3SRCA

Structure of pseudomonas aeruginosa pvdq bound to ns2028
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
164
structure length
164
Chain Sequence
TGLAADIRWTAYGVPHIRAKDERGLGYGIGYAYARDNACLLAEEIVTARGERARYFGSEGKSSAELDNLPSDIFYAWLNQPEALQAFWQAQTPAVRQLLEGYAAGFNRFLREADGKTTSCLGQPWLRAIATDDLLRLTRRLLVEGGVGQFADALVAAAPPGAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-homoserine lactone acylase pvdQ
publication title Structural Characterization and High-Throughput Screening of Inhibitors of PvdQ, an NTN Hydrolase Involved in Pyoverdine Synthesis.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 164
sequence length 164
ec nomenclature ec 3.5.1.97: Acyl-homoserine-lactone acylase.
pdb deposition date 2011-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 3srcA00
1K5SA 1H2GA 1AI6A 1KECA 4YFAA 1PNMA 2AE4A 4WKUA 3SRAA 3SRBA 1GKFA 1AJQA 1KEHA 4WKTA 2WYDA 1JVZA 3ML0A 3JTQA 3JTRA 4E56A 2AE5A 1FXVA 2AE3A 1FM2A 1K7DA 2WYBA 1AI7A 3K3WA 4PELA 4K2GA 1GM8A 1AJNA 4BTHA 3L91A 3SRCA 4E57A 1GK0A 4YF9A 4HSTA 1PNLA 1JW0A 2ADVA 1JX9A 4M1JA 4HSRA 4K2FA 1AI4A 1GK1A 3S8RA 2WYCA 1GM7A 1OR0A 1AI5A 1PNKA 1GM9A 4PEMA 4WKVA 1AJPA 4YFBA 4WKSA 1K5QA 1GHDA 4E55A 2WYEA 3L94A 1GK9A 1FXHA 1CP9A 1E3AA
chains in the Genus database with same CATH superfamily
1K5SA 1H2GA 1AI6A 1KECA 4YFAA 1PNMA 2AE4A 4WKUA 3SRAA 3SRBA 1GKFA 1AJQA 1KEHA 4WKTA 2WYDA 1JVZA 3ML0A 3JTQA 3JTRA 4E56A 2AE5A 1FXVA 2AE3A 1FM2A 1K7DA 2WYBA 1AI7A 3K3WA 4PELA 4K2GA 1GM8A 1AJNA 4BWCA 4BTHA 3L91A 3SRCA 4E57A 1GK0A 4YF9A 4HSTA 1PNLA 1JW0A 2ADVA 1JX9A 4M1JA 4HSRA 4K2FA 1AI4A 1GK1A 3FGRA 2WYCA 1GM7A 1OR0A 1AI5A 3S8RA 1PNKA 1GM9A 4PEMA 4WKVA 1AJPA 4YFBA 3FGTA 4WKSA 1K5QA 1GHDA 4E55A 2WYEA 3L94A 1GK9A 1FXHA 1CP9A 1E3AA
chains in the Genus database with same CATH topology
1K5SA 1H2GA 1AI6A 1KECA 4YFAA 1PNMA 2AE4A 4WKUA 3SRAA 3SRBA 1GKFA 1AJQA 1KEHA 4WKTA 2WYDA 1JVZA 3ML0A 3JTQA 3JTRA 4E56A 2AE5A 1FXVA 2AE3A 1FM2A 1K7DA 2WYBA 1AI7A 3K3WA 4PELA 4K2GA 1GM8A 1AJNA 4BTHA 3L91A 3SRCA 4E57A 1GK0A 4YF9A 4HSTA 1PNLA 1JW0A 2ADVA 1JX9A 4M1JA 4HSRA 4K2FA 1AI4A 1GK1A 3S8RA 2WYCA 1GM7A 1OR0A 1AI5A 1PNKA 1GM9A 4PEMA 4WKVA 1AJPA 4YFBA 4WKSA 1K5QA 1GHDA 4E55A 2WYEA 3L94A 1GK9A 1FXHA 1CP9A 1E3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K5S A;  1H2G A;  1AI6 A;  1KEC A;  4YFA A;  1PNM A;  2AE4 A;  4WKU A;  3SRA A;  3SRB A;  1GKF A;  1AJQ A;  1KEH A;  4WKT A;  2WYD A;  1JVZ A;  3ML0 A;  3JTQ A;  3JTR A;  4E56 A;  2AE5 A;  1FXV A;  2AE3 A;  1FM2 A;  1K7D A;  2WYB A;  1AI7 A;  3K3W A;  4PEL A;  4K2G A;  1GM8 A;  1AJN A;  4BTH A;  3L91 A;  3SRC A;  4E57 A;  1GK0 A;  4YF9 A;  4HST A;  1PNL A;  1JW0 A;  2ADV A;  1JX9 A;  4M1J A;  4HSR A;  4K2F A;  1AI4 A;  1GK1 A;  3S8R A;  2WYC A;  1GM7 A;  1OR0 A;  1AI5 A;  1PNK A;  1GM9 A;  4PEM A;  4WKV A;  1AJP A;  4YFB A;  4WKS A;  1K5Q A;  1GHD A;  4E55 A;  2WYE A;  3L94 A;  1GK9 A;  1FXH A;  1CP9 A;  1E3A A; 
#chains in the Genus database with same CATH topology
 1K5S A;  1H2G A;  1AI6 A;  1KEC A;  4YFA A;  1PNM A;  2AE4 A;  4WKU A;  3SRA A;  3SRB A;  1GKF A;  1AJQ A;  1KEH A;  4WKT A;  2WYD A;  1JVZ A;  3ML0 A;  3JTQ A;  3JTR A;  4E56 A;  2AE5 A;  1FXV A;  2AE3 A;  1FM2 A;  1K7D A;  2WYB A;  1AI7 A;  3K3W A;  4PEL A;  4K2G A;  1GM8 A;  1AJN A;  4BWC A;  4BTH A;  3L91 A;  3SRC A;  4E57 A;  1GK0 A;  4YF9 A;  4HST A;  1PNL A;  1JW0 A;  2ADV A;  1JX9 A;  4M1J A;  4HSR A;  4K2F A;  1AI4 A;  1GK1 A;  3FGR A;  2WYC A;  1GM7 A;  1OR0 A;  1AI5 A;  3S8R A;  1PNK A;  1GM9 A;  4PEM A;  4WKV A;  1AJP A;  4YFB A;  3FGT A;  4WKS A;  1K5Q A;  1GHD A;  4E55 A;  2WYE A;  3L94 A;  1GK9 A;  1FXH A;  1CP9 A;  1E3A A; 
#chains in the Genus database with same CATH homology
 1K5S A;  1H2G A;  1AI6 A;  1KEC A;  4YFA A;  1PNM A;  2AE4 A;  4WKU A;  3SRA A;  3SRB A;  1GKF A;  1AJQ A;  1KEH A;  4WKT A;  2WYD A;  1JVZ A;  3ML0 A;  3JTQ A;  3JTR A;  4E56 A;  2AE5 A;  1FXV A;  2AE3 A;  1FM2 A;  1K7D A;  2WYB A;  1AI7 A;  3K3W A;  4PEL A;  4K2G A;  1GM8 A;  1AJN A;  4BTH A;  3L91 A;  3SRC A;  4E57 A;  1GK0 A;  4YF9 A;  4HST A;  1PNL A;  1JW0 A;  2ADV A;  1JX9 A;  4M1J A;  4HSR A;  4K2F A;  1AI4 A;  1GK1 A;  3S8R A;  2WYC A;  1GM7 A;  1OR0 A;  1AI5 A;  1PNK A;  1GM9 A;  4PEM A;  4WKV A;  1AJP A;  4YFB A;  4WKS A;  1K5Q A;  1GHD A;  4E55 A;  2WYE A;  3L94 A;  1GK9 A;  1FXH A;  1CP9 A;  1E3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...