3SQVA

Crystal structure of e. coli o157:h7 e3 ubiquitin ligase, nlel, with a human e2, ubch7
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
612
structure length
606
Chain Sequence
QGRACLSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGCTAVLTDMLTEHAKESFPEIFSLYYPVAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of two bacterial HECT-like E3 ligases in complex with a human E2 reveal atomic details of pathogen-host interactions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase/signaling protein
molecule keywords secreted effector protein
total genus 166
structure length 606
sequence length 612
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13979 SopA_C SopA-like catalytic domain
A PF13981 SopA SopA-like central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4140.10 Mainly Alpha Orthogonal Bundle effector protein (NleL) fold effector protein (NleL) 3sqvA04
1.25.40.300 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Putative secreted effector protein 3sqvA02
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3sqvA01
3.40.1850.10 Alpha Beta 3-Layer(aba) Sandwich HECT-like ubiquitin ligase fold HECT-like ubiquitin ligase 3sqvA03
3PSZA 3NAWA 3SQVA 3PSSA 2QZAA 3DU1X 2XTXA 2O6WA 3SY2A 5DNSA 2QYUA 4YEIA 2XTYA 2XT2A 3NB2A 4YC5A 2XTWA 4YCQA 4YDTA 2J8KA 2XT4A 4YFOA
chains in the Genus database with same CATH superfamily
3WG7E 2XHEA 4ANVA 4TXQA 1N0QA 2XS8A 3LJ3A 2R2LA 2B0OE 3HXFA 4CCAA 4WNFA 3JXJA 4PS3A 5M72A 4OPWA 3ZGQA 3Q79A 1JPLA 4FC8A 3RSEG 5T4YA 3TWQA 1LLWA 5KNHD 4UI9C 3VTYA 4HORA 3N90A 3FULA 2V4HC 2XT4A 3FP3A 2X38A 3L16A 2WVIA 1S64A 3UT8A 1VBLA 2WPVA 3ZN3A 1TNYA 1N9AA 2P2CP 4BX8A 4HXIA 3LCAA 1OOCA 1KPSB 4YC5A 5EN5D 4Z68A 3CLJA 1FT1A 5AENA 3Q78A 5HQ8A 4XOTA 4GPKA 1GQ8A 4G25A 2R02A 4FULA 4GZ5A 4HNAD 4WUYA 3MJWA 3R9MA 1HZ4A 1H19A 3APFA 4ATGA 2M63A 4KVMA 1YMPA 1O1RA 1ZB1A 3EHMA 4XKCA 4U0UA 3WXXA 4FLBA 2HYZA 4WWOA 2EILE 4EQFA 3LJNA 1W3BA 3TG5A 1A5EA 2F0YA 2EQXA 2VJ8A 1QA2A 4GTMA 1WAO1 4NK8A 1KT0A 1JCSA 1HH8A 4ACKA 4RSYA 4HRNA 4LG6A 2WXIA 4TV3A 3N71A 5ENOD 4YFOA 3QARA 1FVFA 3PSZA 4AY6A 3NOGD 4B89A 2P9SG 1TYWA 4BWRA 2I6HA 3W9GA 2VBKA 5CCMA 4FHKA 4J7WA 2WMOA 2WM9A 4F3VA 3JUIA 4F7AA 1JUQA 1MHQA 4U0ZA 3ZXSA 2XGMA 1OT8A 4GTSA 2UY1B 5ENQD 4EZJA 1LD8A 4WNDA 4RLYA 3QWPA 4GTOA 1TNZA 4BERA 3PZDA 1KTWA 2RFAA 4OAUC 4P29A 5B1BE 4TUUA 3RK6A 2IU1A 3CVLA 4GB9A 2CG2A 3AAAC 2L0IA 3SF4A 2E2EA 3DSTA 4TXRA 4I1AA 5G05C 3SD5A 4AVXA 5AQ9A 2IEJA 3FUNA 3TL5A 3DSSA 3H09A 3QJZA 4OVVA 1PAQA 5JMND 2IY0C 1O8DA 1ZU2A 2EINE 2I1KA 3ASOE 3LJYA 2IOUG 1OFEA 3B4NA 3ZIMA 3PE4A 4XLFA 2WB2A 2V5FA 1PLUA 2PL2A 1Y8MA 3ZNGA 3IBEA 3CSTA 4HLLA 3FU3A 4HBDA 4LNUD 3UTMA 3VSVA 4HQDA 4GPMA 1HG2A 4FP7A 2UVFA 1CLWA 2Y1LE 3HRAA 4G8LA 2INVA 4DX6D 4N39A 3L13A 5AQBA 4ACLA 4AOFA 3CVXA 4U63A 3AS8A 3ISMC 3QNKA 2R59A 1S63A 3ABME 5AMVA 2CG3A 1KCCA 1LTXA 1D8DA 2NSZA 3EHRA 2VSXE 3UKRG 3T9KA 1Z5SC 2ETAA 3U64A 4GTPA 4L23A 1BHEA 4HVBA 2PYGA 2QFCA 3HXDA 5FWQA 2P9IG 4L2LA 1O8JA 5KJMA 2GW1A 1IQUA 3CR3A 4BX9A 3EIJA 3BH7B 1E90A 3FH7A 1WG0A 2FO7A 2XGOA 2FBNA 4IN3B 4YNDA 1HU3A 4J8DA 1QCXA 2VJJA 4TXPA 2CHXA 3JUEA 1BU9A 1N54A 4GZCA 3ZYLA 4C48B 3ULEG 2AW6A 2C0LA 3ZHEB 1ZBPA 4EZLA 1OUVA 4XLEA 3TWSA 4WWPA 5FQ8A 3DEPA 4EBAG 3CVUA 3O48A 4FLHA 3B8YA 4F6RD 2X3MA 2KC7A 2Y4TA 4UWKA 2WXFA 4CGWA 4Y6CA 3P4GA 3T5XA 2XCCA 2IO2C 3L54A 4YCQA 4UWGA 4Z05A 3RRNB 4U95D 3IEGA 2IONA 2AVPA 2PM7A 1NFIE 1NA3A 1IDJA 4U8YD 2VFOA 2BM5A 3R7QA 2YQ8A 3Q4AB 3NB2A 3D9HA 3ASDA 3FUMA 3L82A 3GQ9A 3TXMA 1N4SA 5AARA 1OXJA 4U8HA 1TEZA 2R05A 3GRHA 5JJ6A 1O8IA 3PEVB 2VFPA 5D0QD 3OXFA 4LEUA 4ANWA 4WAFA 2XQ0A 4B94A 4YELA 4A63B 2LAHA 3GZ1A 5AQ7A 1H6KA 5AN8A 3ZHEA 5HKPA 1INZA 3ZUVB 2EIME 4JEHA 4LERA 2R17C 4W8SA 1O5MA 1RWRA 2KXPC 4U0SA 4O6FA 2LXLA 1A17A 4PDXA 3DU1X 1O1TA 2QY1A 3HXEA 2NT9A 5KNGA 2PQNA 2YINA 4OM9A 2ZGDA 4W8QA 1K1AA 3FTSA 3NOCD 4H7XA 2EIKE 2J07A 4HLEA 2P9UG 3UIOC 4BT8A 2DBAA 4GTRA 2PECA 4LSZE 5E75A 1FPPA 4GA2A 3W9FA 4XI0A 1EF1C 3CQGB 1JCQA 5FZSA 3PZ1A 4DX7D 1HX8A 3UM1A 3PZ3A 1RMGA 4K5CA 5ENNA 4PMHA 1HS6A 2VSOE 5BV0A 3P2BA 4XONA 4O60A 3IKOB 4LRZA 5D0OD 3Q73A 4GU5A 4U4BA 3MZLB 2O04A 4GAAA 3EQNA 4XIFA 3CQCB 2I9CA 3CK7A 4KBQA 5LX8A 1RU4A 1E7VA 3B7RL 4PS8A 2LXMA 3U66A 2IF4A 4GA0A 1K3ZD 3J5QB 3Q9UC 2UY1A 1EYHA 4CYMD 4L7TA 3I3NA 4JHJA 1O8KA 2ETBA 3SNXA 1OCCE 3BU8A 1JRGA 4A1SA 3FDHA 2CHWA 4EHMA 1JTAA 5CEDB 2WXOA 1SZ9A 4JEUA 3ESLA 5LFAA 1QBQA 5EYPF 2X3HA 2Y69E 2PZIA 2ILRA 5LOZA 2DYRE 2LAIA 4FHJA 1OY3D 1E7UA 3FY3A 1MZCA 4EPZA 3SFYA 3QKYA 1JWGA 4OZZA 3DEOA 4CDRA 4DI3A 2PNNA 1TYVA 2YHCA 5CHEE 3DSXA 4QQIA 4CDNA 4V3IA 4FJYA 4JC8A 4YVOA 3VLDA 3KSQA 1PXZA 5FJYA 3MKQA 3V79K 3RRUA 1AIRA 3IV0A 4DPRA 3B7SA 2H6GA 1S0PA 4GTTA 3L22A 2YHEA 2ZU6B 4KVOA 1IDKA 3B7BA 5BPPA 2GRNB 3DXMG 3S7BA 2LSUA 4CT4A 4O1OA 3B13A 3B7TA 5FT9A 3PNLB 3MV3B 4BTBA 2XC1A 4UWLA 3TXNA 3SUCA 2P9NG 1IHGA 4JA7A 4J8FA 4ABNA 3MYVA 3FEYA 3DSVA 2L6BA 3QK0A 3DPYA 3UW0A 5IY5E 3MEKA 4XN0A 3FFLA 3CVNA 2A5UA 3U9WA 3BG0B 2X6IA 3AK5A 5HI7A 4JPSA 3TWUA 2V5IA 5EIDA 3LDZA 4RQIA 4XLHA 2AJAA 2MYOA 3NBNB 2MRIA 3FH5A 1TJFA 2FEZA 3D9PA 3KEAA 4HOTA 4JB8P 1EA0A 5BXOA 4BEPA 4K0RA 1U3DA 2GRRB 4BT9A 3PUKA 4HOSA 5DIZA 4N5CA 3PVLA 4I6JA 3SZEA 1O8HA 2X6WA 1HFAA 2BX6A 3ZRHA 3S7DA 4G2VA 4N3BA 1AWCB 2WXMA 3LEWA 1TYUA 3KAEA 3CVQA 1NA0A 1UW4B 4XI9A 1TN6A 3MKQB 2XTWA 5ITZF 2RG8A 3AG4E 3IHYA 3QC1A 3CKBA 3LMWA 2HO1A 3LYCA 3T8MA 1N4PA 2J08A 1NL4A 4EBAA 2WQ7A 3NAWA 4OJ6A 1TN7A 3WWGA 3ML8A 3HXCA 3PUJA 4MS6A 4OYSA 3Q47B 2V5QC 4G8KA 2VBEA 1NZNA 1SA5A 2BKKB 2WXRA 3KEZA 4J0UA 2V8SE 3Q75A 2GRQB 3RIBA 4KYOB 2DWZA 3HXBA 2P9KG 2PM6A 4B0ZA 1L1IA 3LY9A 5C1CA 4CT0A 3PREA 4C0EA 3FUDA 1L5JA 4ANUA 3ZPPA 4OVUA 2X6XA 4YZ0A 2H6FA 2P9PG 3LXUX 1DCQA 3B90A 2OEWA 4GZDA 1N95A 5FTPA 1UG3A 3UM0A 4YEJA 4YDYA 4URRA 3L6AA 2QX3A 1Y6IA 1XNFA 4ZFHA 4B93B 3QOUA 4IRUA 4KZCA 4AIFA 1UOHA 1WMRA 3E30A 1HG5A 4J6IA 1B89A 2YNQA 5ARGA 1K1BA 3D9IA 1OCOE 4W9RA 4FU3A 3AJIA 1OCZE 3GQ8A 4G11A 4Y6WA 3SO8A 2ZIRA 2GROB 1SW6A 2XPYA 1OCRE 3TGOA 1LM1A 4LNBA 4JRAC 3DSWA 3SFZA 1X0CA 4NIKA 1PC2A 3Q9NC 4N5QA 3Q15A 4DLOA 1OFDA 3RJVA 3CK9A 2J8IA 2HR2A 2VTBA 2ZISA 1HF8A 5H7PA 3FU5A 2XEHA 2Q7FA 3APDA 4UI9K 1QA3A 3T8KA 3E37A 4Z03A 4TRQA 2DZNA 1MQSA 2Z8GA 3Q7AA 3CSFA 1YA0A 2GGFA 2F8YA 3VLFA 3J5PA 1O8LA 3ASFA 3G2VA 2XRYA 2JABA 1PY1A 2LNIA 2J4DA 5EX0A 4YDEA 3I4GA 4F1SA 3GZ2A 3CVWA 3Q49B 3CKCA 4O1PA 4N2SA 5LCWJ 3EHNA 4Z06A 4DX2A 3ML9A 5T8IA 1MX4A 2VTBB 4C0MA 2VGYA 3APCA 3LKUA 2DZOA 1QZ2A 1N4RA 2E0IA 2VYIA 4JW1A 3PS6A 4D10C 4TUMA 1E8YA 4HOQA 5C1EA 4JHRA 3VSUA 1X81A 4JXTA 3FUIA 1WDYA 2UWJG 1Z6TA 2QC9A 4ZHBA 2VFMA 3PEUB 1DC2A 5DNSA 1RW2A 2AXZA 4RVBA 3C3QA 4JD2G 4EW9A 3JQ0A 3JURA 4QFVA 1SZAA 4JVSA 4K5AB 4KZ0A 3Q7FA 3AG1E 3ZYQA 1PE9A 2WXNA 4XM3A 2WXGA 2EWEA 1V55E 4FJZA 3KSLA 2F8XK 2INUA 3FTUA 5T3RA 2NTQA 4OJLA 4MR0A 3P1UA 3FH8A 5ENRD 1KZOA 2XEEA 3D9KA 1AP7A 3FEXA 3UT7A 3GW4A 4I2ZA 1DBOA 3UXGA 2P9LG 1E8WA 4GTQA 3TWVA 4YEIA 3ULYA 5FZRA 1MX2A 4MBGA 4HI8A 5KWDA 1MX6A 2O1DA 5AIJA 2KCVA 1KLXA 4I9CA 1NHCA 3BEEA 1LLZA 2BUGA 2J49A 2VGXA 5A23A 3C3OA 1QA1A 1K5CA 1QRCA 1BN8A 1BD8A 1IYGA 3PDNA 4A3VA 3S2AA 5EX3A 4DI4A 3UT4A 2XT2A 3F6QA 5AAOA 3CVPA 5CRVA 1O8FA 1KT1A 3HYMB 1YYHA 5C2YA 2VQ2A 4E85A 4BESA 3KS2A 5C1DA 3HIZA 3V30A 2OCCE 2L9BA 4ANXA 3B95A 4W8RA 4U8VD 2OVFA 4LUNU 3SZ7A 3HG0D 4U49A 1OGOX 1H80A 3ML3A 5ENSD 4XMYA 3UMVA 2PYHA 2XZTG 3S7FA 4OZYA 3CV0A 4EECA 2LO6A 3ZKJA 4GZ3A 3SQVA 2FF4A 4DLQA 1TNBA 1H2UA 1N0RA 5LCWC 4YDOA 3MCXA 5KBAA 4HS2A 1KZPA 1JWFA 3DRAA 4XLAA 3CHOA 4XE0A 2KATA 1E8ZA 5JHBA 3RO2A 4AM9A 2VSYA 5JHAA 3ESKA 1O8MA 1DNPA 4J8YA 3MKRA 3ASGA 4MXNA 3HDXA 4UQZA 4GCNA 5CMYA 3FUKA 4CDMA 2CFZA 1HE8A 1ELRA 3SI5A 2I1JA 4XQFA 4WWNA 4LNGA 4YZQA 3TH0A 3UIPC 1HXIA 3EDTB 1DVPA 2ZXWE 4A55A 3FWVA 4I17A 3UKUG 1IXVA 2KZTB 2IJGX 1HO8A 4GMJA 3JYSA 4FADA 3ZEFA 3E4BA 1UN9A 3AG3E 3ONLA 3PE3A 2XPZA 1K8FA 4YZAA 3DPDA 4BY6A 1S70B 5KJKA 4G23A 4I43A 1D9SA 1O1SA 4GYYA 2X6KA 2J09A 2C2LA 1MJ0A 3EQOA 1XGWA 1UN8A 2WXJA 2XTYA 1BI7B 4XNFA 4F53A 1ELKA 2WMNA 2VGXB 2NZMA 3LY8A 2HM8A 1FCHA 3AS5A 3CHPA 3URZA 4Q96A 1OFLA 1H2VC 2KBXA 2BM7A 2J9QA 4XKWA 1NI1A 4U96D 3UPVA 3CHRA 4K03A 4J8EA 3NZUA 1EDUA 3K9IA 4HRMB 3V2XA 2NTBA 3FHEA 2G0YA 3G2UA 3D9MA 4XN3A 2X6FA 4NACA 4XKBA 3JX8A 3PSSA 2RD0A 5D2MC 4X8QA 5A6CA 2DVWA 4I84A 5ARFA 2YUHA 4XLCA 1V54E 3TWWA 1Z3XA 2WXPA 2R5SA 3PETA 2IQCA 1SVXA 3RIQA 1ELWA 3MGBA 3ABKE 3U3WA 4PS7A 3PZ4A 4C2LA 2EIJE 3UQ3A 4HB5A 2OVBA 1TR4A 2JLBA 1TYQG 3C72A 1IHBA 3UINC 2DIWA 3RU0A 3T9GA 3L17A 4XL9A 5B1AE 3NQPA 5CRUA 4XX5A 1EE6A 2IQ7A 4BTAA 3ZYKA 5A7DB 4J8SA 2J8SD 2X6HA 2GRPB 1O8EA 5FQ6A 4XEIG 3ABLE 3FTXA 2ODLA 2XEVA 1N52A 4AEZC 3LVRE 3EUVA 4XORA 2ZGGA 2V4LA 3TWXA 4GA1A 5CECB 4NURA 4HRLA 5AQAA 5BUZA 5JMCB 4UUCA 5J08A 3G2TA 3C3RA 4HI9A 4M3OA 1OWLA 2DYSE 3MV2B 4RG6A 5BV1A 2OEVA 3EU5A 2CFUA 3LPZA 4ILHB 2BM6A 3HHMA 3DBSA 5G05J 1KQ5A 4KMOA 2KCKA 4WNEA 4GMRA 5BW8C 5CBOA 1FVHA 5KCMA 1EZGA 4APFA 2A4ZA 2XS1A 2BKGA 3QDNA 2UVEA 2WQ6A 3SHFA 3AU5A 3GYZA 1OGMX 1Q2ZA 1UJKA 4AXHA 5ENPD 4XKVA 3EIQC 3R7RA 3C98A 1TYXA 3SYJA 4IULA 3QB2A 4N3CA 4AJWA 2MOWA 4UI9J 3GQ7A 4HFGA 3CHQA 4UQYA 3HVEA 4GZ6A 4NK6A 4C9BB 3CHMA 4KT6B 1TN8A 3ZU7B 4PUCA 3IXEA 5HS0A 2WQHA 4UQXA 3U4TA 2LUHA 4PH4B 3FTYA 1DABA 4HWVA 4CEMA 5EDSA 2I2OA 2HE0A 2NSPA 3ZFWA 4APOA 1VDYA 4URKA 2NSTA 3TWTA 2GRMA 5LP0A 3EU9A 4AY5A 5JLVC 2NYJA 4GCOA 5AYWD 4ILIA 3JCKC 3QWVA 4A1GA 1OWOA 1QQ1A 5KJLA 1OWMA 3PH0C 3JXIA 3VMWA 5CCLA 3D9LA 3LS8A 4OJOA 3KRGA 3CGHA 1Z3YA 4DRXE 2JEKA 3UUXA 1N4QA 1U3CA 3IHVA 4L9PA 3CIAA 2VBMA 1DCEA 2L0TB 1P5QA 3VSTA 2FO1E 2IFUA 3CK8A 2B6CA 3UX4A 3QAQA 2XPIA 3CVVA 2AXVA 4KH3A 1IKND 2F37A 4GTVA 4MRUA 1IB4A 3BG1B 3LVQE 2BEDA 2P58C 5FZQA 1E96B 4I6EA 2NT6A 2BSPA 3G2SA 3ONKA 4U04A 4G24A 5BNWA 3O4ZA 3UM2A 4DJAA 4EZKA 3I4RB 4XZ4A 2WXLA 1X5BA 4IYPA 2XRZA 1TNUA 2J8KA 3KD7A 1OWNA 3FTVA 4AP2A 1BI8B 1CZFA 1OFMA 4ATZD 5ANLA 3EJNA 2WXHA 4XOPA 3ZPJA 1IQRA 4JHKA 2ETCA 5G2NA 2X6JA 2QYJA 3EHQA 3ZW3A 3VTXA 4G26A 4V02C 1O88A 1WM5A 3PRZA 3D9JA 2X85A 3D9OA 2H6HA 3G2WA 1QRBA 2RKKA 5FINA 2KM4A 2B0RA 1RZ4A 3V2OA 1QYMA 3V31A 3NZSA 4XR6A 1EPUA 4F1PA 4H7YA 3ASNE 1KCDA 2H6IA 3ZVVA 1QNFA 2KCLA 3GQAA 2QZAA 2VSNA 2LSVA 3FUEA 1DBGA 4I1MA 2V0PA 1U2VG 5FQ4A 2C0MA 1SQMA 4Q94A 3DWLG 4A3TA 3E33A 3MX3A 2IOSA 3UI2A 1YCSB 2O6WA 4GMLA 3S7JA 3E34A 3SFXA 4L2YA 4KXKB 4RG9A 3AU4A 1O8GA 2RFMA 2VGEA 3SGHA 1LD7A 3E32A 4ME2A 4BSXA 5CBNA 3DXKG 1FT2A 1TSPA 5G04C 1H6OA 4DUIA 3CVYA 3TJPA 3UM3A 4JA9A 3R9AB 2QXZA 3FTZA 5FQ7A 1K8KG 3PNTB 3BQOA 1E8XA 2IO3C 1H2TC 2Y0BG 3FU0A 3AS4A 5CEAA 4OAVB 3AG2E 5BT1A 3JQ1A 3FTWA 5CERB 3FY4A 3FUJA 2FULA 4DK5A 2NC9A 2OV8A 1H0AA 5JJTA 1NP7A 3DSUA 2F3LA 3VLEA 5ANRA 5ENTD 2W7ZA 4I1OB 4NQ0A 1HG8A 2O0VA 4GYWA 3RO3A 4K5BA 2X6YA 5G55A 3X2QE 1N11A 4MKTA 3ZXPA 3TWRA 1LF8A 4B8AA 3N6ZA 2AXUA 4BETA 2KZTA 3CEQA 2VFNA 4I2WA 3BUAA 3CHSA 2Y4UA 3T5VA 4BFRA 2QYUA 3LY7A 3B7UX 4FA6A 2XZDG 5KJNA 3OAWA 2GRLA 3ZSCA 4AVZA 3RRMB 5EKQD 2NXPA 5DBKA 4JZYA 3FUFA 4B8CB 5B3SE 3Q5MA 5G04J 5JJ7A 5J90A 2J4BA 4W8TA 1G3NB 2XCBA 1D8EA 3TAXA 2O0WA 5CMWA 4N2QA 3VMVA 4R7LA 3D9NA 4M7CA 2FI7A 5FIOA 2VFQA 1MYOA 2AWIA 2WXKA 1TJCA 4UWHA 2CHZA 4MLPA 1BPOA 5EYLA 4CZ2D 2DCPA 2BTDA 1QJVA 4YDTA 4WNGA 4CRWA 3L9TA 1K4ZA 4Q69A 4BSZB 4DX1A 4AV7A 5D66A 2NTPA 2XTXA 3ENEA 1SA4A 3QWWA 4YDWA 3HVEB 4HOUA 5EILA 3MA5A 3FU6A 5JA4D 3PZ2A 4I6GA 2L6JA 4UWFA 1H6PA 1OWPA 2QY7A 3I5PA 1N94A 5E76A 3ULQA 2O17A 3BH6B 4I9EA 5AJLA 3L08A 3OTNA 2OOEA 4DX5D 1IA5A 3SBSA 4ILGA 4GYOA 3FUHA 1GW6A 3GZSA 3TG4A 4G1TA 4E6HA 2IOLA 1TNOA 1XG2A 2R03A 1BLXB 2BF0X 4U7EB 3ZYMA 2MHKA 5BXUA 3ASHA 4YZXA 3NF1A 4U07A 3OXLA 2ONDA 4OJ5A 1UJJA 3RKVA 2Y3AA 1QQEA 1JCRA 5AJDA 2XENA 1HF2A 4NRHB 1WY6A 3C5RA 3D3MA 5EIBE 1WXRA 4LCTA 4YVQC 4CGVA 3LYAA 3SY2A 4JL0A 4OJPA 2A5EA 3RAUA 3OXGA 2WXQA 2PQRA 5HRYA 4N3AA 2BM4A 3SBTB 2XGSA 4L1BA 2VJIA
chains in the Genus database with same CATH topology
3PSZA 3NAWA 3SQVA 3PSSA 2QZAA 3DU1X 2XTXA 2O6WA 3SY2A 5DNSA 2QYUA 4YEIA 2XTYA 2XT2A 3NB2A 4YC5A 2XTWA 4YCQA 4YDTA 2J8KA 2XT4A 4YFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSZ A;  3NAW A;  3SQV A;  3PSS A;  2QZA A;  3DU1 X;  2XTX A;  2O6W A;  3SY2 A;  5DNS A;  2QYU A;  4YEI A;  2XTY A;  2XT2 A;  3NB2 A;  4YC5 A;  2XTW A;  4YCQ A;  4YDT A;  2J8K A;  2XT4 A;  4YFO A; 
#chains in the Genus database with same CATH topology
 3WG7 E;  2XHE A;  4ANV A;  4TXQ A;  1N0Q A;  2XS8 A;  3LJ3 A;  2R2L A;  2B0O E;  3HXF A;  4CCA A;  4WNF A;  3JXJ A;  4PS3 A;  5M72 A;  4OPW A;  3ZGQ A;  3Q79 A;  1JPL A;  4FC8 A;  3RSE G;  5T4Y A;  3TWQ A;  1LLW A;  5KNH D;  4UI9 C;  3VTY A;  4HOR A;  3N90 A;  3FUL A;  2V4H C;  2XT4 A;  3FP3 A;  2X38 A;  3L16 A;  2WVI A;  1S64 A;  3UT8 A;  1VBL A;  2WPV A;  3ZN3 A;  1TNY A;  1N9A A;  2P2C P;  4BX8 A;  4HXI A;  3LCA A;  1OOC A;  1KPS B;  4YC5 A;  5EN5 D;  4Z68 A;  3CLJ A;  1FT1 A;  5AEN A;  3Q78 A;  5HQ8 A;  4XOT A;  4GPK A;  1GQ8 A;  4G25 A;  2R02 A;  4FUL A;  4GZ5 A;  4HNA D;  4WUY A;  3MJW A;  3R9M A;  1HZ4 A;  1H19 A;  3APF A;  4ATG A;  2M63 A;  4KVM A;  1YMP A;  1O1R A;  1ZB1 A;  3EHM A;  4XKC A;  4U0U A;  3WXX A;  4FLB A;  2HYZ A;  4WWO A;  2EIL E;  4EQF A;  3LJN A;  1W3B A;  3TG5 A;  1A5E A;  2F0Y A;  2EQX A;  2VJ8 A;  1QA2 A;  4GTM A;  1WAO 1;  4NK8 A;  1KT0 A;  1JCS A;  1HH8 A;  4ACK A;  4RSY A;  4HRN A;  4LG6 A;  2WXI A;  4TV3 A;  3N71 A;  5ENO D;  4YFO A;  3QAR A;  1FVF A;  3PSZ A;  4AY6 A;  3NOG D;  4B89 A;  2P9S G;  1TYW A;  4BWR A;  2I6H A;  3W9G A;  2VBK A;  5CCM A;  4FHK A;  4J7W A;  2WMO A;  2WM9 A;  4F3V A;  3JUI A;  4F7A A;  1JUQ A;  1MHQ A;  4U0Z A;  3ZXS A;  2XGM A;  1OT8 A;  4GTS A;  2UY1 B;  5ENQ D;  4EZJ A;  1LD8 A;  4WND A;  4RLY A;  3QWP A;  4GTO A;  1TNZ A;  4BER A;  3PZD A;  1KTW A;  2RFA A;  4OAU C;  4P29 A;  5B1B E;  4TUU A;  3RK6 A;  2IU1 A;  3CVL A;  4GB9 A;  2CG2 A;  3AAA C;  2L0I A;  3SF4 A;  2E2E A;  3DST A;  4TXR A;  4I1A A;  5G05 C;  3SD5 A;  4AVX A;  5AQ9 A;  2IEJ A;  3FUN A;  3TL5 A;  3DSS A;  3H09 A;  3QJZ A;  4OVV A;  1PAQ A;  5JMN D;  2IY0 C;  1O8D A;  1ZU2 A;  2EIN E;  2I1K A;  3ASO E;  3LJY A;  2IOU G;  1OFE A;  3B4N A;  3ZIM A;  3PE4 A;  4XLF A;  2WB2 A;  2V5F A;  1PLU A;  2PL2 A;  1Y8M A;  3ZNG A;  3IBE A;  3CST A;  4HLL A;  3FU3 A;  4HBD A;  4LNU D;  3UTM A;  3VSV A;  4HQD A;  4GPM A;  1HG2 A;  4FP7 A;  2UVF A;  1CLW A;  2Y1L E;  3HRA A;  4G8L A;  2INV A;  4DX6 D;  4N39 A;  3L13 A;  5AQB A;  4ACL A;  4AOF A;  3CVX A;  4U63 A;  3AS8 A;  3ISM C;  3QNK A;  2R59 A;  1S63 A;  3ABM E;  5AMV A;  2CG3 A;  1KCC A;  1LTX A;  1D8D A;  2NSZ A;  3EHR A;  2VSX E;  3UKR G;  3T9K A;  1Z5S C;  2ETA A;  3U64 A;  4GTP A;  4L23 A;  1BHE A;  4HVB A;  2PYG A;  2QFC A;  3HXD A;  5FWQ A;  2P9I G;  4L2L A;  1O8J A;  5KJM A;  2GW1 A;  1IQU A;  3CR3 A;  4BX9 A;  3EIJ A;  3BH7 B;  1E90 A;  3FH7 A;  1WG0 A;  2FO7 A;  2XGO A;  2FBN A;  4IN3 B;  4YND A;  1HU3 A;  4J8D A;  1QCX A;  2VJJ A;  4TXP A;  2CHX A;  3JUE A;  1BU9 A;  1N54 A;  4GZC A;  3ZYL A;  4C48 B;  3ULE G;  2AW6 A;  2C0L A;  3ZHE B;  1ZBP A;  4EZL A;  1OUV A;  4XLE A;  3TWS A;  4WWP A;  5FQ8 A;  3DEP A;  4EBA G;  3CVU A;  3O48 A;  4FLH A;  3B8Y A;  4F6R D;  2X3M A;  2KC7 A;  2Y4T A;  4UWK A;  2WXF A;  4CGW A;  4Y6C A;  3P4G A;  3T5X A;  2XCC A;  2IO2 C;  3L54 A;  4YCQ A;  4UWG A;  4Z05 A;  3RRN B;  4U95 D;  3IEG A;  2ION A;  2AVP A;  2PM7 A;  1NFI E;  1NA3 A;  1IDJ A;  4U8Y D;  2VFO A;  2BM5 A;  3R7Q A;  2YQ8 A;  3Q4A B;  3NB2 A;  3D9H A;  3ASD A;  3FUM A;  3L82 A;  3GQ9 A;  3TXM A;  1N4S A;  5AAR A;  1OXJ A;  4U8H A;  1TEZ A;  2R05 A;  3GRH A;  5JJ6 A;  1O8I A;  3PEV B;  2VFP A;  5D0Q D;  3OXF A;  4LEU A;  4ANW A;  4WAF A;  2XQ0 A;  4B94 A;  4YEL A;  4A63 B;  2LAH A;  3GZ1 A;  5AQ7 A;  1H6K A;  5AN8 A;  3ZHE A;  5HKP A;  1INZ A;  3ZUV B;  2EIM E;  4JEH A;  4LER A;  2R17 C;  4W8S A;  1O5M A;  1RWR A;  2KXP C;  4U0S A;  4O6F A;  2LXL A;  1A17 A;  4PDX A;  3DU1 X;  1O1T A;  2QY1 A;  3HXE A;  2NT9 A;  5KNG A;  2PQN A;  2YIN A;  4OM9 A;  2ZGD A;  4W8Q A;  1K1A A;  3FTS A;  3NOC D;  4H7X A;  2EIK E;  2J07 A;  4HLE A;  2P9U G;  3UIO C;  4BT8 A;  2DBA A;  4GTR A;  2PEC A;  4LSZ E;  5E75 A;  1FPP A;  4GA2 A;  3W9F A;  4XI0 A;  1EF1 C;  3CQG B;  1JCQ A;  5FZS A;  3PZ1 A;  4DX7 D;  1HX8 A;  3UM1 A;  3PZ3 A;  1RMG A;  4K5C A;  5ENN A;  4PMH A;  1HS6 A;  2VSO E;  5BV0 A;  3P2B A;  4XON A;  4O60 A;  3IKO B;  4LRZ A;  5D0O D;  3Q73 A;  4GU5 A;  4U4B A;  3MZL B;  2O04 A;  4GAA A;  3EQN A;  4XIF A;  3CQC B;  2I9C A;  3CK7 A;  4KBQ A;  5LX8 A;  1RU4 A;  1E7V A;  3B7R L;  4PS8 A;  2LXM A;  3U66 A;  2IF4 A;  4GA0 A;  1K3Z D;  3J5Q B;  3Q9U C;  2UY1 A;  1EYH A;  4CYM D;  4L7T A;  3I3N A;  4JHJ A;  1O8K A;  2ETB A;  3SNX A;  1OCC E;  3BU8 A;  1JRG A;  4A1S A;  3FDH A;  2CHW A;  4EHM A;  1JTA A;  5CED B;  2WXO A;  1SZ9 A;  4JEU A;  3ESL A;  5LFA A;  1QBQ A;  5EYP F;  2X3H A;  2Y69 E;  2PZI A;  2ILR A;  5LOZ A;  2DYR E;  2LAI A;  4FHJ A;  1OY3 D;  1E7U A;  3FY3 A;  1MZC A;  4EPZ A;  3SFY A;  3QKY A;  1JWG A;  4OZZ A;  3DEO A;  4CDR A;  4DI3 A;  2PNN A;  1TYV A;  2YHC A;  5CHE E;  3DSX A;  4QQI A;  4CDN A;  4V3I A;  4FJY A;  4JC8 A;  4YVO A;  3VLD A;  3KSQ A;  1PXZ A;  5FJY A;  3MKQ A;  3V79 K;  3RRU A;  1AIR A;  3IV0 A;  4DPR A;  3B7S A;  2H6G A;  1S0P A;  4GTT A;  3L22 A;  2YHE A;  2ZU6 B;  4KVO A;  1IDK A;  3B7B A;  5BPP A;  2GRN B;  3DXM G;  3S7B A;  2LSU A;  4CT4 A;  4O1O A;  3B13 A;  3B7T A;  5FT9 A;  3PNL B;  3MV3 B;  4BTB A;  2XC1 A;  4UWL A;  3TXN A;  3SUC A;  2P9N G;  1IHG A;  4JA7 A;  4J8F A;  4ABN A;  3MYV A;  3FEY A;  3DSV A;  2L6B A;  3QK0 A;  3DPY A;  3UW0 A;  5IY5 E;  3MEK A;  4XN0 A;  3FFL A;  3CVN A;  2A5U A;  3U9W A;  3BG0 B;  2X6I A;  3AK5 A;  5HI7 A;  4JPS A;  3TWU A;  2V5I A;  5EID A;  3LDZ A;  4RQI A;  4XLH A;  2AJA A;  2MYO A;  3NBN B;  2MRI A;  3FH5 A;  1TJF A;  2FEZ A;  3D9P A;  3KEA A;  4HOT A;  4JB8 P;  1EA0 A;  5BXO A;  4BEP A;  4K0R A;  1U3D A;  2GRR B;  4BT9 A;  3PUK A;  4HOS A;  5DIZ A;  4N5C A;  3PVL A;  4I6J A;  3SZE A;  1O8H A;  2X6W A;  1HFA A;  2BX6 A;  3ZRH A;  3S7D A;  4G2V A;  4N3B A;  1AWC B;  2WXM A;  3LEW A;  1TYU A;  3KAE A;  3CVQ A;  1NA0 A;  1UW4 B;  4XI9 A;  1TN6 A;  3MKQ B;  2XTW A;  5ITZ F;  2RG8 A;  3AG4 E;  3IHY A;  3QC1 A;  3CKB A;  3LMW A;  2HO1 A;  3LYC A;  3T8M A;  1N4P A;  2J08 A;  1NL4 A;  4EBA A;  2WQ7 A;  3NAW A;  4OJ6 A;  1TN7 A;  3WWG A;  3ML8 A;  3HXC A;  3PUJ A;  4MS6 A;  4OYS A;  3Q47 B;  2V5Q C;  4G8K A;  2VBE A;  1NZN A;  1SA5 A;  2BKK B;  2WXR A;  3KEZ A;  4J0U A;  2V8S E;  3Q75 A;  2GRQ B;  3RIB A;  4KYO B;  2DWZ A;  3HXB A;  2P9K G;  2PM6 A;  4B0Z A;  1L1I A;  3LY9 A;  5C1C A;  4CT0 A;  3PRE A;  4C0E A;  3FUD A;  1L5J A;  4ANU A;  3ZPP A;  4OVU A;  2X6X A;  4YZ0 A;  2H6F A;  2P9P G;  3LXU X;  1DCQ A;  3B90 A;  2OEW A;  4GZD A;  1N95 A;  5FTP A;  1UG3 A;  3UM0 A;  4YEJ A;  4YDY A;  4URR A;  3L6A A;  2QX3 A;  1Y6I A;  1XNF A;  4ZFH A;  4B93 B;  3QOU A;  4IRU A;  4KZC A;  4AIF A;  1UOH A;  1WMR A;  3E30 A;  1HG5 A;  4J6I A;  1B89 A;  2YNQ A;  5ARG A;  1K1B A;  3D9I A;  1OCO E;  4W9R A;  4FU3 A;  3AJI A;  1OCZ E;  3GQ8 A;  4G11 A;  4Y6W A;  3SO8 A;  2ZIR A;  2GRO B;  1SW6 A;  2XPY A;  1OCR E;  3TGO A;  1LM1 A;  4LNB A;  4JRA C;  3DSW A;  3SFZ A;  1X0C A;  4NIK A;  1PC2 A;  3Q9N C;  4N5Q A;  3Q15 A;  4DLO A;  1OFD A;  3RJV A;  3CK9 A;  2J8I A;  2HR2 A;  2VTB A;  2ZIS A;  1HF8 A;  5H7P A;  3FU5 A;  2XEH A;  2Q7F A;  3APD A;  4UI9 K;  1QA3 A;  3T8K A;  3E37 A;  4Z03 A;  4TRQ A;  2DZN A;  1MQS A;  2Z8G A;  3Q7A A;  3CSF A;  1YA0 A;  2GGF A;  2F8Y A;  3VLF A;  3J5P A;  1O8L A;  3ASF A;  3G2V A;  2XRY A;  2JAB A;  1PY1 A;  2LNI A;  2J4D A;  5EX0 A;  4YDE A;  3I4G A;  4F1S A;  3GZ2 A;  3CVW A;  3Q49 B;  3CKC A;  4O1P A;  4N2S A;  5LCW J;  3EHN A;  4Z06 A;  4DX2 A;  3ML9 A;  5T8I A;  1MX4 A;  2VTB B;  4C0M A;  2VGY A;  3APC A;  3LKU A;  2DZO A;  1QZ2 A;  1N4R A;  2E0I A;  2VYI A;  4JW1 A;  3PS6 A;  4D10 C;  4TUM A;  1E8Y A;  4HOQ A;  5C1E A;  4JHR A;  3VSU A;  1X81 A;  4JXT A;  3FUI A;  1WDY A;  2UWJ G;  1Z6T A;  2QC9 A;  4ZHB A;  2VFM A;  3PEU B;  1DC2 A;  5DNS A;  1RW2 A;  2AXZ A;  4RVB A;  3C3Q A;  4JD2 G;  4EW9 A;  3JQ0 A;  3JUR A;  4QFV A;  1SZA A;  4JVS A;  4K5A B;  4KZ0 A;  3Q7F A;  3AG1 E;  3ZYQ A;  1PE9 A;  2WXN A;  4XM3 A;  2WXG A;  2EWE A;  1V55 E;  4FJZ A;  3KSL A;  2F8X K;  2INU A;  3FTU A;  5T3R A;  2NTQ A;  4OJL A;  4MR0 A;  3P1U A;  3FH8 A;  5ENR D;  1KZO A;  2XEE A;  3D9K A;  1AP7 A;  3FEX A;  3UT7 A;  3GW4 A;  4I2Z A;  1DBO A;  3UXG A;  2P9L G;  1E8W A;  4GTQ A;  3TWV A;  4YEI A;  3ULY A;  5FZR A;  1MX2 A;  4MBG A;  4HI8 A;  5KWD A;  1MX6 A;  2O1D A;  5AIJ A;  2KCV A;  1KLX A;  4I9C A;  1NHC A;  3BEE A;  1LLZ A;  2BUG A;  2J49 A;  2VGX A;  5A23 A;  3C3O A;  1QA1 A;  1K5C A;  1QRC A;  1BN8 A;  1BD8 A;  1IYG A;  3PDN A;  4A3V A;  3S2A A;  5EX3 A;  4DI4 A;  3UT4 A;  2XT2 A;  3F6Q A;  5AAO A;  3CVP A;  5CRV A;  1O8F A;  1KT1 A;  3HYM B;  1YYH A;  5C2Y A;  2VQ2 A;  4E85 A;  4BES A;  3KS2 A;  5C1D A;  3HIZ A;  3V30 A;  2OCC E;  2L9B A;  4ANX A;  3B95 A;  4W8R A;  4U8V D;  2OVF A;  4LUN U;  3SZ7 A;  3HG0 D;  4U49 A;  1OGO X;  1H80 A;  3ML3 A;  5ENS D;  4XMY A;  3UMV A;  2PYH A;  2XZT G;  3S7F A;  4OZY A;  3CV0 A;  4EEC A;  2LO6 A;  3ZKJ A;  4GZ3 A;  3SQV A;  2FF4 A;  4DLQ A;  1TNB A;  1H2U A;  1N0R A;  5LCW C;  4YDO A;  3MCX A;  5KBA A;  4HS2 A;  1KZP A;  1JWF A;  3DRA A;  4XLA A;  3CHO A;  4XE0 A;  2KAT A;  1E8Z A;  5JHB A;  3RO2 A;  4AM9 A;  2VSY A;  5JHA A;  3ESK A;  1O8M A;  1DNP A;  4J8Y A;  3MKR A;  3ASG A;  4MXN A;  3HDX A;  4UQZ A;  4GCN A;  5CMY A;  3FUK A;  4CDM A;  2CFZ A;  1HE8 A;  1ELR A;  3SI5 A;  2I1J A;  4XQF A;  4WWN A;  4LNG A;  4YZQ A;  3TH0 A;  3UIP C;  1HXI A;  3EDT B;  1DVP A;  2ZXW E;  4A55 A;  3FWV A;  4I17 A;  3UKU G;  1IXV A;  2KZT B;  2IJG X;  1HO8 A;  4GMJ A;  3JYS A;  4FAD A;  3ZEF A;  3E4B A;  1UN9 A;  3AG3 E;  3ONL A;  3PE3 A;  2XPZ A;  1K8F A;  4YZA A;  3DPD A;  4BY6 A;  1S70 B;  5KJK A;  4G23 A;  4I43 A;  1D9S A;  1O1S A;  4GYY A;  2X6K A;  2J09 A;  2C2L A;  1MJ0 A;  3EQO A;  1XGW A;  1UN8 A;  2WXJ A;  2XTY A;  1BI7 B;  4XNF A;  4F53 A;  1ELK A;  2WMN A;  2VGX B;  2NZM A;  3LY8 A;  2HM8 A;  1FCH A;  3AS5 A;  3CHP A;  3URZ A;  4Q96 A;  1OFL A;  1H2V C;  2KBX A;  2BM7 A;  2J9Q A;  4XKW A;  1NI1 A;  4U96 D;  3UPV A;  3CHR A;  4K03 A;  4J8E A;  3NZU A;  1EDU A;  3K9I A;  4HRM B;  3V2X A;  2NTB A;  3FHE A;  2G0Y A;  3G2U A;  3D9M A;  4XN3 A;  2X6F A;  4NAC A;  4XKB A;  3JX8 A;  3PSS A;  2RD0 A;  5D2M C;  4X8Q A;  5A6C A;  2DVW A;  4I84 A;  5ARF A;  2YUH A;  4XLC A;  1V54 E;  3TWW A;  1Z3X A;  2WXP A;  2R5S A;  3PET A;  2IQC A;  1SVX A;  3RIQ A;  1ELW A;  3MGB A;  3ABK E;  3U3W A;  4PS7 A;  3PZ4 A;  4C2L A;  2EIJ E;  3UQ3 A;  4HB5 A;  2OVB A;  1TR4 A;  2JLB A;  1TYQ G;  3C72 A;  1IHB A;  3UIN C;  2DIW A;  3RU0 A;  3T9G A;  3L17 A;  4XL9 A;  5B1A E;  3NQP A;  5CRU A;  4XX5 A;  1EE6 A;  2IQ7 A;  4BTA A;  3ZYK A;  5A7D B;  4J8S A;  2J8S D;  2X6H A;  2GRP B;  1O8E A;  5FQ6 A;  4XEI G;  3ABL E;  3FTX A;  2ODL A;  2XEV A;  1N52 A;  4AEZ C;  3LVR E;  3EUV A;  4XOR A;  2ZGG A;  2V4L A;  3TWX A;  4GA1 A;  5CEC B;  4NUR A;  4HRL A;  5AQA A;  5BUZ A;  5JMC B;  4UUC A;  5J08 A;  3G2T A;  3C3R A;  4HI9 A;  4M3O A;  1OWL A;  2DYS E;  3MV2 B;  4RG6 A;  5BV1 A;  2OEV A;  3EU5 A;  2CFU A;  3LPZ A;  4ILH B;  2BM6 A;  3HHM A;  3DBS A;  5G05 J;  1KQ5 A;  4KMO A;  2KCK A;  4WNE A;  4GMR A;  5BW8 C;  5CBO A;  1FVH A;  5KCM A;  1EZG A;  4APF A;  2A4Z A;  2XS1 A;  2BKG A;  3QDN A;  2UVE A;  2WQ6 A;  3SHF A;  3AU5 A;  3GYZ A;  1OGM X;  1Q2Z A;  1UJK A;  4AXH A;  5ENP D;  4XKV A;  3EIQ C;  3R7R A;  3C98 A;  1TYX A;  3SYJ A;  4IUL A;  3QB2 A;  4N3C A;  4AJW A;  2MOW A;  4UI9 J;  3GQ7 A;  4HFG A;  3CHQ A;  4UQY A;  3HVE A;  4GZ6 A;  4NK6 A;  4C9B B;  3CHM A;  4KT6 B;  1TN8 A;  3ZU7 B;  4PUC A;  3IXE A;  5HS0 A;  2WQH A;  4UQX A;  3U4T A;  2LUH A;  4PH4 B;  3FTY A;  1DAB A;  4HWV A;  4CEM A;  5EDS A;  2I2O A;  2HE0 A;  2NSP A;  3ZFW A;  4APO A;  1VDY A;  4URK A;  2NST A;  3TWT A;  2GRM A;  5LP0 A;  3EU9 A;  4AY5 A;  5JLV C;  2NYJ A;  4GCO A;  5AYW D;  4ILI A;  3JCK C;  3QWV A;  4A1G A;  1OWO A;  1QQ1 A;  5KJL A;  1OWM A;  3PH0 C;  3JXI A;  3VMW A;  5CCL A;  3D9L A;  3LS8 A;  4OJO A;  3KRG A;  3CGH A;  1Z3Y A;  4DRX E;  2JEK A;  3UUX A;  1N4Q A;  1U3C A;  3IHV A;  4L9P A;  3CIA A;  2VBM A;  1DCE A;  2L0T B;  1P5Q A;  3VST A;  2FO1 E;  2IFU A;  3CK8 A;  2B6C A;  3UX4 A;  3QAQ A;  2XPI A;  3CVV A;  2AXV A;  4KH3 A;  1IKN D;  2F37 A;  4GTV A;  4MRU A;  1IB4 A;  3BG1 B;  3LVQ E;  2BED A;  2P58 C;  5FZQ A;  1E96 B;  4I6E A;  2NT6 A;  2BSP A;  3G2S A;  3ONK A;  4U04 A;  4G24 A;  5BNW A;  3O4Z A;  3UM2 A;  4DJA A;  4EZK A;  3I4R B;  4XZ4 A;  2WXL A;  1X5B A;  4IYP A;  2XRZ A;  1TNU A;  2J8K A;  3KD7 A;  1OWN A;  3FTV A;  4AP2 A;  1BI8 B;  1CZF A;  1OFM A;  4ATZ D;  5ANL A;  3EJN A;  2WXH A;  4XOP A;  3ZPJ A;  1IQR A;  4JHK A;  2ETC A;  5G2N A;  2X6J A;  2QYJ A;  3EHQ A;  3ZW3 A;  3VTX A;  4G26 A;  4V02 C;  1O88 A;  1WM5 A;  3PRZ A;  3D9J A;  2X85 A;  3D9O A;  2H6H A;  3G2W A;  1QRB A;  2RKK A;  5FIN A;  2KM4 A;  2B0R A;  1RZ4 A;  3V2O A;  1QYM A;  3V31 A;  3NZS A;  4XR6 A;  1EPU A;  4F1P A;  4H7Y A;  3ASN E;  1KCD A;  2H6I A;  3ZVV A;  1QNF A;  2KCL A;  3GQA A;  2QZA A;  2VSN A;  2LSV A;  3FUE A;  1DBG A;  4I1M A;  2V0P A;  1U2V G;  5FQ4 A;  2C0M A;  1SQM A;  4Q94 A;  3DWL G;  4A3T A;  3E33 A;  3MX3 A;  2IOS A;  3UI2 A;  1YCS B;  2O6W A;  4GML A;  3S7J A;  3E34 A;  3SFX A;  4L2Y A;  4KXK B;  4RG9 A;  3AU4 A;  1O8G A;  2RFM A;  2VGE A;  3SGH A;  1LD7 A;  3E32 A;  4ME2 A;  4BSX A;  5CBN A;  3DXK G;  1FT2 A;  1TSP A;  5G04 C;  1H6O A;  4DUI A;  3CVY A;  3TJP A;  3UM3 A;  4JA9 A;  3R9A B;  2QXZ A;  3FTZ A;  5FQ7 A;  1K8K G;  3PNT B;  3BQO A;  1E8X A;  2IO3 C;  1H2T C;  2Y0B G;  3FU0 A;  3AS4 A;  5CEA A;  4OAV B;  3AG2 E;  5BT1 A;  3JQ1 A;  3FTW A;  5CER B;  3FY4 A;  3FUJ A;  2FUL A;  4DK5 A;  2NC9 A;  2OV8 A;  1H0A A;  5JJT A;  1NP7 A;  3DSU A;  2F3L A;  3VLE A;  5ANR A;  5ENT D;  2W7Z A;  4I1O B;  4NQ0 A;  1HG8 A;  2O0V A;  4GYW A;  3RO3 A;  4K5B A;  2X6Y A;  5G55 A;  3X2Q E;  1N11 A;  4MKT A;  3ZXP A;  3TWR A;  1LF8 A;  4B8A A;  3N6Z A;  2AXU A;  4BET A;  2KZT A;  3CEQ A;  2VFN A;  4I2W A;  3BUA A;  3CHS A;  2Y4U A;  3T5V A;  4BFR A;  2QYU A;  3LY7 A;  3B7U X;  4FA6 A;  2XZD G;  5KJN A;  3OAW A;  2GRL A;  3ZSC A;  4AVZ A;  3RRM B;  5EKQ D;  2NXP A;  5DBK A;  4JZY A;  3FUF A;  4B8C B;  5B3S E;  3Q5M A;  5G04 J;  5JJ7 A;  5J90 A;  2J4B A;  4W8T A;  1G3N B;  2XCB A;  1D8E A;  3TAX A;  2O0W A;  5CMW A;  4N2Q A;  3VMV A;  4R7L A;  3D9N A;  4M7C A;  2FI7 A;  5FIO A;  2VFQ A;  1MYO A;  2AWI A;  2WXK A;  1TJC A;  4UWH A;  2CHZ A;  4MLP A;  1BPO A;  5EYL A;  4CZ2 D;  2DCP A;  2BTD A;  1QJV A;  4YDT A;  4WNG A;  4CRW A;  3L9T A;  1K4Z A;  4Q69 A;  4BSZ B;  4DX1 A;  4AV7 A;  5D66 A;  2NTP A;  2XTX A;  3ENE A;  1SA4 A;  3QWW A;  4YDW A;  3HVE B;  4HOU A;  5EIL A;  3MA5 A;  3FU6 A;  5JA4 D;  3PZ2 A;  4I6G A;  2L6J A;  4UWF A;  1H6P A;  1OWP A;  2QY7 A;  3I5P A;  1N94 A;  5E76 A;  3ULQ A;  2O17 A;  3BH6 B;  4I9E A;  5AJL A;  3L08 A;  3OTN A;  2OOE A;  4DX5 D;  1IA5 A;  3SBS A;  4ILG A;  4GYO A;  3FUH A;  1GW6 A;  3GZS A;  3TG4 A;  4G1T A;  4E6H A;  2IOL A;  1TNO A;  1XG2 A;  2R03 A;  1BLX B;  2BF0 X;  4U7E B;  3ZYM A;  2MHK A;  5BXU A;  3ASH A;  4YZX A;  3NF1 A;  4U07 A;  3OXL A;  2OND A;  4OJ5 A;  1UJJ A;  3RKV A;  2Y3A A;  1QQE A;  1JCR A;  5AJD A;  2XEN A;  1HF2 A;  4NRH B;  1WY6 A;  3C5R A;  3D3M A;  5EIB E;  1WXR A;  4LCT A;  4YVQ C;  4CGV A;  3LYA A;  3SY2 A;  4JL0 A;  4OJP A;  2A5E A;  3RAU A;  3OXG A;  2WXQ A;  2PQR A;  5HRY A;  4N3A A;  2BM4 A;  3SBT B;  2XGS A;  4L1B A;  2VJI A; 
#chains in the Genus database with same CATH homology
 3PSZ A;  3NAW A;  3SQV A;  3PSS A;  2QZA A;  3DU1 X;  2XTX A;  2O6W A;  3SY2 A;  5DNS A;  2QYU A;  4YEI A;  2XTY A;  2XT2 A;  3NB2 A;  4YC5 A;  2XTW A;  4YCQ A;  4YDT A;  2J8K A;  2XT4 A;  4YFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...