3SR1A

Crystal structure of staphylococcal nuclease variant delta+phs a69g bound to ca2+ and thymidine-5',3'-diphosphate at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENGKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS A69G bound to Ca2+ and thymidine-5',3'-diphosphate at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sr1A00
2PQEA 3ERQA 4RKLA 4J6HA 2F0DA 5CV4A 5IGCA 1SYDA 3C1EA 5K5PA 1EY9A 3MEHA 3MVVA 4WRDA 3V2TA 2EYPA 5IGFA 4DU9A 1F2MA 4MIUA 1TT2A 1NUCA 1A3TA 1II3A 2PZUA 4DGZA 5IOCA 3S9WA 4K2LA 3OMGA 4ODGA 3P1HA 1EZ6A 3NP8A 5E1FA 1TQOA 4B9XA 4K8JA 5HGTA 1STHA 5HURA 3BDCA 1SYFA 2F0MA 1EY6A 2F0NA 4ZQ3A 4DF7A 1JOQA 2EXZA 2F0EA 1A2TA 2PW7A 4KJNA 4LAAA 5EGTA 2LKVA 4K14A 1RKNA 5NUCA 2F3VA 2PZTA 3EROA 2KHSA 3HEJA 3E5SA 4HMJA 5KIXA 5ISRA 5CGKA 3SXHA 3NUCA 1SNQA 1F2ZA 1A2UA 4I65A 1KDAA 2F0SA 2RBMA 3SK4A 2O4XA 1IHZA 4DFAA 4QB4A 5J22A 5IGBA 5I9PA 1STNA 2M00A 4KD3A 3SK8A 2NUCA 1SNDA 4EQPA 2SNMA 5C3XA 1NSNS 1SNMA 3D6CA 4KTAA 1KDCA 4N9PA 3SK5A 3T13A 1AEXA 4B9WA 3DMUA 1EY0A 5IODA 1EY5A 3NQTA 4N9TA 5I6WA 4ID6A 3NXWA 5CV7A 2RDFA 5C4ZA 2F0FA 5IGGA 3H6MA 4PNYA 5M9OA 3QOLA 1EY8A 1TR5A 5C5LA 3T16A 5CV6A 5CV5A 2EY6A 2PW5A 4IZ8A 2OF1A 4NDXA 4WORA 2F0LA 4E6IA 4F7XA 4OL7A 2EYFA 4HTHA 4IUNA 1JOOA 2F0TA 3TP8A 3U9OA 4PMBA 4QMGA 2EY5A 5EKKA 5F2DA 3SHLA 4ZUIA 4J1MA 5EKLA 4YIJA 2F0IA 4EQOA 4TRDA 4K5VA 5C5MA 4ZUJA 1A3UA 1STGA 3OMCA 4HMIA 5IGEA 2F0PA 4G57A 4K5WA 5IGDA 5KYIA 4KHVA 1ENAA 2PZWA 3C1FA 4ME5A 4NMZA 4R8NA 1SYCA 4KJOA 2EYOA 5KRUA 1EY7A 2F0WA 2F0QA 2SOBA 1ENCA 3MXPA 4EVOA 4K5XA 5J39A 3NHHA 3P75A 2F0UA 1EY4A 3D8GA 5DAUA 2OEOA 1SYGA 2EYJA 3VA5A 3LX0A 2RKSA 1JOKA 2F0HA 2F0JA 4K8IA 5KYLA 5JAVA 3EVQA 3NK9A 3QB3A 5I6YA 3OSOA 1EYDA 5C6AA 1U9RA 1KAAA 1SNOA 2F0OA 4KV6A 1STAA 4K2KA 5CR3A 1EZ8A 4KY5A 5C3WA 5KEEA 1SYEA 2EYLA 3MHBA 1JORA 4NKLA 4F8MA 3SK6A 2EYMA 2KQ3A 1EYAA 3HZXA 3MZ5A 1EQVA 1SNCA 2OXPA 3PMFA 5KGUA 1KDBA 3D4DA 4NP5A 4EQNA 2EY1A 2F0KA 3TP5A 2SNSA 3DHQA 4RKBA 1SNPA 2ENBA 4PMCA 5E3FA 1F2YA 5J1ZA 5DEHA 5CC4A 3BDLA 3R3OA 3OWFA 5IIFA 3ITPA 2PYKA 4KD4A 2F0GA 2WACA 1EYCA 1STYA 2F3WA 4KY7A 5CV9A 3D4WA 3EJIA 4K6DA 3QOJA 1KABA 5JOBA 3RUZA 5C4HA 4H7BA 2EY2A 2HQEA 4QF4A 1STBA 3SR1A 5CV8A 2EYHA 2QDBA 4IALA 5I9OA 4S3SA 2F0VA 1SYBA 1A3VA 3TP6A 3TMEA 3TP7A 4KY6A
chains in the Genus database with same CATH superfamily
4BXXG 2X6GA 1YJ9A 5E4WC 1E1OA 3J81c 5G3LF 2EOTA 3GTKB 5JJLA 2KCNA 1VQBA 3NBHB 4AYBB 1QUQB 1NUCA 4JG2A 2D62A 2PZUA 1H95A 1CKNB 1JE5A 4ZKCB 3S1NH 4A3BB 5HURA 2A74C 4HJAA 1D1IA 1BBUA 1K28A 5BN4A 4IUUA 2PMZB 3CKIB 5CGKA 4KKTA 3I55A 4N8X1 2RBMA 4RG1A 5A35A 3ZJYC 2BA0A 4MTNA 4BY1H 3I4NH 1VQHA 5I9PA 1ML0D 3SK8A 4DN4M 1SNMA 4JW0A 1GHJA 4BBRB 2JA7H 1AEXA 1O7YA 3BYTB 1CK1A 3K59A 1J8IA 1EEID 1VF5C 3CCQA 1EYGA 1NAPA 4C2MB 4WORA 2RCNA 1B3AA 3A54A 2NYZD 3FDTA 3TP8A 4HTHA 1CA6A 2E2DC 4RHRA 1VQ4A 1NE3A 3LWUA 2PNHA 1LT4D 1J5EQ 4EQOA 5C5MA 2WINB 3OMCA 4K5WA 4NXMQ 4BXXH 4OO1G 1ENAA 1FD7D 3C1FA 2TSSA 1VQ5A 2B2YA 1QNKA 1ENCA 1B3QA 3M7NA 4A3JG 1LT6D 3P7JA 3SDZA 3KF6B 3TS2A 4RH6A 5IY0A 2F0HA 1HNWL 1K3BC 2I5HA 2YTYA 4R9WA 5C6AA 4X62Q 2L1BA 3ULLA 3C46A 4HR7B 1BXTA 1OXVA 1F2LA 3JAMi 2OTJA 1X3EA 1MIUA 2AUKA 2ATWA 5M3FB 3PO3G 2SNSA 4XTCS 1Q46A 4PMCA 1WTQA 4BA2I 3R3OA 1PH9A 4JBMA 2EJMA 4A75A 3UDIA 1HXYD 4RGTA 2F4VL 5JOBA 1R4QB 3GDEA 3A74A 4GLXA 2Y0SE 3SR1A 2VNUD 4XIGS 2B8GA 4ZK9B 3I4LA 4RGOS 3S2DH 1WYDA 4DPGA 4L63B 4DV3L 1N9WA 1VQNA 5EQ0A 1CSPA 3M85A 4JK1C 2WIIB 3ONAB 3PUXA 5ELDA 3HOVG 1I3QH 2Z6BA 2EIFA 2MO0A 4OO1H 3BDCA 1Q12A 2F0EA 2OQ0A 1QB5D 4A3JH 3RZOB 4XQQA 4LUVA 2UUCQ 3W1GA 4PZ6A 1VQ7A 1JT8A 3FHWA 3SEBA 4B3TQ 1F2ZA 2F0SA 2ID0A 2ZT9C 4DV0L 1Y1VH 2EDGA 1IKMA 4R4QA 5IP7G 3CCRA 1PTOD 2CW0D 4JI2Q 3RZDB 2SNMA 3DWQA 4EGVA 3KFUA 1K8OA 3FKIG 1RD9D 4ID6A 3PO2B 2BCOA 3J7A5 3HS0C 5M9OA 4AQYL 3PO3H 4JV5L 1TR5A 1CZGA 2JA6G 3PIOA 2B2VA 2JA8G 2LXKA 3L9AX 2MPMA 4UDUC 5M5WH 2R92G 2WKCA 3RN5A 1HZ9A 1X32A 5F2DA 2BH2A 1IBKL 5LHY1 1LTGD 3NE5B 1DOLA 2VS1A 3SVMA 3G48A 1SEBD 2B3GA 4DV2L 1DCZA 1LO5D 2ZXOA 4ZAIA 2R7ZG 4PQXA 4CJ2C 2NVYH 2E2IB 2UUBL 1GXDC 2A69D 3HOVH 3MTSA 4EX5A 3L2PA 1TY2A 4K8IA 2UUAL 5I6YA 1O80A 2ZJRA 2HUGA 2K5QA 5CR3A 3VYRA 1IBLQ 3PUYA 1Z9FA 1AZPA 1X3FA 4OWTB 2YTXA 4XT3B 1TY0A 3H0GG 2QEJC 5IWAL 1CQVA 5IP7H 5FJ8G 2WAQE 3TN2A 1Y14B 1WD0A 4POGA 1EYCA 3FKIH 2AHOB 1UEAB 3GQBA 4TKOB 1PTOH 3K8AA 2IPKD 4QUCA 2JA6H 2XRQD 2JA8H 1SYBA 4A3FG 2NTTA 2E2JH 3ERSX 1Q90A 1SN8A 5CV4A 4POFA 2R92H 4DK1A 5AJ3L 3K5MA 3MEHA 5FLXc 5IGFA 4XXEA 1F2MA 1D8LA 1VMCA 1JJGA 3Q22A 5IOCA 1Z6HA 4A3KG 3HKZB 3KDFA 2JN4A 3NPPA 2XIWA 1HNWQ 5ELEA 1QUQA 2R7ZH 3X3NA 2EXZA 3NQIA 5EGTA 5AFWA 3EROA 3S2HH 3WDNA 4PMWA 3JC66 5FK9C 2AWOA 4QB4A 4JI3L 5IGBA 2K1BA 1JB3A 1O7IA 1PRTF 2E2HH 4Y52H 1SXTA 1BOSA 2LSSA 3DMUA 3FRPB 2F1MA 1ILQA 3H0GH 3TREA 2F4VQ 1VQKA 3MXNA 1I4QA 1I50B 3S1RH 1Q8IA 1O7LA 5C4JH 3H3VH 5CMDA 2EVBA 3ER0A 4OONA 5C5LA 1S3OA 3T16A 5FJ8H 4A3GG 4NDXA 1MKHA 3NWTA 2R93G 1TIID 4AIMA 4DV3Q 4IUNA 4AH6A 4NB3A 1ZXTA 3SHLA 5CBEE 1WCMB 4TRDA 1XMOL 3D4RA 3OIPA 5E7NA 4C56C 4DV4L 4A3FH 4JI4L 3DM3A 1PRTB 4NMZA 2JEAI 2F0WA 2FJ2A 3CP0A 4CGYB 2F0UA 5JVG3 2WB1B 4A3KH 2RKSA 4N8FA 3PUZA 2F0JA 1CZWA 2A5HA 4K0KQ 4IJHA 3QB3A 3JAML 3UDGA 1PH5A 2CVRA 4A3MG 1NR4A 2HCCA 1G2SA 1X3QA 4P2CB 2KQ3A 2UXCQ 3I73A 1FNUA 4A3IG 1XPUA 3D4DA 4YWLA 2L15A 4QIWB 4AQYQ 4JV5Q 3EA6A 4P74A 4JVZA 2WP8J 1KAWA 1KABA 4RGNA 5C4HA 4CKBA 2EY2A 1G6ZA 5EAYA 3CRLC 1KTKA 1SMXA 4JI8Q 1G6PA 4I7AA 1I6VC 3GTGH 3LNNA 4A3GH 3TP6A 4HJ7A 2R93H 3DWPA 4DAPA 3ICEA 2PQEA 4DV2Q 4DXFA 3QO2A 3RLFA 1EUJA 1JICA 1P16A 5K5PA 2L5TA 3T4AC 1L1OA 1EU3A 1VQDA 3KYHC 5LMNQ 2UUBQ 3J81E 2C9OA 4K2LA 1LTAD 3AFPA 3S1MH 1PZKD 5FO9B 1V9PA 1YNJD 3CC7A 1KLGD 4LFCL 5HGTA 2UUAQ 3OPOA 3I4MB 3R8BA 5C3EG 1Q1BA 4P72A 2G5DA 4B3RL 2PZTA 2E5LL 2CH4A 5D65A 4L5SA 2IT1A 3NUCA 4I65A 3AB9A 2JXMB 5ELNA 5IWAQ 2KUMA 4A3MH 4FF3A 5T1IA 3F2DA 4X3KA 3TDQA 1SBBB 2B63G 1EY5A 1FGUA 3E0EA 2B8FA 2A68D 1HFGA 2KEDA 4OIJA 4A3IH 3NXWA 1IW7D 2RDFA 1PH1A 5JPNC 4IZ8A 4GKKL 3GTQB 2A6ED 1FJGL 4ZCKA 4PMBA 2BE5C 5AJ3Q 3CQZH 5EKLA 5DM73 2K6AA 3HOXB 2AUJD 1EL0A 1RODA 3S15B 1XTCD 5I2XA 1A3UA 2PQAB 3PIO3 3URYA 5D3DA 4IUQA 2F0QA 2HHHL 1TWHH 4KN4C 4JI7L 3I3CA 4RAUC 5BR8L 4X3SA 3BVGA 4DAVA 1PZID 1EFID 2JA9A 2HT1A 5LL6X 1C4QA 5C3EH 2EYMA 5LMNW 1I94L 2PNRC 4Z9CB 3KBXA 1PTOC 2CW0C 5GAEC 4LF7L 1H9KA 4IUVA 3RD4A 1VQIA 3OWFA 5IIFA 2B63H 1V43A 1YHAA 3U4VA 1TKWB 2NN6I 2DY8A 4R4IA 2DGYA 2HQEA 1HR0L 1WTWA 4MTKA 1SDFA 4QGUA 3I4OA 3HOZB 2M2LA 1XMOQ 1RDPD 1XX8A 4OEMB 4A93B 1A63A 2F52A 2M9VA 4JI4Q 3PUWA 2I07B 1PFSA 4DXGA 4CKCA 3MVVA 2B2UC 5M3MB 1R4PB 1X65A 4MIUA 2PI2A 1II3A 2Q2TA 1HA6A 4C3JB 1VCIA 4UAIA 3TZUA 1PFNA 1BDOA 4Y7NB 1SYFA 2Q8TA 2A69C 2NVXH 1U4PA 1GUWA 5EJWA 4IPHA 2CQOA 3Q0AA 1XPRA 4LF9L 4GOPA 2B29A 1KDAA 2NWGA 4IPCA 3CCSA 4KD3A 4DR1L 1DGSA 3HOUG 4ZRZA 1I4RA 4N9PA 4FXDA 2E75C 1QZGA 1QILA 2K5DA 4R4OA 4LJZC 1TVXA 1X56A 2HQLA 5CV7A 1NTGA 2K05A 3M4OB 1PH6A 3J7AV 3S1QB 5M5YB 1B8AA 2K5WA 2E8GA 1MSHA 5GQOA 3S16B 1N36L 2K28A 1S5DD 3I70A 4GKJL 3H15A 3ZYYX 1IYUA 3F2UA 2AQ2B 1SJED 2F0PA 2IW3A 3E6ZX 3QG1A 4LFCQ 2Z4IA 2SOBA 1V1OA 1Q82C 3D0FA 5ELOA 1EEFD 1S5FD 2RF4A 1WD1A 4KLKA 2PI2E 4B3RQ 2RSNA 2E5LQ 1R9TB 4LWCA 3N52A 1S72A 1VDZA 1QVCA 2QDLA 2SDFA 4DUYL 3S14B 1FYCA 4AYBG 1A8VA 2K52A 3T51B 2R7FA 2K7VA 4A3BG 1A15A 2OXPA 1HNXL 1JR0D 5T1GA 3DHQA 2B2WA 1I6HH 5J1ZA 2CWPA 3NTKA 1JJ2A 3HOUH 2NZHA 2PYKA 5G3LD 2X69A 3W1BA 4RWSC 4GKKQ 3QOJA 2TMPA 1FJGQ 4CKEA 1QOHA 1PYBA 3CPFA 3K7AB 2K01A 4RGMA 4DR3L 3STBD 3I90A 4BBRG 4H02A 1V1PA 3ULPA 4KY6A 4DV1L 1F9QA 3GTPB 4WJ4A 1N34L 3D6WA 4HJ8A 3S9WA 4DGZA 2HHHQ 4GNXA 1EZ6A 4JI7Q 5BR8Q 1GOZA 4DF7A 1RHPA 1CM9A 1HRJA 4LAAA 1U4RA 3A7AB 3MA2B 1RKNA 1FR3A 2AQ1B 3E5SA 1AE3A 4WFN3 4IO9A 3GTKH 3G4SA 2JA5B 4DFAA 3CF5A 4LF7Q 4LF6L 4X65Q 5L37A 2DNEA 3SK5A 2VZAA 1H9JA 4A3BH 2VB3X 2PPBC 2P5ZX 4A3DB 1HR0Q 2JK8A 5JJZA 5D3IB 2ES2A 3H3VI 5M3FG 4FVMA 4QMGA 3KJPA 3K0YA 1WFQA 1RIPA 3ND9A 5IT9L 1IYVA 1QCBD 5H1SE 1Y8NB 3CCVA 3BZCA 4BBRH 1ASYA 1QWYA 2NN6G 1D5MC 3I56A 4A3EB 4H0LC 2K5HA 4JI6Q 4KKUA 1B70B 1F9SA 1D5XC 2FFKB 2B2YC 3MXPA 3W5OA 4C2MH 4CHTB 3F2CA 3S1NB 3MAQA 1ILPA 1XNQL 2OEOA 4LFBL 1YNJC 1DZ1A 2L0CA 4LF9Q 3GTLB 1OXSC 1EIGA 1JQYD 1EZ8A 3MHBA 2VL6A 5CORA 4F8MA 1VQMA 3BJUA 3SK6A 2RCFA 3VYSA 4JI5L 3OHXC 1S40A 1X54A 1OXXK 1RCVD 1RF2D 2Z1CA 3HOWB 4DUZL 3AEVA 1CUKA 1BF4A 2MP1A 4QQBX 4C3IB 2R3ZA 1IW7C 1PFMA 4ZLTF 4DR2L 4C3HB 1A0IA 1TU2B 2MQHA 4IALA 4HIKA 1N36Q 2O5IC 2ZXPA 4A3LG 3D3RA 4GKJQ 4K6LA 2KVMA 2JE6I 3F1ZA 3RR5A 4R1JA 1L0YB 3PO2G 3U58A 4L5RC 1I4HA 3Q6SA 4V0BA 5M3FH 2IX3A 3OIQA 4WRDA 3I2ZA 4C1NI 2RSOA 1EIYB 1PH3A 2ZTCA 1HR0W 2NN6H 4ODGA 2SEBD 1DJRD 4B9XA 2F0NA 3Q8DA 1DM0B 3VYTA 1K0SA 4J15A 4HMJA 3CHBD 2KJXA 5FKAC 1HNXQ 3Q24A 4KMUC 4LW1A 1PH8A 4OWXB 1HZBA 4DR7L 4MHEA 3L7ZC 2L9HA 2GN5A 4IPDA 2KEEA 2AKWB 4JBKA 3S17B 4B3ML 4B08A 5C4ZA 3LGJA 2YYZA 3H6MA 3VR2A 3RZOH 4F88A 1BQQT 4OELB 1EU4A 3BDOA 1VQJA 2ZTEA 3HOYB 3A8KE 4DV1Q 1JMCA 4IUPA 1TWCB 2ALYB 3RZDH 4B3SL 1X55A 1N34Q 4A3LH 3TQYA 1E3PA 5IGEA 3NELA 5A2QL 2PZWA 3QWNA 3PO2H 1YHBA 1GM5A 1EQQA 2BDOA 4RHSA 3MFYA 2AQ3B 3AU7A 3VA5A 3T1YL 4BBSB 1Y8PB 2QEXA 4O1NA 4OXPA 5C0XI 2L55A 1XWEA 1M90C 2BOSA 4LF6Q 1YITA 3HKZG 2VUMB 1KC8C 1Y1VB 3KF8B 1GUOA 3KLSA 2KCCA 2EJGC 3U9SA 1XTDA 3H91A 5E3FA 2E2IH 5CC4A 1OO9B 1TWAB 3CC2A 3AQQA 1N8RC 4OWWB 1S5CD 2WACA 1PLFA 5IYBG 4KY7A 4ALPA 3RUZA 4OX9L 1MBYA 2D0PA 3OW2A 2KCMA 2L4NA 4HN7A 1YJNA 1UWVA 2MJ8A 3OW7A 4JCVE 2WV6D 2CH4W 5FLMG 1GUGA 2PCFB 5IYCG 1SFOB 2WKDA 4RMFA 3KOJA 1Q86C 4XQNA 1XNQQ 4LFBQ 3K5LA 1Y69U 1ESFA 1WCMG 1RTNA 3J7AF 3OWEB 3HEJA 1ZYRC 1W6JA 2K33A 3SXHA 1BCPF 4JI5Q 2VQFL 4FO2A 2NVQB 3CCEA 3OOCA 1EOVA 1STNA 1XYIA 3RLNA 2NUCA 1WTXA 3OTOL 4A4IA 4EQPA 2ZJPA 2WB1G 4DUZQ 1X6OA 3V05A 2UU9L 4B9WA 1NCVA 2C35B 3GTMB 3J7YW 4FF1A 3NQTA 4GLAC 3N6RA 4M1UB 2F0FA 3MXUA 3NBHA 5I2YA 3QIAA 1CKNA 5IYBH 1PA6A 4LF8L 3DLLA 1WOCA 3PQIA 4J1MA 1QE6A 3A5UA 2N8NA 3K0XA 1BCPB 3CAMA 2GA4B 1STGA 3L0OA 1DXMA 2XWJB 4ME5A 1IL2A 3WWVA 2DNCA 1I50H 4QY7A 2RDGA 5FLMH 1VQOA 5IYCH 4R4CA 4DK0A 1LTRD 1JC7A 4IOAA 3K5OA 1XNRL 1VQ6A 1MSGA 2D0OA 1TS2A 2J7ZA 3PF5A 3IAYA 1WCMH 2GVBA 1X9NA 1JB7A 2MGSA 4JBJA 3CC4A 1JORA 5IE8A 1E2VA 1QJOA 2EE1A 4RCNA 1SNCA 3G6JB 3CCMA 1XJVA 5KGUA 3HKSA 3I4MG 2OWOA 4B3MQ 2NBFA 3VYUA 1B44D 2ENBA 4DV5L 1EOTA 1CKMA 1TXYA 4TVAB 5C4JB 2HIVA 4UY8C 4JBWA 2EJFC 5I9OA 4S3SA 4FNFA 2F0VA 3KF6A 3IFTA 4DV0Q 4B3SQ 2N88A 4UP9A 1D6EC 3ERQA 4IQZA 1PH4A 4RKLA 4WJWA 2BH8A 1MI2A 3V2TA 1L1OC 3HP3A 5BN5A 1A3TA 2PMZE 3T1YQ 1VS0A 5E1FA 4K8JA 1JWUD 3HOXG 2VQEL 4FDBA 2F3VA 1IBKQ 3C2PA 4IOCA 1ET9A 4CJ0B 1GUTA 5J3BA 3AFQA 2AMCB 1ICWA 1Y1WB 2Q2UA 1T5XD 1Q81C 1SNDA 1TS3A 3BG3A 2RHSB 1B9NA 3K7UC 2DJGC 5C0XG 1MHWC 2KECA 2ICEC 3CMAA 1LACA 2HIXA 5DM63 3I4MH 2K03A 1U0LA 3R2TA 3VR4A 3M3YB 2Q2HA 5C0XJ 5JEAG 4ZUIA 5KNBA 1PV4A 5DNFA 5M5XB 4J8QA 2VY3A 1LTID 2OQKA 1SE3A 1UE7A 4DV7L 3GTOB 4WJ3M 2EYOA 2XN9C 1N33L 2GVAA 4K5XA 5EBCA 5JEAJ 3HOZG 4A93G 1BVSA 2EYJA 4FF2A 4DAYB 3GTQH 2HDMA 4KHPL 5KYLA 5JAVA 3EVQA 2VQFQ 1G8ZD 1HQMC 2MHVA 3MEFA 4DV6L 3IKJA 4LNQA 5M3MG 5FO7B 2DY7A 3HOXH 1EIFA 4C3JG 3GTJH 3S15H 4HIMA 3OTOQ 4NXNL 1HA5A 3HZXA 1UNSA 2UU9Q 1K83B 2YV5A 2NVTB 3A56A 4NP5A 4PZ8A 1AZQA 1TWFH 4RKBA 2K14A 1FNVA 2X6LA 1OXUA 5C4XB 3ITPA 1VQCA 3W2DA 1JJCB 3CMEA 3KF8A 1IL8A 5C0XH 1LTTD 4QF4A 3FMCA 4LF8Q 4FYDA 1M4VA 1SE2A 4HSPA 1CKOA 4JI3Q 3T56B 1B50A 1UE5A 2F3IA 3K6OA 1MJEA 4MNOA 2Y0SB 4Q0FA 3JAMc 3UI2A 5JEAH 3CCJA 1LV9A 4JOIA 4X3TA 2Z6KA 4BY7B 1KNEA 1VQFA 2F4IA 2R7DA 3DWAA 1XNRQ 1TWGB 1STHA 3NTHA 4LMQD 1A2TA 4DA2A 1PHJA 4X6AH 3HOZH 1HHVA 5NUCA 4A93H 1RJTA 2KHSA 1CQFA 2Z4HA 1BNZA 3EIVA 4GOPC 3K5NA 1SLJA 4A3CG 1GUSA 4DV4Q 5M3MH 1XPOA 4DV5Q 4L6TB 1WVLA 4C3JH 4XDXA 4HCSA 3TZDA 5IODA 4N9TA 4Y7NH 4QCLA 2D9UA 4IN3A 1C0AA 5EPKA 1YI2A 1DD2A 4PNYA 4XYOA 1HQRD 3QOLA 1ONLA 2XRSD 4JI0L 5CV5A 3E9HA 2F0LA 4JC0A 2DUDA 4ILWA 2VXWA 1SJHD 1S5BD 3TRZA 3KJOA 1LABA 3H3VC 4HMIA 2A1AA 5IGDA 1Q8KA 3J80i 3M4PA 2B2TA 5KNDA 1D1KA 2PO4A 3M4OH 2IHFA 2N78A 2KBNA 1KNAA 2K4KA 5FOBB 2VQEQ 3E0JA 1SYGA 3S1QH 3PCOB 2JQOA 1JOKA 4CDEC 5M5YH 3U50C 1K8GA 3S16H 1EYDA 2HD3A 2O2LD 3GD7A 2F0OA 4KV6A 1K73C 1G291 4R8IA 1EFWA 2L11A 1KDBA 2XGTA 2A8VA 4A3CH 1B9MA 1F2YA 2B2WC 4L8JA 1R9TH 1STYA 1G51A 2JA5G 2JEBI 3S14H 2WAQB 3PIPA 2ZJQA 2YU9B 1MJCA 4X62L 3TMEA 3HKZE 4EQNA 3A0JA 2CKZB 1VQLA 1G91A 3C1EA 4DV7Q 4CDCC 4A3DG 1Y8OB 1N33Q 4UPAA 4GNXC 3PUVA 3VA7A 2HCIA 1TQOA 2ICIA 1GD7A 2F0MA 2G9HD 4DV6Q 4KJNA 3K7AH 2QKIC 1WTOA 2DJFC 4K14A 5ISRA 1Z7TA 4ABNA 1NR2A 1WTPA 4A3EG 4NXNQ 3UDXA 3GTPH 5J22A 3GV3A 3IL8A 4ULLA 5DLQE 3A8IE 5KNCA 3D6CA 4GN3B 3T13A 4YY3L 4YCVA 5IGGA 3PV0A 5EPJA 3IFDA 2ZM6L 1AH9A 1RL2A 1PDQA 1AW7A 2LS01 1MGSA 5C44B 1YIJA 1X3PA 3DEOA 4F7XA 1QG7A 2QCPX 2JA5H 1WJJA 2UUCL 3HOWG 2F0IA 3ND8A 1I94Q 4K5VA 1AFPA 4C3IG 2FHTA 3CCUA 2WB1E 1C8CA 4OHJA 1SR3A 2QW7A 4C3HG 4JI2L 4KHVA 1STEA 1KL9A 1EY7A 4YHHL 3SE0A 1V8QA 4A3DH 4DR5L 3DEPA 3KLRA 3LX0A 1UUPA 1ET6A 3MWYW 1YZ6A 3HGBA 1Z47A 4HSVA 1B4OA 1KAAA 4K2KA 3U4ZA 4QIWE 1NNXA 1C48A 3A7LA 3KDFB 4A3EH 1NMGA 2NTSA 2RVLA 3BZDB 5ELCA 4DR6L 2QA4A 4RFBA 1G2TA 1GO3E 1QVGA 4JI1L 4JI0Q 2PQAA 3QR8A 2F0GA 3GTLH 1KRSA 4KK7A 1VQ8A 1FL0A 2QGQA 4CBVA 4BWGB 1KRTA 2XWBB 1IBLL 1I4GA 4DR1Q 2F0DA 4CDDC 4GLVB 3E3XA 2R6GA 3MXNB 4BY1B 3I4NB 3HOWH 3D31A 1ZEQX 3BYYB 2Z9HA 1E2WA 4C3IH 3HOYG 3OMGA 2JA7B 3P1HA 3FVQA 4XYQA 3VR3A 3NP8A 1H9SB 5GADC 4C3HH 2NB0A 1NMFA 2A68C 3J7ZC 2XTIA 2PW7A 2LKVA 3G7LA 4P71A 4DNRB 1YVCA 2RQXA 1SNQA 1A2UA 2B39A 3O13A 3PSIA 3A5ZB 1IHZA 3I7FA 2A6EC 4RCOA 1VQGA 2M00A 4H13C 3QJYA 2BA1A 4BBSG 4KTAA 2A6HD 1L0WA 3CD6A 1EY0A 1U4MA 1CHPD 2IJ0A 4GN4B 2VB2X 2EY6A 2VUMG 2I46A 2OF1A 3A8JE 1HNZL 1Y1VG 4DUYQ 2QF7A 3FPUB 2NZOA 1WTRA 4OGQC 1NY4A 3DUZA 1EWIA 4QJFA 3J80L 3CW2C 1E24A 4ZYSA 1B7YB 2MNAA 3CU7A 1SMYD 4YIJA 1VQAA 1F9RA 3CCLA 4YWKA 2C5CA 2J0TD 5ELFA 5KYIA 2K75A 3S17H 5JJKA 5KRUA 1SYCA 1PFBA 4EVOA 4BS9A 3K57A 5TSSA 2KENA 3HOYH 3S24A 2VW9A 2B2VC 1HUNA 4DR3Q 2I5MX 3NK9A 2BE5D 5FLXL 1L1OB 1BO0A 1U9RA 4LF4L 1TWCH 3BVZA 4IFDI 1IKLA 1SYEA 3S2DB 3MZ5A 1EYAA 3OYYA 3VR5A 4YY3Q 2JYOA 4DKAC 3RN2A 2F0KA 1IXRA 1VQPA 2ZM6Q 1YNXA 3H09A 1LTBD 5IT9c 1I3QB 4BBSH 5E4XA 1HTPA 1MD2D 2F3WA 2ZXRA 1I5FA 1YJWA 4H7BA 2LMCB 3EFXD 4YWMA 2A19A 2QDBA 3NEMA 1K9MC 4K0KL 4A3JB 2KHIA 2MFIA 2VUMH 4IPGA 1KD1C 1N32L 3TP7A 3AYHB 2UXBL 1K8AC 1PYSB 1SYDA 1QVFA 2NZ1D 2R61A 4LFAL 1K8MA 2UXCL 2V4DA 3TS0A 4YHHQ 1TWAH 5ELBA 1BCPD 2D5DA 3I8ZA 4DR5Q 3WOFA 5I4DA 1FGBD 1AE2A 3JAME 2MO1A 3PIP3 4PV1C 1EY6A 1QZHA 1QNUA 1XMQL 3PO3B 4LF5L 5HGQA 2LY7A 3RLOA 1Q3LA 5M5WB 4JI8L 3G71A 3V96A 1J6QA 1O78A 4DR6Q 1SFOH 3FPPA 1NSNS 4JI1Q 1CSQA 1WTHA 4BA1I 4HJ5A 4RA8A 2N55A 2K04A 5LMNL 1W3SA 2KCTA 3I72A 2KOLA 4X3UA 1PRTD 1CT1D 2NVYB 1PZJD 2I5LX 4NPSA 3HOVB 4XQJA 1FVIA 1PTOF 1PYWD 2F0TA 2NVQH 1IYJB 1WI5A 5EKKA 3T53B 1LUZA 2EZVA 1VMPA 1AN8A 3J80c 4UP7A 2IY5B 3GTMH 3VDYA 4DNIA 3M4YA 1YBYA 2N49A 3G6EA 4U68A 4QL5A 1LT3D 4DR2Q 3P75A 1EY4A 3T1HL 3W3AA 4MZ9A 3KUPA 3FKIB 1SSOA 1F77A 1SRUA 4A76A 3F8TA 1B1ZA 4XT1B 1SNOA 1STAA 1PTOB 1H9MA 4ME3A 2JA6B 2JA8B 1K0RA 2IWHA 3STBC 1GKHA 2RHQB 5K36G 2E2JB 2KHJA 3NENA 4LK1C 2R92B 2FMMA 3NSWA 1LM0A 1WTVA 5HY6A 4X66L 5DEHA 3BDLA 2LXJA 2XVSA 3KLSX 4KHZA 4KD4A 1HNZQ 5GROA 1VQEA 4GOPB 4GS3A 5LL6S 1LTLA 4X64L 1O7ZA 1Y1WG 4NW2A 1STBA 2R7ZB 1DYQA 5IYDG 1JCKB 1SROA 3L3OC 1UE1A 4DNTB 3K58A 5BN3A 1I4PA 1IZ6A 3S2HB 3K80C 3RNUA 3IRBA 4HIOA 1YEZA 5IGCA 4DR7Q 2OTLA 1EY9A 3J81i 2MUYA 2H1EA 2E2HB 1HZCA 3SGIA 1TT2A 1YNND 1LLRD 1ZKOA 3H0GB 1LTSD 2CFMA 4ZQ3A 2Q8RE 4Q5VA 1JOQA 5CBAE 3S1RB 4LF4Q 1H9SA 5COYA 5KIXA 4IUTA 1NJIC 2CWAA 4AYBE 3CPWA 3I91A 2O4XA 1JWSD 1SAPA 1BR9A 2Z0SA 4FXKC 5C3XA 1GHKA 1CA5A 1CFMA 4A3FB 5K36H 4L5TA 1E0BA 4IFDG 4L5QA 4CJ1B 1C9OA 5JPMC 5CV6A 4G7HC 1HZAA 4A3KB 1PMRA 1OXTA 4M8AA 1W2BA 2KA7A 4IURA 1ICFB 1N32Q 2UXDL 2UXBQ 4YCUA 2EY5A 1Y1WH 5FO8B 4IFDJ 2H5XA 5IYDH 1I4XA 4LFAQ 5C4XG 1E7ZA 2HDLA 1T9HA 2A73B 2FINB 3BS1A 4ZUJA 1KXLA 4IJLA 4G57A 1IBML 4ZKBB 3UE0A 4FP5D 4R8NA 2Q2IA 1SE4A 3NTIA 1XMQQ 5EPLA 5J39A 3EN2A 4LF5Q 3M3YH 3M4QA 4OX9Q 1V1PB 4HAEA 4MN3A 3AMUA 2Y0SG 1PVOA 3VR6A 4BY7G 1ESRA 5M5XH 3FEWX 3GTGB 4JPBW 4A3GB 1X3GA 2XSCA 4GNXB 2R93B 2RA4A 3PMFA 5LMUL 3GTOH 5GAHC 4FXGC 3KK7A 2EY1A 2K32A 3TP5A 1EQRA 4JYAL 2A6HC 2JP1A 3HFZB 5GAGC 1ASZA 3DXJC 3S1MB 1EIHA 4DK6C 5CV9A 3B6YA 3EJIA 2IX0A 1H9RA 2EXDA 4UHVA 1BBXC 4IFDH 2JJQA 1EWCA 5CV8A 2YTVA 1K3RA 4PG3A 2CCZA 1A3VA 1GJXA 1K83H 2NVTH 4J6HA 3MFGA 1SMYC 2ZTDA 3E9IA 3BU2A 4A3MB 3NWSA 2E74C 3H94A 4QUFA 5C4XH 4JOIC 2L12A 2WFWA 2Z6KC 1KIXA 3T1HQ 2IX1A 2IHEA 4A3IB 1BUVT 3NBIA 1NBWA 4CDFC 4LUZA 4F87A 1JWMD 1V1QA 3FP9A 3M9BA 1DOMA 4HJ9A 3MC0B 1P8LA 3GTJB 1JE4A 3GP7A 2OCEA 3CQZB 4I7ZC 3UDFA 4HIDA 3UE1A 4X66Q 4BY7H 4YCWA 3TEHB 1M1KC 3KLWA 1KDCA 3A55A 1B2TA 4TSSA 4GZYC 1B53A 1TWFB 1TWGH 5I6WA 4G7OC 1T5EA 4X64Q 4HEDA 2XNAC 1Q7YC 1YHQA 2PW5A 4KKSA 1TWHB 1CTMA 1XXGA 1LYLA 4OL7A 2EYFA 1DONA 1EQTA 5C3EB 4C1NK 1KLUD 4DR4L 1D7QA 1UAPA 3C3LA 1TS5A 4DK3C 1DOKA 2DN8A 4KI0A 4X65L 2B2TC 4KJOA 2WAQG 1BCPC 1HUMA 4DAMA 4V190 4GN5A 5DAUA 2CQAA 3CXCA 3WOEA 3GV6A 1FNWA 2B63B 1S4ZA 1BKBA 3OSOA 2CHBD 2D2CC 5C3WA 3M7GA 4KY5A 3BVMA 5KEEA 1TS4A 2EYLA 3CRKC 2H4OA 4NKLA 5CYUA 1CHQD 2IL8A 1EQVA 1ENFA 1U4LA 4O0AA 4P73A 4U673 5EBDA 1SNPA 4KN7C 4JI6L 1HCZA 4LUOA 2FMCA 4K6DA 1PRTC 1J9OA 2UXDQ 3R93A 2E76C 3K81C 2O5JC 5IT9E 4OO1I 3J81L 2J4XA 4EQ5A 2EPBA 4P75A 2NVXB 2EYHA 1M8AA 1IBMQ 1D2BA 4O42A 2B2UA 4G4KA 1J5EL 2EYPA 3R2IA 4UP8A 4H44C 4TQUS 5C44G 3MXGA 4NXML 3BZKA 2K5NA 1E2ZA 2EQSA 5IP9G 2JSOA 2OT2A 3HG9A 1HJPA 2YU9H 1UEBA 4PZ7A 4R4TA 3SK4A 5JJIA 5LMUQ 1A6XA 1A62A 2ASBA 1F9PA 3RMHA 3PGZA 4JYAQ 3PF4A 4O2DA 2RDHA 3GO5A 3EBEA 1U5KA 3HRZC 1EY8A 4KHPQ 1EWHA 1VQ9A 3TSSA 1ZYRD 2K5VA 1D5ZC 1L0XB 4E6IA 1PXUA 1OTCA 1UE6A 1KHIA 1JOOA 3U9OA 1E22A 2FXQA 3LWEA 4FF4A 3Q23A 2LFNA 1HH2P 1KQSA 1HTLD 3ULJA 1BBWA 2QILA 2N3SA 1PH2A 5EKIA 3F2BA 3J81j 2G9DA 5D14A 1AP0A 2AWNA 2I0QA 3X3MA 3J80E 1YNNC 3P20A 1SE8A 1I6HB 3NHHA 3D8GA 3HOUB 5C44H 4OIKA 1HFNA 4BY1G 3I4NG 4DU9A 5IP9H 1RTOA 1GUNA 2V1CC 1W6KA 3TBIB 1VF7A 3KBGA 1LT5D 2JA7G 1L2FA 4B3TL 1GVPA 4HCEA 4G7ZC 1E1TA 5FLXE 2Q8IB 1C7YA 1PH7A 2F03A 1S5ED 3D4WA 3DM1A 1Q1EA 2K50A 1CI3M 2Z8LA 3EQLC 2BDNA 5A2QE 4DR4Q 5JVH3 4DAYA 4APVA 1HPCA
chains in the Genus database with same CATH topology
2X6GA 5E4WC 3GTKB 5G3LF 2EOTA 2KCNA 4AYBB 1NUCA 2D62A 2PZUA 4ZKCB 4A3BB 5HURA 2A74C 1D1IA 5BN4A 4IUUA 2PMZB 3CKIB 5CGKA 4KKTA 2RBMA 5A35A 2BA0A 5I9PA 1ML0D 3SK8A 4DN4M 1SNMA 1GHJA 4BBRB 1AEXA 1O7YA 3BYTB 1CK1A 3K59A 1J8IA 1EEID 1VF5C 1NAPA 4C2MB 4WORA 1B3AA 3A54A 2NYZD 3FDTA 3TP8A 4HTHA 1CA6A 2E2DC 4RHRA 3LWUA 1LT4D 4EQOA 5C5MA 2WINB 3OMCA 4K5WA 4OO1G 1ENAA 1FD7D 3C1FA 2TSSA 2B2YA 1QNKA 1ENCA 3M7NA 1LT6D 3P7JA 3SDZA 4RH6A 2F0HA 4R9WA 5C6AA 2L1BA 3C46A 4HR7B 1BXTA 1OXVA 1F2LA 2AUKA 5M3FB 2SNSA 4XTCS 4PMCA 1WTQA 4BA2I 3R3OA 2EJMA 1HXYD 4RGTA 5JOBA 1R4QB 3SR1A 2VNUD 4XIGS 2B8GA 4ZK9B 3I4LA 4RGOS 4L63B 5EQ0A 3M85A 4JK1C 2WIIB 3ONAB 3PUXA 5ELDA 4OO1H 3BDCA 1Q12A 2F0EA 1QB5D 3RZOB 4XQQA 3SEBA 1F2ZA 2F0SA 2ID0A 2ZT9C 2EDGA 1IKMA 1PTOD 2CW0D 3RZDB 2SNMA 3DWQA 4EGVA 1K8OA 1RD9D 4ID6A 3PO2B 2BCOA 3HS0C 5M9OA 1TR5A 1CZGA 2B2VA 3L9AX 2MPMA 4UDUC 2WKCA 1X32A 5F2DA 5LHY1 1LTGD 1DOLA 3NE5B 3SVMA 1SEBD 1DCZA 1LO5D 2ZXOA 4ZAIA 4PQXA 4CJ2C 2E2IB 1GXDC 2A69D 3MTSA 1TY2A 4K8IA 5I6YA 1O80A 2HUGA 2K5QA 5CR3A 3VYRA 3PUYA 1AZPA 4XT3B 1TY0A 2QEJC 1CQVA 3TN2A 1WD0A 1EYCA 1UEAB 3GQBA 4TKOB 1PTOH 2IPKD 4QUCA 2XRQD 1SYBA 2NTTA 1Q90A 5CV4A 4DK1A 3K5MA 3MEHA 5IGFA 4XXEA 1F2MA 1VMCA 3Q22A 5IOCA 1Z6HA 3HKZB 3NPPA 2XIWA 5ELEA 3X3NA 2EXZA 3NQIA 5EGTA 5AFWA 3EROA 3WDNA 4PMWA 5FK9C 2AWOA 4QB4A 5IGBA 2K1BA 1JB3A 1PRTF 1SXTA 1BOSA 3DMUA 3FRPB 2F1MA 1ILQA 3MXNA 1I4QA 1I50B 1Q8IA 1O7LA 5CMDA 2EVBA 5C5LA 3T16A 4NDXA 3NWTA 1TIID 4IUNA 1ZXTA 3SHLA 5CBEE 1WCMB 4TRDA 3D4RA 3OIPA 4C56C 1PRTB 4NMZA 2JEAI 2F0WA 2FJ2A 4CGYB 2F0UA 5JVG3 2WB1B 2RKSA 3PUZA 2F0JA 1CZWA 2A5HA 3QB3A 3JAML 2CVRA 1NR4A 2HCCA 1G2SA 1X3QA 4P2CB 2KQ3A 3I73A 1FNUA 3D4DA 4QIWB 3EA6A 2WP8J 1KABA 4RGNA 5C4HA 4CKBA 2EY2A 1G6ZA 3CRLC 1KTKA 1I6VC 3LNNA 3TP6A 3DWPA 4DAPA 2PQEA 4DXFA 3QO2A 3RLFA 5K5PA 1JICA 2L5TA 3T4AC 1EU3A 3J81E 2C9OA 4K2LA 1LTAD 1PZKD 5FO9B 1YNJD 1KLGD 5HGTA 3OPOA 3I4MB 3R8BA 1Q1BA 2PZTA 5D65A 2IT1A 3NUCA 4I65A 3AB9A 2JXMB 2KUMA 4FF3A 5T1IA 4X3KA 3TDQA 1SBBB 1EY5A 4OIJA 2B8FA 2A68D 1HFGA 2KEDA 3NXWA 1IW7D 2RDFA 5JPNC 4IZ8A 3GTQB 2A6ED 4PMBA 2BE5C 5EKLA 5DM73 2K6AA 3HOXB 2AUJD 1EL0A 1RODA 3S15B 1XTCD 5I2XA 1A3UA 3PIO3 3URYA 5D3DA 4IUQA 2F0QA 4KN4C 3I3CA 4RAUC 4X3SA 3BVGA 4DAVA 1PZID 1EFID 5LL6X 1C4QA 2EYMA 2PNRC 4Z9CB 3KBXA 1PTOC 2CW0C 1H9KA 4IUVA 3RD4A 3OWFA 5IIFA 1V43A 1TKWB 2NN6I 2DY8A 2HQEA 1WTWA 1SDFA 3HOZB 2M2LA 1RDPD 1XX8A 4A93B 2M9VA 3PUWA 2I07B 4DXGA 4CKCA 3MVVA 2B2UC 5M3MB 1R4PB 4MIUA 1II3A 1HA6A 4C3JB 1VCIA 4UAIA 3TZUA 1PFNA 1BDOA 4Y7NB 1SYFA 2Q8TA 2A69C 1U4PA 1GUWA 5EJWA 3Q0AA 1KDAA 2NWGA 4KD3A 4ZRZA 1I4RA 4N9PA 4FXDA 2E75C 1QILA 2K5DA 4LJZC 1TVXA 5CV7A 2K05A 3M4OB 3J7AV 3S1QB 5M5YB 2K5WA 1MSHA 3S16B 2K28A 1S5DD 3I70A 3ZYYX 1IYUA 3F2UA 2AQ2B 1SJED 2F0PA 2IW3A 3E6ZX 3QG1A 2Z4IA 2SOBA 1V1OA 1EEFD 1S5FD 1WD1A 2RSNA 1R9TB 3N52A 1VDZA 2SDFA 3S14B 1FYCA 3T51B 2K7VA 1A15A 2OXPA 1JR0D 5T1GA 3DHQA 2B2WA 5J1ZA 3NTKA 2PYKA 5G3LD 2X69A 4RWSC 3QOJA 2TMPA 4CKEA 1QOHA 3K7AB 2K01A 4RGMA 3I90A 1V1PA 4KY6A 1F9QA 3GTPB 3D6WA 3S9WA 4DGZA 1EZ6A 1GOZA 4DF7A 1RHPA 1CM9A 1HRJA 4LAAA 1U4RA 3A7AB 3MA2B 1RKNA 1FR3A 2AQ1B 3E5SA 4WFN3 2JA5B 4DFAA 2DNEA 3SK5A 1H9JA 2VB3X 2PPBC 4A3DB 5JJZA 5D3IB 4FVMA 4QMGA 3K0YA 3ND9A 5IT9L 1IYVA 1QCBD 1Y8NB 1QWYA 2NN6G 1D5MC 4A3EB 4H0LC 4KKUA 1F9SA 1D5XC 2FFKB 2B2YC 3MXPA 4CHTB 3S1NB 1ILPA 3MAQA 2OEOA 1YNJC 1DZ1A 2L0CA 3GTLB 1OXSC 1EIGA 1JQYD 1EZ8A 3MHBA 5CORA 4F8MA 3SK6A 3VYSA 3OHXC 1OXXK 1RCVD 1RF2D 2Z1CA 3HOWB 1BF4A 2MP1A 4C3IB 2R3ZA 1IW7C 1PFMA 4ZLTF 4C3HB 1TU2B 4IALA 2O5IC 2ZXPA 3D3RA 4K6LA 2KVMA 2JE6I 1L0YB 1I4HA 3Q6SA 4V0BA 2IX3A 3OIQA 4WRDA 4C1NI 2RSOA 2NN6H 4ODGA 2SEBD 1DJRD 4B9XA 2F0NA 1DM0B 3VYTA 4HMJA 3CHBD 2KJXA 5FKAC 3Q24A 4KMUC 4MHEA 3L7ZC 2L9HA 2KEEA 3S17B 4B08A 5C4ZA 2YYZA 3H6MA 3VR2A 4F88A 1BQQT 1EU4A 3BDOA 3HOYB 3A8KE 4IUPA 1TWCB 5IGEA 5A2QL 2PZWA 3QWNA 2BDOA 4RHSA 3MFYA 2AQ3B 3VA5A 3AU7A 4BBSB 1Y8PB 4O1NA 5C0XI 2L55A 1XWEA 2BOSA 2VUMB 1Y1VB 1GUOA 3KLSA 2KCCA 2EJGC 3U9SA 3H91A 5E3FA 5CC4A 1OO9B 1TWAB 1S5CD 2WACA 1PLFA 4KY7A 3RUZA 1MBYA 2L4NA 4HN7A 2MJ8A 3OW7A 2WV6D 1GUGA 2PCFB 1SFOB 2WKDA 4XQNA 3K5LA 1Y69U 1ESFA 1RTNA 3J7AF 3OWEB 3HEJA 1ZYRC 1W6JA 2K33A 3SXHA 1BCPF 4FO2A 2NVQB 3OOCA 1STNA 1XYIA 2NUCA 1WTXA 4EQPA 3V05A 4B9WA 1NCVA 3GTMB 3J7YW 4FF1A 3NQTA 3N6RA 4M1UB 2F0FA 3MXUA 3NBHA 5I2YA 3QIAA 4J1MA 1QE6A 1BCPB 2GA4B 1STGA 1DXMA 2XWJB 4ME5A 2DNCA 2RDGA 4DK0A 1LTRD 1JC7A 3K5OA 1MSGA 1TS2A 2J7ZA 3IAYA 2MGSA 1JORA 1E2VA 1QJOA 2EE1A 4RCNA 1SNCA 3G6JB 5KGUA 2NBFA 3VYUA 1B44D 2ENBA 1EOTA 5C4JB 4JBWA 2EJFC 5I9OA 4S3SA 2F0VA 4FNFA 3IFTA 2N88A 1D6EC 3ERQA 4IQZA 4RKLA 4WJWA 1MI2A 3V2TA 3HP3A 5BN5A 1A3TA 5E1FA 4K8JA 1JWUD 2F3VA 3C2PA 1ET9A 4CJ0B 1GUTA 1ICWA 1Y1WB 1T5XD 1SNDA 1TS3A 3BG3A 1B9NA 5C0XG 2KECA 2ICEC 1LACA 5DM63 2K03A 3R2TA 3VR4A 3M3YB 5C0XJ 5JEAG 4ZUIA 5KNBA 5DNFA 5M5XB 4J8QA 1LTID 1SE3A 3GTOB 2EYOA 2XN9C 4K5XA 5EBCA 5JEAJ 2EYJA 4FF2A 2HDMA 5KYLA 5JAVA 3EVQA 1G8ZD 1HQMC 2MHVA 3IKJA 5FO7B 2DY7A 4C3JG 1HA5A 3HZXA 1UNSA 1K83B 2NVTB 3A56A 4NP5A 1AZQA 4RKBA 1FNVA 2X6LA 1OXUA 5C4XB 3ITPA 3W2DA 3KF8A 1IL8A 5C0XH 1LTTD 4QF4A 3FMCA 4FYDA 1M4VA 1SE2A 4HSPA 3T56B 1B50A 3K6OA 2Y0SB 4Q0FA 3UI2A 5JEAH 1LV9A 4X3TA 4BY7B 1KNEA 2F4IA 3DWAA 1TWGB 1STHA 3NTHA 4LMQD 1A2TA 4DA2A 1HHVA 5NUCA 1RJTA 2KHSA 1CQFA 2Z4HA 1BNZA 3K5NA 1GUSA 4L6TB 1WVLA 4XDXA 4HCSA 3TZDA 5IODA 4N9TA 4QCLA 2D9UA 4IN3A 5EPKA 1DD2A 4PNYA 4XYOA 1HQRD 3QOLA 1ONLA 2XRSD 5CV5A 2F0LA 4ILWA 2VXWA 1SJHD 1S5BD 1LABA 3H3VC 4HMIA 5IGDA 5KNDA 2B2TA 1D1KA 2PO4A 1KNAA 5FOBB 3E0JA 1SYGA 1JOKA 1EYDA 2O2LD 3GD7A 2F0OA 4KV6A 1G291 4R8IA 2L11A 1KDBA 1B9MA 1F2YA 2B2WC 4L8JA 1STYA 2JEBI 2WAQB 2YU9B 3TMEA 4EQNA 1G91A 3C1EA 1Y8OB 3PUVA 3VA7A 2HCIA 1TQOA 2ICIA 2F0MA 2G9HD 4KJNA 2QKIC 1WTOA 4K14A 5ISRA 1Z7TA 4ABNA 1NR2A 1WTPA 5J22A 3GV3A 3IL8A 4ULLA 3A8IE 5KNCA 3D6CA 3T13A 5IGGA 3PV0A 5EPJA 3IFDA 1PDQA 1AW7A 2LS01 1MGSA 5C44B 1X3PA 3DEOA 4F7XA 1QG7A 2QCPX 2F0IA 3ND8A 4K5VA 1AFPA 4C3IG 2FHTA 1C8CA 4OHJA 4C3HG 4KHVA 1STEA 1EY7A 3SE0A 1V8QA 3DEPA 3KLRA 3LX0A 1UUPA 1ET6A 3MWYW 3HGBA 1Z47A 4HSVA 1B4OA 1KAAA 4K2KA 1C48A 3A7LA 2NTSA 2RVLA 3BZDB 5ELCA 4RFBA 1G2TA 2F0GA 4KK7A 4CBVA 4BWGB 2XWBB 1I4GA 2F0DA 2R6GA 4BY1B 3I4NB 3D31A 1ZEQX 3BYYB 1E2WA 3OMGA 2JA7B 3P1HA 3FVQA 4XYQA 3VR3A 3NP8A 1H9SB 2NB0A 2A68C 2PW7A 2LKVA 3G7LA 4DNRB 2RQXA 1SNQA 1A2UA 2B39A 3O13A 1IHZA 2A6EC 4RCOA 2M00A 4H13C 3QJYA 2BA1A 4KTAA 2A6HD 1EY0A 1U4MA 1CHPD 2IJ0A 2VB2X 2EY6A 2I46A 2OF1A 3A8JE 2QF7A 3FPUB 1WTRA 4OGQC 3J80L 3DUZA 4ZYSA 3CU7A 1SMYD 4YIJA 1F9RA 2C5CA 2J0TD 5ELFA 5KYIA 5KRUA 1SYCA 1PFBA 4EVOA 4BS9A 3K57A 5TSSA 2B2VC 1HUNA 3NK9A 2BE5D 5FLXL 1BO0A 1U9RA 3BVZA 4IFDI 1IKLA 1SYEA 3S2DB 3MZ5A 1EYAA 3VR5A 2JYOA 2F0KA 3H09A 1LTBD 1I3QB 5E4XA 1HTPA 1MD2D 2F3WA 2ZXRA 4H7BA 2LMCB 3EFXD 2QDBA 4A3JB 3TP7A 1SYDA 2NZ1D 2R61A 1K8MA 2V4DA 5ELBA 1BCPD 2D5DA 3I8ZA 3WOFA 5I4DA 1FGBD 3JAME 3PIP3 4PV1C 1EY6A 1QNUA 3PO3B 2LY7A 1Q3LA 5M5WB 3V96A 1O78A 3FPPA 1NSNS 4BA1I 4RA8A 2N55A 2K04A 3I72A 2KOLA 4X3UA 1PRTD 1CT1D 2NVYB 1PZJD 3HOVB 4XQJA 1PYWD 1PTOF 2F0TA 5EKKA 3T53B 2EZVA 1VMPA 1AN8A 3M4YA 4U68A 1LT3D 3P75A 1EY4A 3W3AA 3KUPA 3FKIB 1SSOA 1F77A 1B1ZA 4XT1B 1SNOA 1STAA 1PTOB 1H9MA 2JA6B 2JA8B 2IWHA 5K36G 2E2JB 4LK1C 2R92B 2FMMA 3NSWA 1WTVA 5DEHA 3BDLA 2XVSA 3KLSX 4KHZA 4KD4A 5LL6S 1O7ZA 4NW2A 1STBA 2R7ZB 1DYQA 1JCKB 3L3OC 4DNTB 3K58A 5BN3A 1I4PA 3S2HB 5IGCA 1EY9A 2MUYA 2H1EA 2E2HB 1TT2A 1YNND 1LLRD 1ZKOA 3H0GB 1LTSD 4ZQ3A 2Q8RE 4Q5VA 1JOQA 5CBAE 3S1RB 1H9SA 5COYA 5KIXA 4IUTA 3I91A 2O4XA 1JWSD 1SAPA 1BR9A 4FXKC 5C3XA 1GHKA 1CA5A 1CFMA 4A3FB 5K36H 1E0BA 4IFDG 4CJ1B 5JPMC 5CV6A 4G7HC 4A3KB 1PMRA 1OXTA 4M8AA 2KA7A 4IURA 2EY5A 5FO8B 4IFDJ 1I4XA 2HDLA 2A73B 2FINB 3BS1A 4ZUJA 4G57A 4ZKBB 4FP5D 4R8NA 1SE4A 3NTIA 5EPLA 5J39A 1V1PB 4HAEA 4MN3A 3AMUA 3VR6A 1ESRA 3FEWX 3GTGB 4A3GB 2XSCA 2R93B 2RA4A 3PMFA 4FXGC 3KK7A 2EY1A 2K32A 3TP5A 2A6HC 2JP1A 3DXJC 3S1MB 1EIHA 5CV9A 3EJIA 2IX0A 1H9RA 4IFDH 1BBXC 1EWCA 5CV8A 1A3VA 1GJXA 4J6HA 3MFGA 1SMYC 4A3MB 3NWSA 2E74C 3H94A 4QUFA 2L12A 2IX1A 4A3IB 1BUVT 3NBIA 4F87A 1JWMD 1DOMA 3MC0B 3GTJB 1JE4A 3GP7A 3CQZB 4I7ZC 1B2TA 1KDCA 3A55A 4TSSA 4GZYC 1B53A 1TWFB 5I6WA 4G7OC 1T5EA 4HEDA 2XNAC 2PW5A 4KKSA 1TWHB 1CTMA 1XXGA 4OL7A 2EYFA 1DONA 1EQTA 5C3EB 4C1NK 1KLUD 1UAPA 3C3LA 1TS5A 1DOKA 2DN8A 4KI0A 2B2TC 4KJOA 1BCPC 1HUMA 4V190 5DAUA 2CQAA 3WOEA 3GV6A 1FNWA 2B63B 1S4ZA 3OSOA 2CHBD 2D2CC 5C3WA 3M7GA 4KY5A 3BVMA 5KEEA 1TS4A 2EYLA 3CRKC 2H4OA 4NKLA 5CYUA 1CHQD 2IL8A 1EQVA 1ENFA 1U4LA 4U673 5EBDA 1SNPA 4KN7C 1HCZA 2FMCA 4K6DA 1PRTC 1J9OA 3R93A 2E76C 2O5JC 5IT9E 4OO1I 3J81L 2J4XA 2EPBA 2NVXB 2EYHA 1M8AA 1D2BA 4O42A 2B2UA 4G4KA 2EYPA 3R2IA 4H44C 4TQUS 3MXGA 1E2ZA 2JSOA 2OT2A 3HG9A 3SK4A 1A6XA 1F9PA 3RMHA 2RDHA 3GO5A 3HRZC 1EY8A 1EWHA 3TSSA 1ZYRD 1D5ZC 1L0XB 4E6IA 1PXUA 1JOOA 3U9OA 3LWEA 4FF4A 3Q23A 2LFNA 1HTLD 2QILA 5EKIA 2G9DA 5D14A 1AP0A 2AWNA 3X3MA 3J80E 1YNNC 3P20A 1I6HB 3NHHA 3D8GA 3HOUB 4OIKA 1HFNA 4DU9A 1RTOA 1GUNA 3TBIB 1W6KA 1VF7A 3KBGA 1LT5D 4HCEA 4G7ZC 5FLXE 2Q8IB 2F03A 1S5ED 3D4WA 3DM1A 1Q1EA 1CI3M 2Z8LA 3EQLC 2BDNA 5A2QE 5JVH3 4DAYA 1HPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQE A;  3ERQ A;  4RKL A;  4J6H A;  2F0D A;  5CV4 A;  5IGC A;  1SYD A;  3C1E A;  5K5P A;  1EY9 A;  3MEH A;  3MVV A;  4WRD A;  3V2T A;  2EYP A;  5IGF A;  4DU9 A;  1F2M A;  4MIU A;  1TT2 A;  1NUC A;  1A3T A;  1II3 A;  2PZU A;  4DGZ A;  5IOC A;  3S9W A;  4K2L A;  3OMG A;  4ODG A;  3P1H A;  1EZ6 A;  3NP8 A;  5E1F A;  1TQO A;  4B9X A;  4K8J A;  5HGT A;  1STH A;  5HUR A;  3BDC A;  1SYF A;  2F0M A;  1EY6 A;  2F0N A;  4ZQ3 A;  4DF7 A;  1JOQ A;  2EXZ A;  2F0E A;  1A2T A;  2PW7 A;  4KJN A;  4LAA A;  5EGT A;  2LKV A;  4K14 A;  1RKN A;  5NUC A;  2F3V A;  2PZT A;  3ERO A;  2KHS A;  3HEJ A;  3E5S A;  4HMJ A;  5KIX A;  5ISR A;  5CGK A;  3SXH A;  3NUC A;  1SNQ A;  1F2Z A;  1A2U A;  4I65 A;  1KDA A;  2F0S A;  2RBM A;  3SK4 A;  2O4X A;  1IHZ A;  4DFA A;  4QB4 A;  5J22 A;  5IGB A;  5I9P A;  1STN A;  2M00 A;  4KD3 A;  3SK8 A;  2NUC A;  1SND A;  4EQP A;  2SNM A;  5C3X A;  1NSN S;  1SNM A;  3D6C A;  4KTA A;  1KDC A;  4N9P A;  3SK5 A;  3T13 A;  1AEX A;  4B9W A;  3DMU A;  1EY0 A;  5IOD A;  1EY5 A;  3NQT A;  4N9T A;  5I6W A;  4ID6 A;  3NXW A;  5CV7 A;  2RDF A;  5C4Z A;  2F0F A;  5IGG A;  3H6M A;  4PNY A;  5M9O A;  3QOL A;  1EY8 A;  1TR5 A;  5C5L A;  3T16 A;  5CV6 A;  5CV5 A;  2EY6 A;  2PW5 A;  4IZ8 A;  2OF1 A;  4NDX A;  4WOR A;  2F0L A;  4E6I A;  4F7X A;  4OL7 A;  2EYF A;  4HTH A;  4IUN A;  1JOO A;  2F0T A;  3TP8 A;  3U9O A;  4PMB A;  4QMG A;  2EY5 A;  5EKK A;  5F2D A;  3SHL A;  4ZUI A;  4J1M A;  5EKL A;  4YIJ A;  2F0I A;  4EQO A;  4TRD A;  4K5V A;  5C5M A;  4ZUJ A;  1A3U A;  1STG A;  3OMC A;  4HMI A;  5IGE A;  2F0P A;  4G57 A;  4K5W A;  5IGD A;  5KYI A;  4KHV A;  1ENA A;  2PZW A;  3C1F A;  4ME5 A;  4NMZ A;  4R8N A;  1SYC A;  4KJO A;  2EYO A;  5KRU A;  1EY7 A;  2F0W A;  2F0Q A;  2SOB A;  1ENC A;  3MXP A;  4EVO A;  4K5X A;  5J39 A;  3NHH A;  3P75 A;  2F0U A;  1EY4 A;  3D8G A;  5DAU A;  2OEO A;  1SYG A;  2EYJ A;  3VA5 A;  3LX0 A;  2RKS A;  1JOK A;  2F0H A;  2F0J A;  4K8I A;  5KYL A;  5JAV A;  3EVQ A;  3NK9 A;  3QB3 A;  5I6Y A;  3OSO A;  1EYD A;  5C6A A;  1U9R A;  1KAA A;  1SNO A;  2F0O A;  4KV6 A;  1STA A;  4K2K A;  5CR3 A;  1EZ8 A;  4KY5 A;  5C3W A;  5KEE A;  1SYE A;  2EYL A;  3MHB A;  1JOR A;  4NKL A;  4F8M A;  3SK6 A;  2EYM A;  2KQ3 A;  1EYA A;  3HZX A;  3MZ5 A;  1EQV A;  1SNC A;  2OXP A;  3PMF A;  5KGU A;  1KDB A;  3D4D A;  4NP5 A;  4EQN A;  2EY1 A;  2F0K A;  3TP5 A;  2SNS A;  3DHQ A;  4RKB A;  1SNP A;  2ENB A;  4PMC A;  5E3F A;  1F2Y A;  5J1Z A;  5DEH A;  5CC4 A;  3BDL A;  3R3O A;  3OWF A;  5IIF A;  3ITP A;  2PYK A;  4KD4 A;  2F0G A;  2WAC A;  1EYC A;  1STY A;  2F3W A;  4KY7 A;  5CV9 A;  3D4W A;  3EJI A;  4K6D A;  3QOJ A;  1KAB A;  5JOB A;  3RUZ A;  5C4H A;  4H7B A;  2EY2 A;  2HQE A;  4QF4 A;  1STB A;  3SR1 A;  5CV8 A;  2EYH A;  2QDB A;  4IAL A;  5I9O A;  4S3S A;  2F0V A;  1SYB A;  1A3V A;  3TP6 A;  3TME A;  3TP7 A;  4KY6 A; 
#chains in the Genus database with same CATH topology
 4BXX G;  2X6G A;  1YJ9 A;  5E4W C;  1E1O A;  3J81 c;  5G3L F;  2EOT A;  3GTK B;  5JJL A;  2KCN A;  1VQB A;  3NBH B;  4AYB B;  1QUQ B;  1NUC A;  4JG2 A;  2D62 A;  2PZU A;  1H95 A;  1CKN B;  1JE5 A;  4ZKC B;  3S1N H;  4A3B B;  5HUR A;  2A74 C;  4HJA A;  1D1I A;  1BBU A;  1K28 A;  5BN4 A;  4IUU A;  2PMZ B;  3CKI B;  5CGK A;  4KKT A;  3I55 A;  4N8X 1;  2RBM A;  4RG1 A;  5A35 A;  3ZJY C;  2BA0 A;  4MTN A;  4BY1 H;  3I4N H;  1VQH A;  5I9P A;  1ML0 D;  3SK8 A;  4DN4 M;  1SNM A;  4JW0 A;  1GHJ A;  4BBR B;  2JA7 H;  1AEX A;  1O7Y A;  3BYT B;  1CK1 A;  3K59 A;  1J8I A;  1EEI D;  1VF5 C;  3CCQ A;  1EYG A;  1NAP A;  4C2M B;  4WOR A;  2RCN A;  1B3A A;  3A54 A;  2NYZ D;  3FDT A;  3TP8 A;  4HTH A;  1CA6 A;  2E2D C;  4RHR A;  1VQ4 A;  1NE3 A;  3LWU A;  2PNH A;  1LT4 D;  1J5E Q;  4EQO A;  5C5M A;  2WIN B;  3OMC A;  4K5W A;  4NXM Q;  4BXX H;  4OO1 G;  1ENA A;  1FD7 D;  3C1F A;  2TSS A;  1VQ5 A;  2B2Y A;  1QNK A;  1ENC A;  1B3Q A;  3M7N A;  4A3J G;  1LT6 D;  3P7J A;  3SDZ A;  3KF6 B;  3TS2 A;  4RH6 A;  5IY0 A;  2F0H A;  1HNW L;  1K3B C;  2I5H A;  2YTY A;  4R9W A;  5C6A A;  4X62 Q;  2L1B A;  3ULL A;  3C46 A;  4HR7 B;  1BXT A;  1OXV A;  1F2L A;  3JAM i;  2OTJ A;  1X3E A;  1MIU A;  2AUK A;  2ATW A;  5M3F B;  3PO3 G;  2SNS A;  4XTC S;  1Q46 A;  4PMC A;  1WTQ A;  4BA2 I;  3R3O A;  1PH9 A;  4JBM A;  2EJM A;  4A75 A;  3UDI A;  1HXY D;  4RGT A;  2F4V L;  5JOB A;  1R4Q B;  3GDE A;  3A74 A;  4GLX A;  2Y0S E;  3SR1 A;  2VNU D;  4XIG S;  2B8G A;  4ZK9 B;  3I4L A;  4RGO S;  3S2D H;  1WYD A;  4DPG A;  4L63 B;  4DV3 L;  1N9W A;  1VQN A;  5EQ0 A;  1CSP A;  3M85 A;  4JK1 C;  2WII B;  3ONA B;  3PUX A;  5ELD A;  3HOV G;  1I3Q H;  2Z6B A;  2EIF A;  2MO0 A;  4OO1 H;  3BDC A;  1Q12 A;  2F0E A;  2OQ0 A;  1QB5 D;  4A3J H;  3RZO B;  4XQQ A;  4LUV A;  2UUC Q;  3W1G A;  4PZ6 A;  1VQ7 A;  1JT8 A;  3FHW A;  3SEB A;  4B3T Q;  1F2Z A;  2F0S A;  2ID0 A;  2ZT9 C;  4DV0 L;  1Y1V H;  2EDG A;  1IKM A;  4R4Q A;  5IP7 G;  3CCR A;  1PTO D;  2CW0 D;  4JI2 Q;  3RZD B;  2SNM A;  3DWQ A;  4EGV A;  3KFU A;  1K8O A;  3FKI G;  1RD9 D;  4ID6 A;  3PO2 B;  2BCO A;  3J7A 5;  3HS0 C;  5M9O A;  4AQY L;  3PO3 H;  4JV5 L;  1TR5 A;  1CZG A;  2JA6 G;  3PIO A;  2B2V A;  2JA8 G;  2LXK A;  3L9A X;  2MPM A;  4UDU C;  5M5W H;  2R92 G;  2WKC A;  3RN5 A;  1HZ9 A;  1X32 A;  5F2D A;  2BH2 A;  1IBK L;  5LHY 1;  1LTG D;  3NE5 B;  1DOL A;  2VS1 A;  3SVM A;  3G48 A;  1SEB D;  2B3G A;  4DV2 L;  1DCZ A;  1LO5 D;  2ZXO A;  4ZAI A;  2R7Z G;  4PQX A;  4CJ2 C;  2NVY H;  2E2I B;  2UUB L;  1GXD C;  2A69 D;  3HOV H;  3MTS A;  4EX5 A;  3L2P A;  1TY2 A;  4K8I A;  2UUA L;  5I6Y A;  1O80 A;  2ZJR A;  2HUG A;  2K5Q A;  5CR3 A;  3VYR A;  1IBL Q;  3PUY A;  1Z9F A;  1AZP A;  1X3F A;  4OWT B;  2YTX A;  4XT3 B;  1TY0 A;  3H0G G;  2QEJ C;  5IWA L;  1CQV A;  5IP7 H;  5FJ8 G;  2WAQ E;  3TN2 A;  1Y14 B;  1WD0 A;  4POG A;  1EYC A;  3FKI H;  2AHO B;  1UEA B;  3GQB A;  4TKO B;  1PTO H;  3K8A A;  2IPK D;  4QUC A;  2JA6 H;  2XRQ D;  2JA8 H;  1SYB A;  4A3F G;  2NTT A;  2E2J H;  3ERS X;  1Q90 A;  1SN8 A;  5CV4 A;  4POF A;  2R92 H;  4DK1 A;  5AJ3 L;  3K5M A;  3MEH A;  5FLX c;  5IGF A;  4XXE A;  1F2M A;  1D8L A;  1VMC A;  1JJG A;  3Q22 A;  5IOC A;  1Z6H A;  4A3K G;  3HKZ B;  3KDF A;  2JN4 A;  3NPP A;  2XIW A;  1HNW Q;  5ELE A;  1QUQ A;  2R7Z H;  3X3N A;  2EXZ A;  3NQI A;  5EGT A;  5AFW A;  3ERO A;  3S2H H;  3WDN A;  4PMW A;  3JC6 6;  5FK9 C;  2AWO A;  4QB4 A;  4JI3 L;  5IGB A;  2K1B A;  1JB3 A;  1O7I A;  1PRT F;  2E2H H;  4Y52 H;  1SXT A;  1BOS A;  2LSS A;  3DMU A;  3FRP B;  2F1M A;  1ILQ A;  3H0G H;  3TRE A;  2F4V Q;  1VQK A;  3MXN A;  1I4Q A;  1I50 B;  3S1R H;  1Q8I A;  1O7L A;  5C4J H;  3H3V H;  5CMD A;  2EVB A;  3ER0 A;  4OON A;  5C5L A;  1S3O A;  3T16 A;  5FJ8 H;  4A3G G;  4NDX A;  1MKH A;  3NWT A;  2R93 G;  1TII D;  4AIM A;  4DV3 Q;  4IUN A;  4AH6 A;  4NB3 A;  1ZXT A;  3SHL A;  5CBE E;  1WCM B;  4TRD A;  1XMO L;  3D4R A;  3OIP A;  5E7N A;  4C56 C;  4DV4 L;  4A3F H;  4JI4 L;  3DM3 A;  1PRT B;  4NMZ A;  2JEA I;  2F0W A;  2FJ2 A;  3CP0 A;  4CGY B;  2F0U A;  5JVG 3;  2WB1 B;  4A3K H;  2RKS A;  4N8F A;  3PUZ A;  2F0J A;  1CZW A;  2A5H A;  4K0K Q;  4IJH A;  3QB3 A;  3JAM L;  3UDG A;  1PH5 A;  2CVR A;  4A3M G;  1NR4 A;  2HCC A;  1G2S A;  1X3Q A;  4P2C B;  2KQ3 A;  2UXC Q;  3I73 A;  1FNU A;  4A3I G;  1XPU A;  3D4D A;  4YWL A;  2L15 A;  4QIW B;  4AQY Q;  4JV5 Q;  3EA6 A;  4P74 A;  4JVZ A;  2WP8 J;  1KAW A;  1KAB A;  4RGN A;  5C4H A;  4CKB A;  2EY2 A;  1G6Z A;  5EAY A;  3CRL C;  1KTK A;  1SMX A;  4JI8 Q;  1G6P A;  4I7A A;  1I6V C;  3GTG H;  3LNN A;  4A3G H;  3TP6 A;  4HJ7 A;  2R93 H;  3DWP A;  4DAP A;  3ICE A;  2PQE A;  4DV2 Q;  4DXF A;  3QO2 A;  3RLF A;  1EUJ A;  1JIC A;  1P16 A;  5K5P A;  2L5T A;  3T4A C;  1L1O A;  1EU3 A;  1VQD A;  3KYH C;  5LMN Q;  2UUB Q;  3J81 E;  2C9O A;  4K2L A;  1LTA D;  3AFP A;  3S1M H;  1PZK D;  5FO9 B;  1V9P A;  1YNJ D;  3CC7 A;  1KLG D;  4LFC L;  5HGT A;  2UUA Q;  3OPO A;  3I4M B;  3R8B A;  5C3E G;  1Q1B A;  4P72 A;  2G5D A;  4B3R L;  2PZT A;  2E5L L;  2CH4 A;  5D65 A;  4L5S A;  2IT1 A;  3NUC A;  4I65 A;  3AB9 A;  2JXM B;  5ELN A;  5IWA Q;  2KUM A;  4A3M H;  4FF3 A;  5T1I A;  3F2D A;  4X3K A;  3TDQ A;  1SBB B;  2B63 G;  1EY5 A;  1FGU A;  3E0E A;  2B8F A;  2A68 D;  1HFG A;  2KED A;  4OIJ A;  4A3I H;  3NXW A;  1IW7 D;  2RDF A;  1PH1 A;  5JPN C;  4IZ8 A;  4GKK L;  3GTQ B;  2A6E D;  1FJG L;  4ZCK A;  4PMB A;  2BE5 C;  5AJ3 Q;  3CQZ H;  5EKL A;  5DM7 3;  2K6A A;  3HOX B;  2AUJ D;  1EL0 A;  1ROD A;  3S15 B;  1XTC D;  5I2X A;  1A3U A;  2PQA B;  3PIO 3;  3URY A;  5D3D A;  4IUQ A;  2F0Q A;  2HHH L;  1TWH H;  4KN4 C;  4JI7 L;  3I3C A;  4RAU C;  5BR8 L;  4X3S A;  3BVG A;  4DAV A;  1PZI D;  1EFI D;  2JA9 A;  2HT1 A;  5LL6 X;  1C4Q A;  5C3E H;  2EYM A;  5LMN W;  1I94 L;  2PNR C;  4Z9C B;  3KBX A;  1PTO C;  2CW0 C;  5GAE C;  4LF7 L;  1H9K A;  4IUV A;  3RD4 A;  1VQI A;  3OWF A;  5IIF A;  2B63 H;  1V43 A;  1YHA A;  3U4V A;  1TKW B;  2NN6 I;  2DY8 A;  4R4I A;  2DGY A;  2HQE A;  1HR0 L;  1WTW A;  4MTK A;  1SDF A;  4QGU A;  3I4O A;  3HOZ B;  2M2L A;  1XMO Q;  1RDP D;  1XX8 A;  4OEM B;  4A93 B;  1A63 A;  2F52 A;  2M9V A;  4JI4 Q;  3PUW A;  2I07 B;  1PFS A;  4DXG A;  4CKC A;  3MVV A;  2B2U C;  5M3M B;  1R4P B;  1X65 A;  4MIU A;  2PI2 A;  1II3 A;  2Q2T A;  1HA6 A;  4C3J B;  1VCI A;  4UAI A;  3TZU A;  1PFN A;  1BDO A;  4Y7N B;  1SYF A;  2Q8T A;  2A69 C;  2NVX H;  1U4P A;  1GUW A;  5EJW A;  4IPH A;  2CQO A;  3Q0A A;  1XPR A;  4LF9 L;  4GOP A;  2B29 A;  1KDA A;  2NWG A;  4IPC A;  3CCS A;  4KD3 A;  4DR1 L;  1DGS A;  3HOU G;  4ZRZ A;  1I4R A;  4N9P A;  4FXD A;  2E75 C;  1QZG A;  1QIL A;  2K5D A;  4R4O A;  4LJZ C;  1TVX A;  1X56 A;  2HQL A;  5CV7 A;  1NTG A;  2K05 A;  3M4O B;  1PH6 A;  3J7A V;  3S1Q B;  5M5Y B;  1B8A A;  2K5W A;  2E8G A;  1MSH A;  5GQO A;  3S16 B;  1N36 L;  2K28 A;  1S5D D;  3I70 A;  4GKJ L;  3H15 A;  3ZYY X;  1IYU A;  3F2U A;  2AQ2 B;  1SJE D;  2F0P A;  2IW3 A;  3E6Z X;  3QG1 A;  4LFC Q;  2Z4I A;  2SOB A;  1V1O A;  1Q82 C;  3D0F A;  5ELO A;  1EEF D;  1S5F D;  2RF4 A;  1WD1 A;  4KLK A;  2PI2 E;  4B3R Q;  2RSN A;  2E5L Q;  1R9T B;  4LWC A;  3N52 A;  1S72 A;  1VDZ A;  1QVC A;  2QDL A;  2SDF A;  4DUY L;  3S14 B;  1FYC A;  4AYB G;  1A8V A;  2K52 A;  3T51 B;  2R7F A;  2K7V A;  4A3B G;  1A15 A;  2OXP A;  1HNX L;  1JR0 D;  5T1G A;  3DHQ A;  2B2W A;  1I6H H;  5J1Z A;  2CWP A;  3NTK A;  1JJ2 A;  3HOU H;  2NZH A;  2PYK A;  5G3L D;  2X69 A;  3W1B A;  4RWS C;  4GKK Q;  3QOJ A;  2TMP A;  1FJG Q;  4CKE A;  1QOH A;  1PYB A;  3CPF A;  3K7A B;  2K01 A;  4RGM A;  4DR3 L;  3STB D;  3I90 A;  4BBR G;  4H02 A;  1V1P A;  3ULP A;  4KY6 A;  4DV1 L;  1F9Q A;  3GTP B;  4WJ4 A;  1N34 L;  3D6W A;  4HJ8 A;  3S9W A;  4DGZ A;  2HHH Q;  4GNX A;  1EZ6 A;  4JI7 Q;  5BR8 Q;  1GOZ A;  4DF7 A;  1RHP A;  1CM9 A;  1HRJ A;  4LAA A;  1U4R A;  3A7A B;  3MA2 B;  1RKN A;  1FR3 A;  2AQ1 B;  3E5S A;  1AE3 A;  4WFN 3;  4IO9 A;  3GTK H;  3G4S A;  2JA5 B;  4DFA A;  3CF5 A;  4LF7 Q;  4LF6 L;  4X65 Q;  5L37 A;  2DNE A;  3SK5 A;  2VZA A;  1H9J A;  4A3B H;  2VB3 X;  2PPB C;  2P5Z X;  4A3D B;  1HR0 Q;  2JK8 A;  5JJZ A;  5D3I B;  2ES2 A;  3H3V I;  5M3F G;  4FVM A;  4QMG A;  3KJP A;  3K0Y A;  1WFQ A;  1RIP A;  3ND9 A;  5IT9 L;  1IYV A;  1QCB D;  5H1S E;  1Y8N B;  3CCV A;  3BZC A;  4BBR H;  1ASY A;  1QWY A;  2NN6 G;  1D5M C;  3I56 A;  4A3E B;  4H0L C;  2K5H A;  4JI6 Q;  4KKU A;  1B70 B;  1F9S A;  1D5X C;  2FFK B;  2B2Y C;  3MXP A;  3W5O A;  4C2M H;  4CHT B;  3F2C A;  3S1N B;  3MAQ A;  1ILP A;  1XNQ L;  2OEO A;  4LFB L;  1YNJ C;  1DZ1 A;  2L0C A;  4LF9 Q;  3GTL B;  1OXS C;  1EIG A;  1JQY D;  1EZ8 A;  3MHB A;  2VL6 A;  5COR A;  4F8M A;  1VQM A;  3BJU A;  3SK6 A;  2RCF A;  3VYS A;  4JI5 L;  3OHX C;  1S40 A;  1X54 A;  1OXX K;  1RCV D;  1RF2 D;  2Z1C A;  3HOW B;  4DUZ L;  3AEV A;  1CUK A;  1BF4 A;  2MP1 A;  4QQB X;  4C3I B;  2R3Z A;  1IW7 C;  1PFM A;  4ZLT F;  4DR2 L;  4C3H B;  1A0I A;  1TU2 B;  2MQH A;  4IAL A;  4HIK A;  1N36 Q;  2O5I C;  2ZXP A;  4A3L G;  3D3R A;  4GKJ Q;  4K6L A;  2KVM A;  2JE6 I;  3F1Z A;  3RR5 A;  4R1J A;  1L0Y B;  3PO2 G;  3U58 A;  4L5R C;  1I4H A;  3Q6S A;  4V0B A;  5M3F H;  2IX3 A;  3OIQ A;  4WRD A;  3I2Z A;  4C1N I;  2RSO A;  1EIY B;  1PH3 A;  2ZTC A;  1HR0 W;  2NN6 H;  4ODG A;  2SEB D;  1DJR D;  4B9X A;  2F0N A;  3Q8D A;  1DM0 B;  3VYT A;  1K0S A;  4J15 A;  4HMJ A;  3CHB D;  2KJX A;  5FKA C;  1HNX Q;  3Q24 A;  4KMU C;  4LW1 A;  1PH8 A;  4OWX B;  1HZB A;  4DR7 L;  4MHE A;  3L7Z C;  2L9H A;  2GN5 A;  4IPD A;  2KEE A;  2AKW B;  4JBK A;  3S17 B;  4B3M L;  4B08 A;  5C4Z A;  3LGJ A;  2YYZ A;  3H6M A;  3VR2 A;  3RZO H;  4F88 A;  1BQQ T;  4OEL B;  1EU4 A;  3BDO A;  1VQJ A;  2ZTE A;  3HOY B;  3A8K E;  4DV1 Q;  1JMC A;  4IUP A;  1TWC B;  2ALY B;  3RZD H;  4B3S L;  1X55 A;  1N34 Q;  4A3L H;  3TQY A;  1E3P A;  5IGE A;  3NEL A;  5A2Q L;  2PZW A;  3QWN A;  3PO2 H;  1YHB A;  1GM5 A;  1EQQ A;  2BDO A;  4RHS A;  3MFY A;  2AQ3 B;  3AU7 A;  3VA5 A;  3T1Y L;  4BBS B;  1Y8P B;  2QEX A;  4O1N A;  4OXP A;  5C0X I;  2L55 A;  1XWE A;  1M90 C;  2BOS A;  4LF6 Q;  1YIT A;  3HKZ G;  2VUM B;  1KC8 C;  1Y1V B;  3KF8 B;  1GUO A;  3KLS A;  2KCC A;  2EJG C;  3U9S A;  1XTD A;  3H91 A;  5E3F A;  2E2I H;  5CC4 A;  1OO9 B;  1TWA B;  3CC2 A;  3AQQ A;  1N8R C;  4OWW B;  1S5C D;  2WAC A;  1PLF A;  5IYB G;  4KY7 A;  4ALP A;  3RUZ A;  4OX9 L;  1MBY A;  2D0P A;  3OW2 A;  2KCM A;  2L4N A;  4HN7 A;  1YJN A;  1UWV A;  2MJ8 A;  3OW7 A;  4JCV E;  2WV6 D;  2CH4 W;  5FLM G;  1GUG A;  2PCF B;  5IYC G;  1SFO B;  2WKD A;  4RMF A;  3KOJ A;  1Q86 C;  4XQN A;  1XNQ Q;  4LFB Q;  3K5L A;  1Y69 U;  1ESF A;  1WCM G;  1RTN A;  3J7A F;  3OWE B;  3HEJ A;  1ZYR C;  1W6J A;  2K33 A;  3SXH A;  1BCP F;  4JI5 Q;  2VQF L;  4FO2 A;  2NVQ B;  3CCE A;  3OOC A;  1EOV A;  1STN A;  1XYI A;  3RLN A;  2NUC A;  1WTX A;  3OTO L;  4A4I A;  4EQP A;  2ZJP A;  2WB1 G;  4DUZ Q;  1X6O A;  3V05 A;  2UU9 L;  4B9W A;  1NCV A;  2C35 B;  3GTM B;  3J7Y W;  4FF1 A;  3NQT A;  4GLA C;  3N6R A;  4M1U B;  2F0F A;  3MXU A;  3NBH A;  5I2Y A;  3QIA A;  1CKN A;  5IYB H;  1PA6 A;  4LF8 L;  3DLL A;  1WOC A;  3PQI A;  4J1M A;  1QE6 A;  3A5U A;  2N8N A;  3K0X A;  1BCP B;  3CAM A;  2GA4 B;  1STG A;  3L0O A;  1DXM A;  2XWJ B;  4ME5 A;  1IL2 A;  3WWV A;  2DNC A;  1I50 H;  4QY7 A;  2RDG A;  5FLM H;  1VQO A;  5IYC H;  4R4C A;  4DK0 A;  1LTR D;  1JC7 A;  4IOA A;  3K5O A;  1XNR L;  1VQ6 A;  1MSG A;  2D0O A;  1TS2 A;  2J7Z A;  3PF5 A;  3IAY A;  1WCM H;  2GVB A;  1X9N A;  1JB7 A;  2MGS A;  4JBJ A;  3CC4 A;  1JOR A;  5IE8 A;  1E2V A;  1QJO A;  2EE1 A;  4RCN A;  1SNC A;  3G6J B;  3CCM A;  1XJV A;  5KGU A;  3HKS A;  3I4M G;  2OWO A;  4B3M Q;  2NBF A;  3VYU A;  1B44 D;  2ENB A;  4DV5 L;  1EOT A;  1CKM A;  1TXY A;  4TVA B;  5C4J B;  2HIV A;  4UY8 C;  4JBW A;  2EJF C;  5I9O A;  4S3S A;  4FNF A;  2F0V A;  3KF6 A;  3IFT A;  4DV0 Q;  4B3S Q;  2N88 A;  4UP9 A;  1D6E C;  3ERQ A;  4IQZ A;  1PH4 A;  4RKL A;  4WJW A;  2BH8 A;  1MI2 A;  3V2T A;  1L1O C;  3HP3 A;  5BN5 A;  1A3T A;  2PMZ E;  3T1Y Q;  1VS0 A;  5E1F A;  4K8J A;  1JWU D;  3HOX G;  2VQE L;  4FDB A;  2F3V A;  1IBK Q;  3C2P A;  4IOC A;  1ET9 A;  4CJ0 B;  1GUT A;  5J3B A;  3AFQ A;  2AMC B;  1ICW A;  1Y1W B;  2Q2U A;  1T5X D;  1Q81 C;  1SND A;  1TS3 A;  3BG3 A;  2RHS B;  1B9N A;  3K7U C;  2DJG C;  5C0X G;  1MHW C;  2KEC A;  2ICE C;  3CMA A;  1LAC A;  2HIX A;  5DM6 3;  3I4M H;  2K03 A;  1U0L A;  3R2T A;  3VR4 A;  3M3Y B;  2Q2H A;  5C0X J;  5JEA G;  4ZUI A;  5KNB A;  1PV4 A;  5DNF A;  5M5X B;  4J8Q A;  2VY3 A;  1LTI D;  2OQK A;  1SE3 A;  1UE7 A;  4DV7 L;  3GTO B;  4WJ3 M;  2EYO A;  2XN9 C;  1N33 L;  2GVA A;  4K5X A;  5EBC A;  5JEA J;  3HOZ G;  4A93 G;  1BVS A;  2EYJ A;  4FF2 A;  4DAY B;  3GTQ H;  2HDM A;  4KHP L;  5KYL A;  5JAV A;  3EVQ A;  2VQF Q;  1G8Z D;  1HQM C;  2MHV A;  3MEF A;  4DV6 L;  3IKJ A;  4LNQ A;  5M3M G;  5FO7 B;  2DY7 A;  3HOX H;  1EIF A;  4C3J G;  3GTJ H;  3S15 H;  4HIM A;  3OTO Q;  4NXN L;  1HA5 A;  3HZX A;  1UNS A;  2UU9 Q;  1K83 B;  2YV5 A;  2NVT B;  3A56 A;  4NP5 A;  4PZ8 A;  1AZQ A;  1TWF H;  4RKB A;  2K14 A;  1FNV A;  2X6L A;  1OXU A;  5C4X B;  3ITP A;  1VQC A;  3W2D A;  1JJC B;  3CME A;  3KF8 A;  1IL8 A;  5C0X H;  1LTT D;  4QF4 A;  3FMC A;  4LF8 Q;  4FYD A;  1M4V A;  1SE2 A;  4HSP A;  1CKO A;  4JI3 Q;  3T56 B;  1B50 A;  1UE5 A;  2F3I A;  3K6O A;  1MJE A;  4MNO A;  2Y0S B;  4Q0F A;  3JAM c;  3UI2 A;  5JEA H;  3CCJ A;  1LV9 A;  4JOI A;  4X3T A;  2Z6K A;  4BY7 B;  1KNE A;  1VQF A;  2F4I A;  2R7D A;  3DWA A;  1XNR Q;  1TWG B;  1STH A;  3NTH A;  4LMQ D;  1A2T A;  4DA2 A;  1PHJ A;  4X6A H;  3HOZ H;  1HHV A;  5NUC A;  4A93 H;  1RJT A;  2KHS A;  1CQF A;  2Z4H A;  1BNZ A;  3EIV A;  4GOP C;  3K5N A;  1SLJ A;  4A3C G;  1GUS A;  4DV4 Q;  5M3M H;  1XPO A;  4DV5 Q;  4L6T B;  1WVL A;  4C3J H;  4XDX A;  4HCS A;  3TZD A;  5IOD A;  4N9T A;  4Y7N H;  4QCL A;  2D9U A;  4IN3 A;  1C0A A;  5EPK A;  1YI2 A;  1DD2 A;  4PNY A;  4XYO A;  1HQR D;  3QOL A;  1ONL A;  2XRS D;  4JI0 L;  5CV5 A;  3E9H A;  2F0L A;  4JC0 A;  2DUD A;  4ILW A;  2VXW A;  1SJH D;  1S5B D;  3TRZ A;  3KJO A;  1LAB A;  3H3V C;  4HMI A;  2A1A A;  5IGD A;  1Q8K A;  3J80 i;  3M4P A;  2B2T A;  5KND A;  1D1K A;  2PO4 A;  3M4O H;  2IHF A;  2N78 A;  2KBN A;  1KNA A;  2K4K A;  5FOB B;  2VQE Q;  3E0J A;  1SYG A;  3S1Q H;  3PCO B;  2JQO A;  1JOK A;  4CDE C;  5M5Y H;  3U50 C;  1K8G A;  3S16 H;  1EYD A;  2HD3 A;  2O2L D;  3GD7 A;  2F0O A;  4KV6 A;  1K73 C;  1G29 1;  4R8I A;  1EFW A;  2L11 A;  1KDB A;  2XGT A;  2A8V A;  4A3C H;  1B9M A;  1F2Y A;  2B2W C;  4L8J A;  1R9T H;  1STY A;  1G51 A;  2JA5 G;  2JEB I;  3S14 H;  2WAQ B;  3PIP A;  2ZJQ A;  2YU9 B;  1MJC A;  4X62 L;  3TME A;  3HKZ E;  4EQN A;  3A0J A;  2CKZ B;  1VQL A;  1G91 A;  3C1E A;  4DV7 Q;  4CDC C;  4A3D G;  1Y8O B;  1N33 Q;  4UPA A;  4GNX C;  3PUV A;  3VA7 A;  2HCI A;  1TQO A;  2ICI A;  1GD7 A;  2F0M A;  2G9H D;  4DV6 Q;  4KJN A;  3K7A H;  2QKI C;  1WTO A;  2DJF C;  4K14 A;  5ISR A;  1Z7T A;  4ABN A;  1NR2 A;  1WTP A;  4A3E G;  4NXN Q;  3UDX A;  3GTP H;  5J22 A;  3GV3 A;  3IL8 A;  4ULL A;  5DLQ E;  3A8I E;  5KNC A;  3D6C A;  4GN3 B;  3T13 A;  4YY3 L;  4YCV A;  5IGG A;  3PV0 A;  5EPJ A;  3IFD A;  2ZM6 L;  1AH9 A;  1RL2 A;  1PDQ A;  1AW7 A;  2LS0 1;  1MGS A;  5C44 B;  1YIJ A;  1X3P A;  3DEO A;  4F7X A;  1QG7 A;  2QCP X;  2JA5 H;  1WJJ A;  2UUC L;  3HOW G;  2F0I A;  3ND8 A;  1I94 Q;  4K5V A;  1AFP A;  4C3I G;  2FHT A;  3CCU A;  2WB1 E;  1C8C A;  4OHJ A;  1SR3 A;  2QW7 A;  4C3H G;  4JI2 L;  4KHV A;  1STE A;  1KL9 A;  1EY7 A;  4YHH L;  3SE0 A;  1V8Q A;  4A3D H;  4DR5 L;  3DEP A;  3KLR A;  3LX0 A;  1UUP A;  1ET6 A;  3MWY W;  1YZ6 A;  3HGB A;  1Z47 A;  4HSV A;  1B4O A;  1KAA A;  4K2K A;  3U4Z A;  4QIW E;  1NNX A;  1C48 A;  3A7L A;  3KDF B;  4A3E H;  1NMG A;  2NTS A;  2RVL A;  3BZD B;  5ELC A;  4DR6 L;  2QA4 A;  4RFB A;  1G2T A;  1GO3 E;  1QVG A;  4JI1 L;  4JI0 Q;  2PQA A;  3QR8 A;  2F0G A;  3GTL H;  1KRS A;  4KK7 A;  1VQ8 A;  1FL0 A;  2QGQ A;  4CBV A;  4BWG B;  1KRT A;  2XWB B;  1IBL L;  1I4G A;  4DR1 Q;  2F0D A;  4CDD C;  4GLV B;  3E3X A;  2R6G A;  3MXN B;  4BY1 B;  3I4N B;  3HOW H;  3D31 A;  1ZEQ X;  3BYY B;  2Z9H A;  1E2W A;  4C3I H;  3HOY G;  3OMG A;  2JA7 B;  3P1H A;  3FVQ A;  4XYQ A;  3VR3 A;  3NP8 A;  1H9S B;  5GAD C;  4C3H H;  2NB0 A;  1NMF A;  2A68 C;  3J7Z C;  2XTI A;  2PW7 A;  2LKV A;  3G7L A;  4P71 A;  4DNR B;  1YVC A;  2RQX A;  1SNQ A;  1A2U A;  2B39 A;  3O13 A;  3PSI A;  3A5Z B;  1IHZ A;  3I7F A;  2A6E C;  4RCO A;  1VQG A;  2M00 A;  4H13 C;  3QJY A;  2BA1 A;  4BBS G;  4KTA A;  2A6H D;  1L0W A;  3CD6 A;  1EY0 A;  1U4M A;  1CHP D;  2IJ0 A;  4GN4 B;  2VB2 X;  2EY6 A;  2VUM G;  2I46 A;  2OF1 A;  3A8J E;  1HNZ L;  1Y1V G;  4DUY Q;  2QF7 A;  3FPU B;  2NZO A;  1WTR A;  4OGQ C;  1NY4 A;  3DUZ A;  1EWI A;  4QJF A;  3J80 L;  3CW2 C;  1E24 A;  4ZYS A;  1B7Y B;  2MNA A;  3CU7 A;  1SMY D;  4YIJ A;  1VQA A;  1F9R A;  3CCL A;  4YWK A;  2C5C A;  2J0T D;  5ELF A;  5KYI A;  2K75 A;  3S17 H;  5JJK A;  5KRU A;  1SYC A;  1PFB A;  4EVO A;  4BS9 A;  3K57 A;  5TSS A;  2KEN A;  3HOY H;  3S24 A;  2VW9 A;  2B2V C;  1HUN A;  4DR3 Q;  2I5M X;  3NK9 A;  2BE5 D;  5FLX L;  1L1O B;  1BO0 A;  1U9R A;  4LF4 L;  1TWC H;  3BVZ A;  4IFD I;  1IKL A;  1SYE A;  3S2D B;  3MZ5 A;  1EYA A;  3OYY A;  3VR5 A;  4YY3 Q;  2JYO A;  4DKA C;  3RN2 A;  2F0K A;  1IXR A;  1VQP A;  2ZM6 Q;  1YNX A;  3H09 A;  1LTB D;  5IT9 c;  1I3Q B;  4BBS H;  5E4X A;  1HTP A;  1MD2 D;  2F3W A;  2ZXR A;  1I5F A;  1YJW A;  4H7B A;  2LMC B;  3EFX D;  4YWM A;  2A19 A;  2QDB A;  3NEM A;  1K9M C;  4K0K L;  4A3J B;  2KHI A;  2MFI A;  2VUM H;  4IPG A;  1KD1 C;  1N32 L;  3TP7 A;  3AYH B;  2UXB L;  1K8A C;  1PYS B;  1SYD A;  1QVF A;  2NZ1 D;  2R61 A;  4LFA L;  1K8M A;  2UXC L;  2V4D A;  3TS0 A;  4YHH Q;  1TWA H;  5ELB A;  1BCP D;  2D5D A;  3I8Z A;  4DR5 Q;  3WOF A;  5I4D A;  1FGB D;  1AE2 A;  3JAM E;  2MO1 A;  3PIP 3;  4PV1 C;  1EY6 A;  1QZH A;  1QNU A;  1XMQ L;  3PO3 B;  4LF5 L;  5HGQ A;  2LY7 A;  3RLO A;  1Q3L A;  5M5W B;  4JI8 L;  3G71 A;  3V96 A;  1J6Q A;  1O78 A;  4DR6 Q;  1SFO H;  3FPP A;  1NSN S;  4JI1 Q;  1CSQ A;  1WTH A;  4BA1 I;  4HJ5 A;  4RA8 A;  2N55 A;  2K04 A;  5LMN L;  1W3S A;  2KCT A;  3I72 A;  2KOL A;  4X3U A;  1PRT D;  1CT1 D;  2NVY B;  1PZJ D;  2I5L X;  4NPS A;  3HOV B;  4XQJ A;  1FVI A;  1PTO F;  1PYW D;  2F0T A;  2NVQ H;  1IYJ B;  1WI5 A;  5EKK A;  3T53 B;  1LUZ A;  2EZV A;  1VMP A;  1AN8 A;  3J80 c;  4UP7 A;  2IY5 B;  3GTM H;  3VDY A;  4DNI A;  3M4Y A;  1YBY A;  2N49 A;  3G6E A;  4U68 A;  4QL5 A;  1LT3 D;  4DR2 Q;  3P75 A;  1EY4 A;  3T1H L;  3W3A A;  4MZ9 A;  3KUP A;  3FKI B;  1SSO A;  1F77 A;  1SRU A;  4A76 A;  3F8T A;  1B1Z A;  4XT1 B;  1SNO A;  1STA A;  1PTO B;  1H9M A;  4ME3 A;  2JA6 B;  2JA8 B;  1K0R A;  2IWH A;  3STB C;  1GKH A;  2RHQ B;  5K36 G;  2E2J B;  2KHJ A;  3NEN A;  4LK1 C;  2R92 B;  2FMM A;  3NSW A;  1LM0 A;  1WTV A;  5HY6 A;  4X66 L;  5DEH A;  3BDL A;  2LXJ A;  2XVS A;  3KLS X;  4KHZ A;  4KD4 A;  1HNZ Q;  5GRO A;  1VQE A;  4GOP B;  4GS3 A;  5LL6 S;  1LTL A;  4X64 L;  1O7Z A;  1Y1W G;  4NW2 A;  1STB A;  2R7Z B;  1DYQ A;  5IYD G;  1JCK B;  1SRO A;  3L3O C;  1UE1 A;  4DNT B;  3K58 A;  5BN3 A;  1I4P A;  1IZ6 A;  3S2H B;  3K80 C;  3RNU A;  3IRB A;  4HIO A;  1YEZ A;  5IGC A;  4DR7 Q;  2OTL A;  1EY9 A;  3J81 i;  2MUY A;  2H1E A;  2E2H B;  1HZC A;  3SGI A;  1TT2 A;  1YNN D;  1LLR D;  1ZKO A;  3H0G B;  1LTS D;  2CFM A;  4ZQ3 A;  2Q8R E;  4Q5V A;  1JOQ A;  5CBA E;  3S1R B;  4LF4 Q;  1H9S A;  5COY A;  5KIX A;  4IUT A;  1NJI C;  2CWA A;  4AYB E;  3CPW A;  3I91 A;  2O4X A;  1JWS D;  1SAP A;  1BR9 A;  2Z0S A;  4FXK C;  5C3X A;  1GHK A;  1CA5 A;  1CFM A;  4A3F B;  5K36 H;  4L5T A;  1E0B A;  4IFD G;  4L5Q A;  4CJ1 B;  1C9O A;  5JPM C;  5CV6 A;  4G7H C;  1HZA A;  4A3K B;  1PMR A;  1OXT A;  4M8A A;  1W2B A;  2KA7 A;  4IUR A;  1ICF B;  1N32 Q;  2UXD L;  2UXB Q;  4YCU A;  2EY5 A;  1Y1W H;  5FO8 B;  4IFD J;  2H5X A;  5IYD H;  1I4X A;  4LFA Q;  5C4X G;  1E7Z A;  2HDL A;  1T9H A;  2A73 B;  2FIN B;  3BS1 A;  4ZUJ A;  1KXL A;  4IJL A;  4G57 A;  1IBM L;  4ZKB B;  3UE0 A;  4FP5 D;  4R8N A;  2Q2I A;  1SE4 A;  3NTI A;  1XMQ Q;  5EPL A;  5J39 A;  3EN2 A;  4LF5 Q;  3M3Y H;  3M4Q A;  4OX9 Q;  1V1P B;  4HAE A;  4MN3 A;  3AMU A;  2Y0S G;  1PVO A;  3VR6 A;  4BY7 G;  1ESR A;  5M5X H;  3FEW X;  3GTG B;  4JPB W;  4A3G B;  1X3G A;  2XSC A;  4GNX B;  2R93 B;  2RA4 A;  3PMF A;  5LMU L;  3GTO H;  5GAH C;  4FXG C;  3KK7 A;  2EY1 A;  2K32 A;  3TP5 A;  1EQR A;  4JYA L;  2A6H C;  2JP1 A;  3HFZ B;  5GAG C;  1ASZ A;  3DXJ C;  3S1M B;  1EIH A;  4DK6 C;  5CV9 A;  3B6Y A;  3EJI A;  2IX0 A;  1H9R A;  2EXD A;  4UHV A;  1BBX C;  4IFD H;  2JJQ A;  1EWC A;  5CV8 A;  2YTV A;  1K3R A;  4PG3 A;  2CCZ A;  1A3V A;  1GJX A;  1K83 H;  2NVT H;  4J6H A;  3MFG A;  1SMY C;  2ZTD A;  3E9I A;  3BU2 A;  4A3M B;  3NWS A;  2E74 C;  3H94 A;  4QUF A;  5C4X H;  4JOI C;  2L12 A;  2WFW A;  2Z6K C;  1KIX A;  3T1H Q;  2IX1 A;  2IHE A;  4A3I B;  1BUV T;  3NBI A;  1NBW A;  4CDF C;  4LUZ A;  4F87 A;  1JWM D;  1V1Q A;  3FP9 A;  3M9B A;  1DOM A;  4HJ9 A;  3MC0 B;  1P8L A;  3GTJ B;  1JE4 A;  3GP7 A;  2OCE A;  3CQZ B;  4I7Z C;  3UDF A;  4HID A;  3UE1 A;  4X66 Q;  4BY7 H;  4YCW A;  3TEH B;  1M1K C;  3KLW A;  1KDC A;  3A55 A;  1B2T A;  4TSS A;  4GZY C;  1B53 A;  1TWF B;  1TWG H;  5I6W A;  4G7O C;  1T5E A;  4X64 Q;  4HED A;  2XNA C;  1Q7Y C;  1YHQ A;  2PW5 A;  4KKS A;  1TWH B;  1CTM A;  1XXG A;  1LYL A;  4OL7 A;  2EYF A;  1DON A;  1EQT A;  5C3E B;  4C1N K;  1KLU D;  4DR4 L;  1D7Q A;  1UAP A;  3C3L A;  1TS5 A;  4DK3 C;  1DOK A;  2DN8 A;  4KI0 A;  4X65 L;  2B2T C;  4KJO A;  2WAQ G;  1BCP C;  1HUM A;  4DAM A;  4V19 0;  4GN5 A;  5DAU A;  2CQA A;  3CXC A;  3WOE A;  3GV6 A;  1FNW A;  2B63 B;  1S4Z A;  1BKB A;  3OSO A;  2CHB D;  2D2C C;  5C3W A;  3M7G A;  4KY5 A;  3BVM A;  5KEE A;  1TS4 A;  2EYL A;  3CRK C;  2H4O A;  4NKL A;  5CYU A;  1CHQ D;  2IL8 A;  1EQV A;  1ENF A;  1U4L A;  4O0A A;  4P73 A;  4U67 3;  5EBD A;  1SNP A;  4KN7 C;  4JI6 L;  1HCZ A;  4LUO A;  2FMC A;  4K6D A;  1PRT C;  1J9O A;  2UXD Q;  3R93 A;  2E76 C;  3K81 C;  2O5J C;  5IT9 E;  4OO1 I;  3J81 L;  2J4X A;  4EQ5 A;  2EPB A;  4P75 A;  2NVX B;  2EYH A;  1M8A A;  1IBM Q;  1D2B A;  4O42 A;  2B2U A;  4G4K A;  1J5E L;  2EYP A;  3R2I A;  4UP8 A;  4H44 C;  4TQU S;  5C44 G;  3MXG A;  4NXM L;  3BZK A;  2K5N A;  1E2Z A;  2EQS A;  5IP9 G;  2JSO A;  2OT2 A;  3HG9 A;  1HJP A;  2YU9 H;  1UEB A;  4PZ7 A;  4R4T A;  3SK4 A;  5JJI A;  5LMU Q;  1A6X A;  1A62 A;  2ASB A;  1F9P A;  3RMH A;  3PGZ A;  4JYA Q;  3PF4 A;  4O2D A;  2RDH A;  3GO5 A;  3EBE A;  1U5K A;  3HRZ C;  1EY8 A;  4KHP Q;  1EWH A;  1VQ9 A;  3TSS A;  1ZYR D;  2K5V A;  1D5Z C;  1L0X B;  4E6I A;  1PXU A;  1OTC A;  1UE6 A;  1KHI A;  1JOO A;  3U9O A;  1E22 A;  2FXQ A;  3LWE A;  4FF4 A;  3Q23 A;  2LFN A;  1HH2 P;  1KQS A;  1HTL D;  3ULJ A;  1BBW A;  2QIL A;  2N3S A;  1PH2 A;  5EKI A;  3F2B A;  3J81 j;  2G9D A;  5D14 A;  1AP0 A;  2AWN A;  2I0Q A;  3X3M A;  3J80 E;  1YNN C;  3P20 A;  1SE8 A;  1I6H B;  3NHH A;  3D8G A;  3HOU B;  5C44 H;  4OIK A;  1HFN A;  4BY1 G;  3I4N G;  4DU9 A;  5IP9 H;  1RTO A;  1GUN A;  2V1C C;  1W6K A;  3TBI B;  1VF7 A;  3KBG A;  1LT5 D;  2JA7 G;  1L2F A;  4B3T L;  1GVP A;  4HCE A;  4G7Z C;  1E1T A;  5FLX E;  2Q8I B;  1C7Y A;  1PH7 A;  2F03 A;  1S5E D;  3D4W A;  3DM1 A;  1Q1E A;  2K50 A;  1CI3 M;  2Z8L A;  3EQL C;  2BDN A;  5A2Q E;  4DR4 Q;  5JVH 3;  4DAY A;  4APV A;  1HPC A; 
#chains in the Genus database with same CATH homology
 2X6G A;  5E4W C;  3GTK B;  5G3L F;  2EOT A;  2KCN A;  4AYB B;  1NUC A;  2D62 A;  2PZU A;  4ZKC B;  4A3B B;  5HUR A;  2A74 C;  1D1I A;  5BN4 A;  4IUU A;  2PMZ B;  3CKI B;  5CGK A;  4KKT A;  2RBM A;  5A35 A;  2BA0 A;  5I9P A;  1ML0 D;  3SK8 A;  4DN4 M;  1SNM A;  1GHJ A;  4BBR B;  1AEX A;  1O7Y A;  3BYT B;  1CK1 A;  3K59 A;  1J8I A;  1EEI D;  1VF5 C;  1NAP A;  4C2M B;  4WOR A;  1B3A A;  3A54 A;  2NYZ D;  3FDT A;  3TP8 A;  4HTH A;  1CA6 A;  2E2D C;  4RHR A;  3LWU A;  1LT4 D;  4EQO A;  5C5M A;  2WIN B;  3OMC A;  4K5W A;  4OO1 G;  1ENA A;  1FD7 D;  3C1F A;  2TSS A;  2B2Y A;  1QNK A;  1ENC A;  3M7N A;  1LT6 D;  3P7J A;  3SDZ A;  4RH6 A;  2F0H A;  4R9W A;  5C6A A;  2L1B A;  3C46 A;  4HR7 B;  1BXT A;  1OXV A;  1F2L A;  2AUK A;  5M3F B;  2SNS A;  4XTC S;  4PMC A;  1WTQ A;  4BA2 I;  3R3O A;  2EJM A;  1HXY D;  4RGT A;  5JOB A;  1R4Q B;  3SR1 A;  2VNU D;  4XIG S;  2B8G A;  4ZK9 B;  3I4L A;  4RGO S;  4L63 B;  5EQ0 A;  3M85 A;  4JK1 C;  2WII B;  3ONA B;  3PUX A;  5ELD A;  4OO1 H;  3BDC A;  1Q12 A;  2F0E A;  1QB5 D;  3RZO B;  4XQQ A;  3SEB A;  1F2Z A;  2F0S A;  2ID0 A;  2ZT9 C;  2EDG A;  1IKM A;  1PTO D;  2CW0 D;  3RZD B;  2SNM A;  3DWQ A;  4EGV A;  1K8O A;  1RD9 D;  4ID6 A;  3PO2 B;  2BCO A;  3HS0 C;  5M9O A;  1TR5 A;  1CZG A;  2B2V A;  3L9A X;  2MPM A;  4UDU C;  2WKC A;  1X32 A;  5F2D A;  5LHY 1;  1LTG D;  1DOL A;  3NE5 B;  3SVM A;  1SEB D;  1DCZ A;  1LO5 D;  2ZXO A;  4ZAI A;  4PQX A;  4CJ2 C;  2E2I B;  1GXD C;  2A69 D;  3MTS A;  1TY2 A;  4K8I A;  5I6Y A;  1O80 A;  2HUG A;  2K5Q A;  5CR3 A;  3VYR A;  3PUY A;  1AZP A;  4XT3 B;  1TY0 A;  2QEJ C;  1CQV A;  3TN2 A;  1WD0 A;  1EYC A;  1UEA B;  3GQB A;  4TKO B;  1PTO H;  2IPK D;  4QUC A;  2XRQ D;  1SYB A;  2NTT A;  1Q90 A;  5CV4 A;  4DK1 A;  3K5M A;  3MEH A;  5IGF A;  4XXE A;  1F2M A;  1VMC A;  3Q22 A;  5IOC A;  1Z6H A;  3HKZ B;  3NPP A;  2XIW A;  5ELE A;  3X3N A;  2EXZ A;  3NQI A;  5EGT A;  5AFW A;  3ERO A;  3WDN A;  4PMW A;  5FK9 C;  2AWO A;  4QB4 A;  5IGB A;  2K1B A;  1JB3 A;  1PRT F;  1SXT A;  1BOS A;  3DMU A;  3FRP B;  2F1M A;  1ILQ A;  3MXN A;  1I4Q A;  1I50 B;  1Q8I A;  1O7L A;  5CMD A;  2EVB A;  5C5L A;  3T16 A;  4NDX A;  3NWT A;  1TII D;  4IUN A;  1ZXT A;  3SHL A;  5CBE E;  1WCM B;  4TRD A;  3D4R A;  3OIP A;  4C56 C;  1PRT B;  4NMZ A;  2JEA I;  2F0W A;  2FJ2 A;  4CGY B;  2F0U A;  5JVG 3;  2WB1 B;  2RKS A;  3PUZ A;  2F0J A;  1CZW A;  2A5H A;  3QB3 A;  3JAM L;  2CVR A;  1NR4 A;  2HCC A;  1G2S A;  1X3Q A;  4P2C B;  2KQ3 A;  3I73 A;  1FNU A;  3D4D A;  4QIW B;  3EA6 A;  2WP8 J;  1KAB A;  4RGN A;  5C4H A;  4CKB A;  2EY2 A;  1G6Z A;  3CRL C;  1KTK A;  1I6V C;  3LNN A;  3TP6 A;  3DWP A;  4DAP A;  2PQE A;  4DXF A;  3QO2 A;  3RLF A;  5K5P A;  1JIC A;  2L5T A;  3T4A C;  1EU3 A;  3J81 E;  2C9O A;  4K2L A;  1LTA D;  1PZK D;  5FO9 B;  1YNJ D;  1KLG D;  5HGT A;  3OPO A;  3I4M B;  3R8B A;  1Q1B A;  2PZT A;  5D65 A;  2IT1 A;  3NUC A;  4I65 A;  3AB9 A;  2JXM B;  2KUM A;  4FF3 A;  5T1I A;  4X3K A;  3TDQ A;  1SBB B;  1EY5 A;  4OIJ A;  2B8F A;  2A68 D;  1HFG A;  2KED A;  3NXW A;  1IW7 D;  2RDF A;  5JPN C;  4IZ8 A;  3GTQ B;  2A6E D;  4PMB A;  2BE5 C;  5EKL A;  5DM7 3;  2K6A A;  3HOX B;  2AUJ D;  1EL0 A;  1ROD A;  3S15 B;  1XTC D;  5I2X A;  1A3U A;  3PIO 3;  3URY A;  5D3D A;  4IUQ A;  2F0Q A;  4KN4 C;  3I3C A;  4RAU C;  4X3S A;  3BVG A;  4DAV A;  1PZI D;  1EFI D;  5LL6 X;  1C4Q A;  2EYM A;  2PNR C;  4Z9C B;  3KBX A;  1PTO C;  2CW0 C;  1H9K A;  4IUV A;  3RD4 A;  3OWF A;  5IIF A;  1V43 A;  1TKW B;  2NN6 I;  2DY8 A;  2HQE A;  1WTW A;  1SDF A;  3HOZ B;  2M2L A;  1RDP D;  1XX8 A;  4A93 B;  2M9V A;  3PUW A;  2I07 B;  4DXG A;  4CKC A;  3MVV A;  2B2U C;  5M3M B;  1R4P B;  4MIU A;  1II3 A;  1HA6 A;  4C3J B;  1VCI A;  4UAI A;  3TZU A;  1PFN A;  1BDO A;  4Y7N B;  1SYF A;  2Q8T A;  2A69 C;  1U4P A;  1GUW A;  5EJW A;  3Q0A A;  1KDA A;  2NWG A;  4KD3 A;  4ZRZ A;  1I4R A;  4N9P A;  4FXD A;  2E75 C;  1QIL A;  2K5D A;  4LJZ C;  1TVX A;  5CV7 A;  2K05 A;  3M4O B;  3J7A V;  3S1Q B;  5M5Y B;  2K5W A;  1MSH A;  3S16 B;  2K28 A;  1S5D D;  3I70 A;  3ZYY X;  1IYU A;  3F2U A;  2AQ2 B;  1SJE D;  2F0P A;  2IW3 A;  3E6Z X;  3QG1 A;  2Z4I A;  2SOB A;  1V1O A;  1EEF D;  1S5F D;  1WD1 A;  2RSN A;  1R9T B;  3N52 A;  1VDZ A;  2SDF A;  3S14 B;  1FYC A;  3T51 B;  2K7V A;  1A15 A;  2OXP A;  1JR0 D;  5T1G A;  3DHQ A;  2B2W A;  5J1Z A;  3NTK A;  2PYK A;  5G3L D;  2X69 A;  4RWS C;  3QOJ A;  2TMP A;  4CKE A;  1QOH A;  3K7A B;  2K01 A;  4RGM A;  3I90 A;  1V1P A;  4KY6 A;  1F9Q A;  3GTP B;  3D6W A;  3S9W A;  4DGZ A;  1EZ6 A;  1GOZ A;  4DF7 A;  1RHP A;  1CM9 A;  1HRJ A;  4LAA A;  1U4R A;  3A7A B;  3MA2 B;  1RKN A;  1FR3 A;  2AQ1 B;  3E5S A;  4WFN 3;  2JA5 B;  4DFA A;  2DNE A;  3SK5 A;  1H9J A;  2VB3 X;  2PPB C;  4A3D B;  5JJZ A;  5D3I B;  4FVM A;  4QMG A;  3K0Y A;  3ND9 A;  5IT9 L;  1IYV A;  1QCB D;  1Y8N B;  1QWY A;  2NN6 G;  1D5M C;  4A3E B;  4H0L C;  4KKU A;  1F9S A;  1D5X C;  2FFK B;  2B2Y C;  3MXP A;  4CHT B;  3S1N B;  1ILP A;  3MAQ A;  2OEO A;  1YNJ C;  1DZ1 A;  2L0C A;  3GTL B;  1OXS C;  1EIG A;  1JQY D;  1EZ8 A;  3MHB A;  5COR A;  4F8M A;  3SK6 A;  3VYS A;  3OHX C;  1OXX K;  1RCV D;  1RF2 D;  2Z1C A;  3HOW B;  1BF4 A;  2MP1 A;  4C3I B;  2R3Z A;  1IW7 C;  1PFM A;  4ZLT F;  4C3H B;  1TU2 B;  4IAL A;  2O5I C;  2ZXP A;  3D3R A;  4K6L A;  2KVM A;  2JE6 I;  1L0Y B;  1I4H A;  3Q6S A;  4V0B A;  2IX3 A;  3OIQ A;  4WRD A;  4C1N I;  2RSO A;  2NN6 H;  4ODG A;  2SEB D;  1DJR D;  4B9X A;  2F0N A;  1DM0 B;  3VYT A;  4HMJ A;  3CHB D;  2KJX A;  5FKA C;  3Q24 A;  4KMU C;  4MHE A;  3L7Z C;  2L9H A;  2KEE A;  3S17 B;  4B08 A;  5C4Z A;  2YYZ A;  3H6M A;  3VR2 A;  4F88 A;  1BQQ T;  1EU4 A;  3BDO A;  3HOY B;  3A8K E;  4IUP A;  1TWC B;  5IGE A;  5A2Q L;  2PZW A;  3QWN A;  2BDO A;  4RHS A;  3MFY A;  2AQ3 B;  3VA5 A;  3AU7 A;  4BBS B;  1Y8P B;  4O1N A;  5C0X I;  2L55 A;  1XWE A;  2BOS A;  2VUM B;  1Y1V B;  1GUO A;  3KLS A;  2KCC A;  2EJG C;  3U9S A;  3H91 A;  5E3F A;  5CC4 A;  1OO9 B;  1TWA B;  1S5C D;  2WAC A;  1PLF A;  4KY7 A;  3RUZ A;  1MBY A;  2L4N A;  4HN7 A;  2MJ8 A;  3OW7 A;  2WV6 D;  1GUG A;  2PCF B;  1SFO B;  2WKD A;  4XQN A;  3K5L A;  1Y69 U;  1ESF A;  1RTN A;  3J7A F;  3OWE B;  3HEJ A;  1ZYR C;  1W6J A;  2K33 A;  3SXH A;  1BCP F;  4FO2 A;  2NVQ B;  3OOC A;  1STN A;  1XYI A;  2NUC A;  1WTX A;  4EQP A;  3V05 A;  4B9W A;  1NCV A;  3GTM B;  3J7Y W;  4FF1 A;  3NQT A;  3N6R A;  4M1U B;  2F0F A;  3MXU A;  3NBH A;  5I2Y A;  3QIA A;  4J1M A;  1QE6 A;  1BCP B;  2GA4 B;  1STG A;  1DXM A;  2XWJ B;  4ME5 A;  2DNC A;  2RDG A;  4DK0 A;  1LTR D;  1JC7 A;  3K5O A;  1MSG A;  1TS2 A;  2J7Z A;  3IAY A;  2MGS A;  1JOR A;  1E2V A;  1QJO A;  2EE1 A;  4RCN A;  1SNC A;  3G6J B;  5KGU A;  2NBF A;  3VYU A;  1B44 D;  2ENB A;  1EOT A;  5C4J B;  4JBW A;  2EJF C;  5I9O A;  4S3S A;  2F0V A;  4FNF A;  3IFT A;  2N88 A;  1D6E C;  3ERQ A;  4IQZ A;  4RKL A;  4WJW A;  1MI2 A;  3V2T A;  3HP3 A;  5BN5 A;  1A3T A;  5E1F A;  4K8J A;  1JWU D;  2F3V A;  3C2P A;  1ET9 A;  4CJ0 B;  1GUT A;  1ICW A;  1Y1W B;  1T5X D;  1SND A;  1TS3 A;  3BG3 A;  1B9N A;  5C0X G;  2KEC A;  2ICE C;  1LAC A;  5DM6 3;  2K03 A;  3R2T A;  3VR4 A;  3M3Y B;  5C0X J;  5JEA G;  4ZUI A;  5KNB A;  5DNF A;  5M5X B;  4J8Q A;  1LTI D;  1SE3 A;  3GTO B;  2EYO A;  2XN9 C;  4K5X A;  5EBC A;  5JEA J;  2EYJ A;  4FF2 A;  2HDM A;  5KYL A;  5JAV A;  3EVQ A;  1G8Z D;  1HQM C;  2MHV A;  3IKJ A;  5FO7 B;  2DY7 A;  4C3J G;  1HA5 A;  3HZX A;  1UNS A;  1K83 B;  2NVT B;  3A56 A;  4NP5 A;  1AZQ A;  4RKB A;  1FNV A;  2X6L A;  1OXU A;  5C4X B;  3ITP A;  3W2D A;  3KF8 A;  1IL8 A;  5C0X H;  1LTT D;  4QF4 A;  3FMC A;  4FYD A;  1M4V A;  1SE2 A;  4HSP A;  3T56 B;  1B50 A;  3K6O A;  2Y0S B;  4Q0F A;  3UI2 A;  5JEA H;  1LV9 A;  4X3T A;  4BY7 B;  1KNE A;  2F4I A;  3DWA A;  1TWG B;  1STH A;  3NTH A;  4LMQ D;  1A2T A;  4DA2 A;  1HHV A;  5NUC A;  1RJT A;  2KHS A;  1CQF A;  2Z4H A;  1BNZ A;  3K5N A;  1GUS A;  4L6T B;  1WVL A;  4XDX A;  4HCS A;  3TZD A;  5IOD A;  4N9T A;  4QCL A;  2D9U A;  4IN3 A;  5EPK A;  1DD2 A;  4PNY A;  4XYO A;  1HQR D;  3QOL A;  1ONL A;  2XRS D;  5CV5 A;  2F0L A;  4ILW A;  2VXW A;  1SJH D;  1S5B D;  1LAB A;  3H3V C;  4HMI A;  5IGD A;  5KND A;  2B2T A;  1D1K A;  2PO4 A;  1KNA A;  5FOB B;  3E0J A;  1SYG A;  1JOK A;  1EYD A;  2O2L D;  3GD7 A;  2F0O A;  4KV6 A;  1G29 1;  4R8I A;  2L11 A;  1KDB A;  1B9M A;  1F2Y A;  2B2W C;  4L8J A;  1STY A;  2JEB I;  2WAQ B;  2YU9 B;  3TME A;  4EQN A;  1G91 A;  3C1E A;  1Y8O B;  3PUV A;  3VA7 A;  2HCI A;  1TQO A;  2ICI A;  2F0M A;  2G9H D;  4KJN A;  2QKI C;  1WTO A;  4K14 A;  5ISR A;  1Z7T A;  4ABN A;  1NR2 A;  1WTP A;  5J22 A;  3GV3 A;  3IL8 A;  4ULL A;  3A8I E;  5KNC A;  3D6C A;  3T13 A;  5IGG A;  3PV0 A;  5EPJ A;  3IFD A;  1PDQ A;  1AW7 A;  2LS0 1;  1MGS A;  5C44 B;  1X3P A;  3DEO A;  4F7X A;  1QG7 A;  2QCP X;  2F0I A;  3ND8 A;  4K5V A;  1AFP A;  4C3I G;  2FHT A;  1C8C A;  4OHJ A;  4C3H G;  4KHV A;  1STE A;  1EY7 A;  3SE0 A;  1V8Q A;  3DEP A;  3KLR A;  3LX0 A;  1UUP A;  1ET6 A;  3MWY W;  3HGB A;  1Z47 A;  4HSV A;  1B4O A;  1KAA A;  4K2K A;  1C48 A;  3A7L A;  2NTS A;  2RVL A;  3BZD B;  5ELC A;  4RFB A;  1G2T A;  2F0G A;  4KK7 A;  4CBV A;  4BWG B;  2XWB B;  1I4G A;  2F0D A;  2R6G A;  4BY1 B;  3I4N B;  3D31 A;  1ZEQ X;  3BYY B;  1E2W A;  3OMG A;  2JA7 B;  3P1H A;  3FVQ A;  4XYQ A;  3VR3 A;  3NP8 A;  1H9S B;  2NB0 A;  2A68 C;  2PW7 A;  2LKV A;  3G7L A;  4DNR B;  2RQX A;  1SNQ A;  1A2U A;  2B39 A;  3O13 A;  1IHZ A;  2A6E C;  4RCO A;  2M00 A;  4H13 C;  3QJY A;  2BA1 A;  4KTA A;  2A6H D;  1EY0 A;  1U4M A;  1CHP D;  2IJ0 A;  2VB2 X;  2EY6 A;  2I46 A;  2OF1 A;  3A8J E;  2QF7 A;  3FPU B;  1WTR A;  4OGQ C;  3J80 L;  3DUZ A;  4ZYS A;  3CU7 A;  1SMY D;  4YIJ A;  1F9R A;  2C5C A;  2J0T D;  5ELF A;  5KYI A;  5KRU A;  1SYC A;  1PFB A;  4EVO A;  4BS9 A;  3K57 A;  5TSS A;  2B2V C;  1HUN A;  3NK9 A;  2BE5 D;  5FLX L;  1BO0 A;  1U9R A;  3BVZ A;  4IFD I;  1IKL A;  1SYE A;  3S2D B;  3MZ5 A;  1EYA A;  3VR5 A;  2JYO A;  2F0K A;  3H09 A;  1LTB D;  1I3Q B;  5E4X A;  1HTP A;  1MD2 D;  2F3W A;  2ZXR A;  4H7B A;  2LMC B;  3EFX D;  2QDB A;  4A3J B;  3TP7 A;  1SYD A;  2NZ1 D;  2R61 A;  1K8M A;  2V4D A;  5ELB A;  1BCP D;  2D5D A;  3I8Z A;  3WOF A;  5I4D A;  1FGB D;  3JAM E;  3PIP 3;  4PV1 C;  1EY6 A;  1QNU A;  3PO3 B;  2LY7 A;  1Q3L A;  5M5W B;  3V96 A;  1O78 A;  3FPP A;  1NSN S;  4BA1 I;  4RA8 A;  2N55 A;  2K04 A;  3I72 A;  2KOL A;  4X3U A;  1PRT D;  1CT1 D;  2NVY B;  1PZJ D;  3HOV B;  4XQJ A;  1PYW D;  1PTO F;  2F0T A;  5EKK A;  3T53 B;  2EZV A;  1VMP A;  1AN8 A;  3M4Y A;  4U68 A;  1LT3 D;  3P75 A;  1EY4 A;  3W3A A;  3KUP A;  3FKI B;  1SSO A;  1F77 A;  1B1Z A;  4XT1 B;  1SNO A;  1STA A;  1PTO B;  1H9M A;  2JA6 B;  2JA8 B;  2IWH A;  5K36 G;  2E2J B;  4LK1 C;  2R92 B;  2FMM A;  3NSW A;  1WTV A;  5DEH A;  3BDL A;  2XVS A;  3KLS X;  4KHZ A;  4KD4 A;  5LL6 S;  1O7Z A;  4NW2 A;  1STB A;  2R7Z B;  1DYQ A;  1JCK B;  3L3O C;  4DNT B;  3K58 A;  5BN3 A;  1I4P A;  3S2H B;  5IGC A;  1EY9 A;  2MUY A;  2H1E A;  2E2H B;  1TT2 A;  1YNN D;  1LLR D;  1ZKO A;  3H0G B;  1LTS D;  4ZQ3 A;  2Q8R E;  4Q5V A;  1JOQ A;  5CBA E;  3S1R B;  1H9S A;  5COY A;  5KIX A;  4IUT A;  3I91 A;  2O4X A;  1JWS D;  1SAP A;  1BR9 A;  4FXK C;  5C3X A;  1GHK A;  1CA5 A;  1CFM A;  4A3F B;  5K36 H;  1E0B A;  4IFD G;  4CJ1 B;  5JPM C;  5CV6 A;  4G7H C;  4A3K B;  1PMR A;  1OXT A;  4M8A A;  2KA7 A;  4IUR A;  2EY5 A;  5FO8 B;  4IFD J;  1I4X A;  2HDL A;  2A73 B;  2FIN B;  3BS1 A;  4ZUJ A;  4G57 A;  4ZKB B;  4FP5 D;  4R8N A;  1SE4 A;  3NTI A;  5EPL A;  5J39 A;  1V1P B;  4HAE A;  4MN3 A;  3AMU A;  3VR6 A;  1ESR A;  3FEW X;  3GTG B;  4A3G B;  2XSC A;  2R93 B;  2RA4 A;  3PMF A;  4FXG C;  3KK7 A;  2EY1 A;  2K32 A;  3TP5 A;  2A6H C;  2JP1 A;  3DXJ C;  3S1M B;  1EIH A;  5CV9 A;  3EJI A;  2IX0 A;  1H9R A;  4IFD H;  1BBX C;  1EWC A;  5CV8 A;  1A3V A;  1GJX A;  4J6H A;  3MFG A;  1SMY C;  4A3M B;  3NWS A;  2E74 C;  3H94 A;  4QUF A;  2L12 A;  2IX1 A;  4A3I B;  1BUV T;  3NBI A;  4F87 A;  1JWM D;  1DOM A;  3MC0 B;  3GTJ B;  1JE4 A;  3GP7 A;  3CQZ B;  4I7Z C;  1B2T A;  1KDC A;  3A55 A;  4TSS A;  4GZY C;  1B53 A;  1TWF B;  5I6W A;  4G7O C;  1T5E A;  4HED A;  2XNA C;  2PW5 A;  4KKS A;  1TWH B;  1CTM A;  1XXG A;  4OL7 A;  2EYF A;  1DON A;  1EQT A;  5C3E B;  4C1N K;  1KLU D;  1UAP A;  3C3L A;  1TS5 A;  1DOK A;  2DN8 A;  4KI0 A;  2B2T C;  4KJO A;  1BCP C;  1HUM A;  4V19 0;  5DAU A;  2CQA A;  3WOE A;  3GV6 A;  1FNW A;  2B63 B;  1S4Z A;  3OSO A;  2CHB D;  2D2C C;  5C3W A;  3M7G A;  4KY5 A;  3BVM A;  5KEE A;  1TS4 A;  2EYL A;  3CRK C;  2H4O A;  4NKL A;  5CYU A;  1CHQ D;  2IL8 A;  1EQV A;  1ENF A;  1U4L A;  4U67 3;  5EBD A;  1SNP A;  4KN7 C;  1HCZ A;  2FMC A;  4K6D A;  1PRT C;  1J9O A;  3R93 A;  2E76 C;  2O5J C;  5IT9 E;  4OO1 I;  3J81 L;  2J4X A;  2EPB A;  2NVX B;  2EYH A;  1M8A A;  1D2B A;  4O42 A;  2B2U A;  4G4K A;  2EYP A;  3R2I A;  4H44 C;  4TQU S;  3MXG A;  1E2Z A;  2JSO A;  2OT2 A;  3HG9 A;  3SK4 A;  1A6X A;  1F9P A;  3RMH A;  2RDH A;  3GO5 A;  3HRZ C;  1EY8 A;  1EWH A;  3TSS A;  1ZYR D;  1D5Z C;  1L0X B;  4E6I A;  1PXU A;  1JOO A;  3U9O A;  3LWE A;  4FF4 A;  3Q23 A;  2LFN A;  1HTL D;  2QIL A;  5EKI A;  2G9D A;  5D14 A;  1AP0 A;  2AWN A;  3X3M A;  3J80 E;  1YNN C;  3P20 A;  1I6H B;  3NHH A;  3D8G A;  3HOU B;  4OIK A;  1HFN A;  4DU9 A;  1RTO A;  1GUN A;  3TBI B;  1W6K A;  1VF7 A;  3KBG A;  1LT5 D;  4HCE A;  4G7Z C;  5FLX E;  2Q8I B;  2F03 A;  1S5E D;  3D4W A;  3DM1 A;  1Q1E A;  1CI3 M;  2Z8L A;  3EQL C;  2BDN A;  5A2Q E;  5JVH 3;  4DAY A;  1HPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...