  2I1J A;  5ENO D;  1KCC A;  3FFL A;  3JQ1 A;  2VGX B;  4BEP A;  1QA2 A;  4UWG A;  3ZYM A;  2VFN A;  2FUL A;  2LNI A;  3TWW A;  2BTD A;  3IEG A;  2WM9 A;  3CSF A;  1HO8 A;  4BWR A;  2VJJ A;  3HDX A;  2HO1 A;  1MX2 A;  1HF8 A;  3DSS A;  3GW4 A;  4O1O A;  4GTR A;  5M72 A;  2NT6 A;  1O8G A;  4U8H A;  5AIJ A;  4YDE A;  3SYJ A;  3G2W A;  4V3I A;  2KM4 A;  3UT4 A;  2IEJ A;  5D2M C;  3TAX A;  4CT0 A;  4PS7 A;  4YEI A;  1DNP A;  2YHE A;  4XKB A;  3MKQ A;  4L2L A;  4GB9 A;  2KCV A;  3DXK G;  1JWF A;  5AMV A;  3T9G A;  2AXU A;  3V2O A;  1LD8 A;  3SQV A;  4NK6 A;  2YNQ A;  3SUC A;  1FT2 A;  3HXE A;  2XQ0 A;  3ZYK A;  4I1A A;  4XIF A;  3C72 A;  4AOF A;  3UPV A;  1Q2Z A;  5BXO A;  4APF A;  3B90 A;  1NL4 A;  2XEH A;  4XMY A;  2FBN A;  3LS8 A;  3VLE A;  1JPL A;  5ARF A;  5ENN A;  4NQ0 A;  4DX5 D;  3ZIM A;  1N54 A;  2O0V A;  1IXV A;  4N2S A;  2OND A;  4KYO B;  2WMN A;  1OUV A;  4ACL A;  3SNX A;  5JJ7 A;  2H6I A;  3D9O A;  3PNT B;  2VSY A;  3JUR A;  5T8I A;  2LSV A;  1WM5 A;  3BU8 A;  2J49 A;  1DBG A;  4EBA A;  3BG1 B;  5G04 J;  5LFA A;  1IDK A;  4XI9 A;  3NQP A;  3VMV A;  4EQF A;  2GRM A;  4N2Q A;  3KD7 A;  2LAI A;  4IRU A;  2IQ7 A;  1Y6I A;  3ASH A;  1HE8 A;  4FHJ A;  1IYG A;  2X38 A;  2IO3 C;  4DX6 D;  4ZFH A;  2PYH A;  4HNA D;  4J8F A;  2XPZ A;  3VSU A;  3E4B A;  2AXZ A;  2HR2 A;  4YZQ A;  1IQU A;  3EU5 A;  1OOC A;  2PYG A;  1BHE A;  3ONL A;  2V5F A;  4UI9 J;  4U07 A;  2OOE A;  1D9S A;  4URR A;  2GRP B;  3CQC B;  4K5C A;  1MX4 A;  4HRM B;  4K5B A;  3SI5 A;  3FTS A;  1AP7 A;  3APD A;  4TV3 A;  2X6Y A;  3BQO A;  4WWO A;  3V31 A;  4ILH B;  4OPW A;  1WG0 A;  1DAB A;  1BU9 A;  1H6O A;  4KMO A;  2NZM A;  3LCA A;  2Y4T A;  2BM6 A;  3IV0 A;  3HVE B;  3EDT B;  5T3R A;  3DRA A;  2IO2 C;  2KZT B;  4E6H A;  3Q78 A;  2OCC E;  1N52 A;  3TXN A;  2NYJ A;  2I9C A;  3OXL A;  3W9G A;  1N4S A;  2XPI A;  5J90 A;  1O8E A;  5KJL A;  2H6H A;  3CGH A;  3EJN A;  4BSZ B;  4K0R A;  1SZA A;  1OGO X;  4UQZ A;  2P9N G;  2DZN A;  5JJ6 A;  4ILI A;  2XPY A;  3ZNG A;  4OVV A;  3G2V A;  2HYZ A;  1H2T C;  4GYY A;  3ZHE B;  1BN8 A;  1YCS B;  2WXL A;  3DPD A;  2J8S D;  3PS6 A;  4UWL A;  4F1P A;  3T8M A;  1TNO A;  3B13 A;  3EHN A;  2R03 A;  3ML8 A;  3AK5 A;  4Q69 A;  2Y0B G;  1TYU A;  3NB2 A;  1KZO A;  2E0I A;  2P9U G;  4FUL A;  3C98 A;  4E85 A;  3ZW3 A;  4GCO A;  2EIK E;  2WXH A;  1N11 A;  4YZA A;  2BF0 X;  1N4Q A;  5AN8 A;  3CIA A;  1E8Y A;  4I1O B;  4O6F A;  2BED A;  4MBG A;  1OFD A;  3QJZ A;  2H6F A;  2QXZ A;  4F6R D;  1PE9 A;  2BX6 A;  2IF4 A;  2A4Z A;  5H7P A;  2J09 A;  1O8J A;  4N3A A;  4J8D A;  4FAD A;  5CRU A;  2DVW A;  4YVO A;  3ML9 A;  2IJG X;  4L23 A;  4NK8 A;  2R02 A;  2FI7 A;  3L82 A;  2FO1 E;  4WWN A;  3V2X A;  3UUX A;  2V4H C;  1HZ4 A;  3O48 A;  2KCL A;  5BXU A;  2BM4 A;  1UW4 B;  3MA5 A;  1D8E A;  4I2Z A;  4EZL A;  4JVS A;  5AEN A;  1O8F A;  4IUL A;  4KVM A;  3B8Y A;  5LCW J;  3SFX A;  3QWP A;  3B7T A;  4LSZ E;  4L1B A;  3IXE A;  4XLH A;  2VJ8 A;  3FH8 A;  2B6C A;  3RU0 A;  4TUU A;  4I17 A;  5AQB A;  4JHK A;  2DZO A;  3FU5 A;  1NFI E;  3ESK A;  4D10 C;  1OFE A;  5FIO A;  3HXF A;  2UWJ G;  4AVZ A;  1AWC B;  1TN8 A;  2BUG A;  3FU6 A;  1TNB A;  2QYU A;  1H6K A;  2P9K G;  2IOS A;  5FWQ A;  2DCP A;  4TXR A;  1TJC A;  3PVL A;  5HKP A;  1OCO E;  1Z3Y A;  4GZD A;  3CQG B;  4N5C A;  1TR4 A;  1KCD A;  2V5I A;  1KT1 A;  4OAU C;  1VBL A;  2WB2 A;  4U0Z A;  3HYM B;  2W7Z A;  3NBN B;  1SW6 A;  3TWS A;  4YZ0 A;  2ILR A;  3ABL E;  3S7J A;  4JPS A;  2R5S A;  1O88 A;  2XZD G;  4Y6C A;  1QRC A;  4C0M A;  5DIZ A;  4KVO A;  2X6X A;  2J4B A;  3QOU A;  2P9L G;  3CVY A;  2P9I G;  3ASO E;  4TUM A;  2WQH A;  4WAF A;  5FT9 A;  3GQA A;  2LUH A;  3MYV A;  5BNW A;  2XEN A;  2J8I A;  2O04 A;  3Q47 B;  5EYL A;  3KAE A;  1HS6 A;  4J6I A;  4BX8 A;  4URK A;  3NOG D;  3CK8 A;  1KT0 A;  3B7B A;  2O17 A;  3LMW A;  4U63 A;  3L54 A;  3LJN A;  2Y4U A;  2X6F A;  3DEO A;  1IDJ A;  4NAC A;  3GRH A;  4I6J A;  3PZ1 A;  3J5Q B;  4KH3 A;  3AS4 A;  2G0Y A;  3CLJ A;  1TYQ G;  3FUD A;  2O0W A;  5JMN D;  1DCQ A;  2GW1 A;  3N90 A;  1LF8 A;  2RFA A;  3QNK A;  3CVU A;  4JA7 A;  5E76 A;  4I1M A;  4XLF A;  1O8L A;  1N9A A;  1NHC A;  4ANW A;  2WXF A;  2VGX A;  5FQ7 A;  4K5A B;  2CHX A;  3U66 A;  4XL9 A;  3C3Q A;  4KXK B;  1CZF A;  3RAU A;  4O1P A;  4OJ6 A;  2DIW A;  2JEK A;  1E7U A;  4ATZ D;  1WAO 1;  3DPY A;  3I4R B;  3OXF A;  3E37 A;  3JCK C;  4HLE A;  2XZT G;  3N71 A;  3TG5 A;  5JMC B;  3Q7F A;  3RIQ A;  3L22 A;  5D66 A;  1QQE A;  4CT4 A;  5EN5 D;  4ILG A;  4PUC A;  2XTX A;  1AIR A;  3FTU A;  4XOT A;  2M63 A;  2RFM A;  3GZ2 A;  1UN9 A;  2ZGD A;  3EQO A;  4FJZ A;  3OTN A;  4NUR A;  3ZXP A;  1O1R A;  3QWV A;  3NZS A;  2R59 A;  1S70 B;  3DSX A;  5AYW D;  4U96 D;  2IOU G;  2X3H A;  3JQ0 A;  5ITZ F;  3G2S A;  3CHM A;  2A5E A;  1WMR A;  3UW0 A;  1K3Z D;  2WMO A;  3FU3 A;  3DSW A;  3U64 A;  4UUC A;  3FUI A;  2X6H A;  3FUJ A;  1TYX A;  3DST A;  1OWN A;  3RRU A;  4APO A;  4Y6W A;  3LJ3 A;  2BSP A;  2GGF A;  3C3R A;  2NTQ A;  3CK7 A;  3LVQ E;  4XM3 A;  3S7D A;  4XN3 A;  4UQY A;  2L0T B;  2VFM A;  3ULY A;  3QK0 A;  4AJW A;  1K4Z A;  4H7Y A;  4XZ4 A;  3SGH A;  5C2Y A;  3H09 A;  4W8T A;  3VLF A;  3UT7 A;  2PNN A;  3DSV A;  1OCZ E;  3T5V A;  1N4R A;  1O8I A;  1Z3X A;  3URZ A;  4U95 D;  5B1A E;  5G2N A;  1JWG A;  3B7S A;  2VBK A;  3ZN3 A;  5G05 C;  2L6J A;  5FZS A;  5C1D A;  4YDO A;  2VSO E;  5C1E A;  2UY1 B;  4J8S A;  1B89 A;  5HRY A;  3UXG A;  4WND A;  3U4T A;  1MZC A;  4GZ6 A;  5DBK A;  1HF2 A;  3ZUV B;  4AY5 A;  3UKU G;  1QCX A;  3FUL A;  4A3T A;  3MJW A;  4JHJ A;  3FTZ A;  4LRZ A;  1EE6 A;  4BT8 A;  3B7R L;  3LYA A;  4HXI A;  4ZHB A;  1N94 A;  3MGB A;  1HFA A;  3TG4 A;  1N0Q A;  1K5C A;  1OWM A;  3CKC A;  3UQ3 A;  4U04 A;  3ZRH A;  4MXN A;  4HRL A;  2LO6 A;  1DCE A;  1IHG A;  3HXD A;  3L6A A;  3AG3 E;  4G26 A;  4UI9 C;  1MYO A;  4J0U A;  5CBN A;  4OAV B;  2L9B A;  3SY2 A;  3RRM B;  1MJ0 A;  1U2V G;  3L16 A;  4HOS A;  1IKN D;  3MZL B;  4CGV A;  1TYV A;  4HI9 A;  5JJT A;  4MR0 A;  4LEU A;  5KJK A;  2OEW A;  4YZX A;  1N95 A;  1VDY A;  2RD0 A;  1DVP A;  4HS2 A;  1K8F A;  1TNY A;  2Z8G A;  2XEV A;  3SZ7 A;  3F6Q A;  2INV A;  3ZGQ A;  4W8S A;  4Q94 A;  3RJV A;  3ESL A;  3E32 A;  3ASG A;  2ZU6 B;  3AS8 A;  4FP7 A;  3FUH A;  3LVR E;  3JUI A;  2C0L A;  4PS8 A;  2B0R A;  3PE3 A;  2VBE A;  3GQ9 A;  5ENT D;  1QYM A;  4PDX A;  5CED B;  4H7X A;  3ASF A;  4ANV A;  3VSV A;  1TN7 A;  1DC2 A;  1NA0 A;  5AJL A;  1SVX A;  5FZQ A;  5AQ7 A;  3AG4 E;  3CVQ A;  3CHQ A;  3FHE A;  4BES A;  3RRN B;  3UIO C;  3ZPJ A;  5FJY A;  3GQ8 A;  2XCB A;  3RO3 A;  3UI2 A;  3V79 K;  2AWI A;  1OFM A;  4MLP A;  4GA1 A;  2ETA A;  3ZU7 B;  1JUQ A;  2XCC A;  5KJN A;  4J7W A;  4RSY A;  3LJY A;  1BI8 B;  4GTQ A;  4CYM D;  4XEI G;  4Z03 A;  3Q9U C;  2R05 A;  4KZC A;  4WNF A;  4XX5 A;  4C0E A;  5J08 A;  1K8K G;  1Y8M A;  3TGO A;  3JX8 A;  2XS1 A;  2VTB B;  1HG2 A;  2PQR A;  4DI4 A;  4G11 A;  3R7Q A;  2NC9 A;  2P58 C;  3AAA C;  2NTP A;  4RVB A;  1OGM X;  2P9P G;  2VSX E;  2E2E A;  3S7F A;  1RW2 A;  3PDN A;  3CR3 A;  2WQ7 A;  2NST A;  4F3V A;  3JYS A;  4RG9 A;  2ODL A;  2IFU A;  2ZXW E;  1S0P A;  5G04 C;  1XG2 A;  5CBO A;  4Z05 A;  2RKK A;  4LG6 A;  1A5E A;  5LCW C;  1EDU A;  2QY1 A;  3PRE A;  3R9A B;  2LXL A;  3KRG A;  3PH0 C;  2J07 A;  1PAQ A;  2O1D A;  3QB2 A;  5B1B E;  3SFY A;  3FUE A;  2EQX A;  5KWD A;  4XR6 A;  5AQ9 A;  3EIQ C;  2XGM A;  2F8X K;  4JB8 P;  4XLA A;  5D0Q D;  3AG1 E;  3TWT A;  3PUJ A;  4GZ5 A;  3ZKJ A;  1H19 A;  2UVE A;  3HRA A;  4YEJ A;  3ZYL A;  4TRQ A;  4DPR A;  2Y69 E;  4YCQ A;  5B3S E;  4J8E A;  2WXI A;  4WNE A;  4V02 C;  4PMH A;  1TN6 A;  5C1C A;  3Q4A B;  3MEK A;  4DUI A;  3UTM A;  3ZFW A;  4U8V D;  4HB5 A;  3ULE G;  4WNG A;  3BEE A;  1LD7 A;  4OM9 A;  1FVH A;  4HQD A;  1TYW A;  2XT2 A;  4XN0 A;  3IHY A;  1SA4 A;  1CLW A;  5E75 A;  1QQ1 A;  1KLX A;  4GMJ A;  2I2O A;  1N0R A;  1GW6 A;  3NZU A;  3AG2 E;  5HQ8 A;  2KZT A;  1K1A A;  1FCH A;  4RQI A;  3Q5M A;  5ARG A;  4ANU A;  4LCT A;  3LKU A;  1BD8 A;  2XGO A;  5ENP D;  2LAH A;  3C3O A;  4HFG A;  1JCR A;  3UX4 A;  5ANL A;  3WG7 E;  2LSU A;  1OXJ A;  3FP3 A;  5BW8 C;  3JUE A;  2ETC A;  3DEP A;  4JHR A;  4OZZ A;  2F8Y A;  4YEL A;  1OFL A;  4GTP A;  1JTA A;  4JRA C;  4I9C A;  5EIB E;  1RWR A;  2NSZ A;  5KBA A;  5HI7 A;  1HH8 A;  4G8L A;  3B95 A;  1EF1 C;  2F37 A;  4AVX A;  4GYW A;  1RZ4 A;  3DWL G;  2WPV A;  3SO8 A;  2Y1L E;  3TWU A;  4DRX E;  3HXC A;  3K9I A;  2VGE A;  1MHQ A;  4XKW A;  3X2Q E;  1QA1 A;  1U3C A;  2INU A;  3U3W A;  5T4Y A;  4LNG A;  1LTX A;  5EDS A;  2VTB A;  3Q9N C;  4GCN A;  3GQ7 A;  4YC5 A;  3VST A;  1H80 A;  4L9P A;  1BPO A;  2XGS A;  3LPZ A;  1NI1 A;  4JA9 A;  5LP0 A;  2WXG A;  4Z68 A;  3OXG A;  4JC8 A;  5KCM A;  2KCK A;  4AIF A;  5BPP A;  1OWL A;  5KNH D;  4B93 B;  4ANX A;  2R2L A;  1KTW A;  3MV2 B;  2X6J A;  5AAR A;  2NXP A;  3CHR A;  3ASD A;  4JL0 A;  3L9T A;  4B8A A;  3RKV A;  1QNF A;  5JHA A;  3V30 A;  3LY7 A;  2BM5 A;  3EHR A;  3JXI A;  5LOZ A;  3TWQ A;  3MX3 A;  5ENS D;  5EKQ D;  1O5M A;  3HXB A;  1E8W A;  3FUF A;  4XLE A;  4QQI A;  3D9H A;  4JW1 A;  4N39 A;  5AJD A;  4DLQ A;  2F0Y A;  3KSQ A;  2X6I A;  4LER A;  3SBS A;  4I2W A;  3CV0 A;  3ENE A;  3SFZ A;  4XKC A;  3FUM A;  4GZ3 A;  1OCR E;  3CVW A;  3N6Z A;  5FZR A;  2GRQ B;  2CFU A;  2J08 A;  4F53 A;  2MRI A;  1KQ5 A;  3PRZ A;  5CER B;  2YUH A;  3HG0 D;  3UM0 A;  2DWZ A;  5FQ8 A;  3GYZ A;  3D3M A;  3FH7 A;  2XTW A;  3RO2 A;  2WXJ A;  4G25 A;  2QYJ A;  4FJY A;  4AY6 A;  3HVE A;  2NTB A;  1L1I A;  1X0C A;  4QFV A;  4PS3 A;  2F3L A;  3QKY A;  1MQS A;  3ZHE A;  3FU0 A;  3KSL A;  2AW6 A;  3Q79 A;  4ATG A;  1PLU A;  4B89 A;  2FEZ A;  3UM1 A;  4JEH A;  4XNF A;  2VFO A;  3AJI A;  1GQ8 A;  4YDW A;  3C5R A;  1S64 A;  2KBX A;  1PY1 A;  4Z06 A;  1PC2 A;  3U9W A;  4AP2 A;  1BI7 B;  2FO7 A;  4G24 A;  2YHC A;  4KBQ A;  2MYO A;  1XGW A;  2YQ8 A;  3MKQ B;  1E90 A;  1KPS B;  3CKB A;  4HI8 A;  1RMG A;  3Q75 A;  1TEZ A;  1IB4 A;  1LLZ A;  2PZI A;  4GA2 A;  2QY7 A;  3EHM A;  2ION A;  4AV7 A;  3I4G A;  2WXP A;  2VFP A;  1H2U A;  1HXI A;  4G23 A;  4EZK A;  4U4B A;  2BM7 A;  3LY9 A;  2WXQ A;  1JCS A;  3FUK A;  3NF1 A;  2JAB A;  1L5J A;  2HE0 A;  1MX6 A;  5CMW A;  4XON A;  2I1K A;  5HS0 A;  4I6E A;  4GTS A;  2JLB A;  3ZEF A;  4MKT A;  3TWR A;  4A55 A;  3TJP A;  3BG0 B;  5CCM A;  4G8K A;  3G2T A;  4Q96 A;  4DX2 A;  3PZ4 A;  1YYH A;  4F7A A;  5CCL A;  2CG2 A;  4UWK A;  2XC1 A;  3Q73 A;  4A1G A;  5AQA A;  2CG3 A;  4A3V A;  2L6B A;  4MRU A;  5FQ4 A;  4UWH A;  2IOL A;  3RIB A;  2IY0 C;  1HG5 A;  4CGW A;  4DX1 A;  3DSU A;  2AJA A;  4JXT A;  2J9Q A;  1OCC E;  4UWF A;  4DI3 A;  4YDT A;  1UN8 A;  4A1S A;  1PXZ A;  3CVV A;  4O60 A;  3ONK A;  4GTM A;  4A63 B;  3BUA A;  1QRB A;  1QA3 A;  2WXM A;  3EHQ A;  4L7T A;  2WQ6 A;  3UM2 A;  1NZN A;  2IQC A;  3QDN A;  1O8H A;  3ZSC A;  5JLV C;  1V55 E;  3PET A;  3EUV A;  3IKO B;  5FIN A;  3IHV A;  1K1B A;  5ANR A;  4YDY A;  3FY3 A;  2KAT A;  5FTP A;  3EIJ A;  4MS6 A;  1X81 A;  4NRH B;  3CEQ A;  4I43 A;  3ZXS A;  1O8K A;  2WXO A;  4C9B B;  4OYS A;  2VFQ A;  2WXR A;  5G55 A;  3D9L A;  3B4N A;  2KXP C;  2X6W A;  2ZGG A;  4YFO A;  3S7B A;  4CDN A;  4C2L A;  3SZE A;  3TL5 A;  1EYH A;  1O1S A;  4M7C A;  3D9K A;  3PNL B;  2NSP A;  1SA5 A;  4OJP A;  2R17 C;  4NIK A;  4XI0 A;  3CVX A;  5CEA A;  5BV0 A;  2VQ2 A;  3PEU B;  5DNS A;  4IYP A;  5IY5 E;  3R7R A;  3HHM A;  5KNG A;  5LX8 A;  1O1T A;  4BT9 A;  3TH0 A;  2PQN A;  2ZIS A;  3LXU X;  2OEV A;  3ISM C;  3QAQ A;  2L0I A;  3UT8 A;  3DXM G;  5G05 J;  1ZU2 A;  2X3M A;  4X8Q A;  4HOU A;  4LNU D;  3ABK E;  1ZBP A;  2ETB A;  5A6C A;  3PSZ A;  4WUY A;  1YA0 A;  3WWG A;  2O6W A;  3PSS A;  4EW9 A;  5CHE E;  3UM3 A;  4LNB A;  2QZA A;  4GMR A;  3FEY A;  3SF4 A;  4U7E B;  1S63 A;  3Q15 A;  1EZG A;  1DBO A;  2MHK A;  3P4G A;  2PEC A;  1HG8 A;  1P5Q A;  4RLY A;  2VGY A;  3P1U A;  4GTO A;  1ELK A;  1X5B A;  3S2A A;  2X6K A;  2KC7 A;  2V0P A;  2XS8 A;  3T5X A;  4PH4 B;  3ABM E;  4U0S A;  3SBT B;  3BH6 B;  3CHO A;  2QX3 A;  3QC1 A;  2I6H A;  3VLD A;  3ML3 A;  3ZYQ A;  4FU3 A;  2YIN A;  2AVP A;  3ZVV A;  2OVB A;  1QZ2 A;  4UQX A;  3TXM A;  3FTV A;  4DLO A;  4YVQ C;  2XRZ A;  4YND A;  4XOR A;  3ULQ A;  3Q49 B;  4HRN A;  4TXP A;  1E8Z A;  1D8D A;  4XQF A;  3CVL A;  3LDZ A;  2AXV A;  2GRR B;  3UIP C;  1V54 E;  2CHZ A;  4F1S A;  4XOP A;  4EEC A;  4L2Y A;  1EA0 A;  3RSE G;  4W8R A;  4ME2 A;  1OWP A;  2EIL E;  5AAO A;  3RK6 A;  1WXR A;  1OY3 D;  1YMP A;  1JCQ A;  1LLW A;  4OZY A;  3PE4 A;  1TNU A;  4HLL A;  1FT1 A;  1ELR A;  4CZ2 D;  3FEX A;  4N3B A;  4W9R A;  4B8C B;  2XRY A;  2UVF A;  4KZ0 A;  2OVF A;  3SHF A;  3TWX A;  2VJI A;  4U0U A;  1SZ9 A;  1WY6 A;  1HX8 A;  1IHB A;  3UIN C;  4KT6 B;  2P9S G;  3FTY A;  3R9M A;  4B94 A;  1E8X A;  2V5Q C;  4EBA G;  5JHB A;  3E33 A;  1JRG A;  3MV3 B;  3TWV A;  4GYO A;  3QAR A;  1UOH A;  4HBD A;  2XHE A;  4EPZ A;  1TNZ A;  3E34 A;  3L08 A;  1ELW A;  4FLB A;  1TSP A;  1FPP A;  2Q7F A;  4CRW A;  2J8K A;  2OV8 A;  3PUK A;  2QFC A;  2MOW A;  4XLC A;  2A5U A;  5FQ6 A;  3D9I A;  2CHW A;  1E96 B;  3I3N A;  4BER A;  3MCX A;  3LYC A;  2DBA A;  5JA4 D;  2PM6 A;  3FWV A;  4GAA A;  4JZY A;  4OJO A;  3EU9 A;  3KEZ A;  4I6G A;  2UY1 A;  4JEU A;  4EHM A;  4C48 B;  3AU4 A;  2EIJ E;  3CHP A;  2NT9 A;  3FTW A;  2EIN E;  3VTX A;  4WWP A;  4AXH A;  1QBQ A;  2VSN A;  2PM7 A;  1H0A A;  3CST A;  2V8S E;  2VYI A;  1LM1 A;  3L13 A;  3T9K A;  3UMV A;  2WXN A;  1FVF A;  2P2C P;  4EZJ A;  3W9F A;  4CCA A;  4RG6 A;  3CVN A;  2QC9 A;  3APC A;  4W8Q A;  3WXX A;  4IN3 B;  2GRO B;  1UJK A;  1EPU A;  2DYR E;  4HOQ A;  5ENR D;  2EWE A;  4BTA A;  4FHK A;  4LUN U;  1RU4 A;  4OJ5 A;  1SQM A;  3O4Z A;  1W3B A;  4XKV A;  1O8D A;  4I84 A;  1U3D A;  4CDR A;  5KJM A;  3BH7 B;  3DBS A;  1UG3 A;  2IU1 A;  2BKG A;  3FTX A;  2VBM A;  3Q7A A;  4K03 A;  4FA6 A;  3NOC D;  3CVP A;  4UI9 K;  1OT8 A;  4GA0 A;  5BUZ A;  1OWO A;  4GPK A;  2V4L A;  3D9M A;  1Z6T A;  3P2B A;  2B0O E;  1INZ A;  2Y3A A;  4N5Q A;  5EIL A;  5ENQ D;  1E7V A;  3I5P A;  3L17 A;  3E30 A;  1A17 A;  4BET A;  4ABN A;  4BSX A;  5EYP F;  1ZB1 A;  3GZ1 A;  2GRL A;  5D0O D;  5CRV A;  5A23 A;  2DYS E;  4GML A;  2X85 A;  3KEA A;  2WVI A;  4BY6 A;  2XTY A;  4U49 A;  3IBE A;  3FH5 A;  3KS2 A;  4GU5 A;  1NA3 A;  3B7U X;  3NAW A;  3GZS A;  1G3N B;  3OAW A;  3HIZ A;  3PZD A;  3PZ2 A;  4G1T A;  3T8K A;  4GPM A;  4I9E A;  5CEC B;  4B0Z A;  3VMW A;  1H2V C;  5BT1 A;  1N4P A;  4DX7 D;  3FY4 A;  3D9J A;  1UJJ A;  5A7D B;  3ZPP A;  1HU3 A;  4N3C A;  4BTB A;  4BFR A;  2H6G A;  1H6P A;  2CFZ A;  3APF A;  5EX0 A;  2XT4 A;  4JD2 G;  3J5P A;  4HOR A;  1O8M A;  3CK9 A;  1Z5S C;  5BV1 A;  5EX3 A;  2C2L A;  2LXM A;  1QJV A;  3ASN E;  1IA5 A;  4OVU A;  4OJL A;  4P29 A;  2RG8 A;  3LEW A;  1NP7 A;  1BLX B;  3PEV B;  2HM8 A;  2PL2 A;  3G2U A;  3LY8 A;  4XE0 A;  4TXQ A;  4GTV A;  4GZC A;  2WXK A;  3FUN A;  3AS5 A; 
#chains in the Genus database with same CATH homology
 3SY2 A;  3PSZ A;  2O6W A;  2XT2 A;  3SQV A;  3NAW A;  3PSS A;  5DNS A;  4YC5 A;  2XTW A;  3NB2 A;  4YEI A;  2QZA A;  3DU1 X;  2XTX A;  4YDT A;  4YCQ A;  2QYU A;  4YFO A;  2J8K A;  2XT4 A;  2XTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...