3SRJA

Pfama1 in complex with invasion-inhibitory peptide r1
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
340
structure length
298
Chain Sequence
MGNPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSKTTFLTPVATGNQYLKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNGPRYCNSMFCFRPAKDISFQNYVYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKQDRYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINDKSYIATTALSHPIEVENNFPSVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apical membrane antigen 1, AMA1
publication title Structural and functional insights into the malaria parasite moving junction complex.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Cell invasion/inhibitor
total genus 84
structure length 298
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 3srjA01
3HMSA 4R1CA 2X2ZA 5EODA 1NK1A 1GMOA 2YIOA 1BHTA 2HGFA 2Z8WA 5CS3A 4DURA 2Z8VA 5CS9A 2K13X 5CP9A 1YXEA 5CSQA 2Q8BA 1Z40A 1HKYA 5EOKA 3HMTA 3SP8A 2LL3A 2Q8AA 2YIPA 3ZWZA 4Z0FA 1GP9A 5COEA 2F83A 4IUAA 4APMA 4Z09A 5CT3A 5I25A 3HMRA 1I8NA 4A5TS 2QJ2A 4R1BA 1W81A 4Z0EA 3ZLEA 3SRIA 5CT2A 4Z0DA 4UV6A 3HN4A 5CS1A 4R1AA 4R19A 5CS5A 2QJ4A 1W8KA 2LL4M 5CT1A 2Y8RA 4UAOA 2YILA 3SRJA 3MKPA 2J8LA 2J8JA 4APLA 1GMNA
chains in the Genus database with same CATH superfamily
3HMSA 4R1CA 2X2ZA 5EODA 1NK1A 1GMOA 2YIOA 1BHTA 2HGFA 2Z8WA 5CS3A 4DURA 2Z8VA 5CS9A 2K13X 5CP9A 1YXEA 5CSQA 2Q8BA 1Z40A 1HKYA 5EOKA 3HMTA 4YIVA 3SP8A 2LL3A 2Q8AA 2YIPA 2KL5A 3ZWZA 4Z0FA 1GP9A 5COEA 2F83A 4IUAA 4APMA 4Z09A 5CT3A 5I25A 3HMRA 1I8NA 4A5TS 2QJ2A 4R1BA 1W81A 4Z0EA 3ZLEA 3SRIA 5CT2A 4Z0DA 4UV6A 3HN4A 5CS1A 4R1AA 4YIZA 4R19A 5CS5A 2QJ4A 1W8KA 2LL4M 5CT1A 2Y8RA 4UAOA 2YILA 3SRJA 3MKPA 2J8LA 2J8JA 4APLA 1GMNA
chains in the Genus database with same CATH topology
3HMSA 4R1CA 2X2ZA 5EODA 1NK1A 1GMOA 2YIOA 1BHTA 2HGFA 2Z8WA 5CS3A 4DURA 2Z8VA 5CS9A 2K13X 5CP9A 1YXEA 5CSQA 2Q8BA 1Z40A 1HKYA 5EOKA 3HMTA 4YIVA 3SP8A 2LL3A 2Q8AA 2YIPA 2KL5A 3ZWZA 4Z0FA 1GP9A 5COEA 2F83A 4IUAA 4APMA 4Z09A 5CT3A 5I25A 3HMRA 1I8NA 4A5TS 2QJ2A 4R1BA 1W81A 4Z0EA 3ZLEA 3SRIA 5CT2A 4Z0DA 4UV6A 3HN4A 5CS1A 4R1AA 4YIZA 4R19A 5CS5A 2QJ4A 1W8KA 2LL4M 5CT1A 2Y8RA 4UAOA 2YILA 3SRJA 3MKPA 2J8LA 2J8JA 4APLA 1GMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HMS A;  4R1C A;  2X2Z A;  5EOD A;  1NK1 A;  1GMO A;  2YIO A;  1BHT A;  2HGF A;  2Z8W A;  5CS3 A;  4DUR A;  2Z8V A;  5CS9 A;  2K13 X;  5CP9 A;  1YXE A;  5CSQ A;  2Q8B A;  1Z40 A;  1HKY A;  5EOK A;  3HMT A;  3SP8 A;  2LL3 A;  2Q8A A;  2YIP A;  3ZWZ A;  4Z0F A;  1GP9 A;  5COE A;  2F83 A;  4IUA A;  4APM A;  4Z09 A;  5CT3 A;  5I25 A;  3HMR A;  1I8N A;  4A5T S;  2QJ2 A;  4R1B A;  1W81 A;  4Z0E A;  3ZLE A;  3SRI A;  5CT2 A;  4Z0D A;  4UV6 A;  3HN4 A;  5CS1 A;  4R1A A;  4R19 A;  5CS5 A;  2QJ4 A;  1W8K A;  2LL4 M;  5CT1 A;  2Y8R A;  4UAO A;  2YIL A;  3SRJ A;  3MKP A;  2J8L A;  2J8J A;  4APL A;  1GMN A; 
#chains in the Genus database with same CATH topology
 3HMS A;  4R1C A;  2X2Z A;  5EOD A;  1NK1 A;  1GMO A;  2YIO A;  1BHT A;  2HGF A;  2Z8W A;  5CS3 A;  4DUR A;  2Z8V A;  5CS9 A;  2K13 X;  5CP9 A;  1YXE A;  5CSQ A;  2Q8B A;  1Z40 A;  1HKY A;  5EOK A;  3HMT A;  4YIV A;  3SP8 A;  2LL3 A;  2Q8A A;  2YIP A;  2KL5 A;  3ZWZ A;  4Z0F A;  1GP9 A;  5COE A;  2F83 A;  4IUA A;  4APM A;  4Z09 A;  5CT3 A;  5I25 A;  3HMR A;  1I8N A;  4A5T S;  2QJ2 A;  4R1B A;  1W81 A;  4Z0E A;  3ZLE A;  3SRI A;  5CT2 A;  4Z0D A;  4UV6 A;  3HN4 A;  5CS1 A;  4R1A A;  4YIZ A;  4R19 A;  5CS5 A;  2QJ4 A;  1W8K A;  2LL4 M;  5CT1 A;  2Y8R A;  4UAO A;  2YIL A;  3SRJ A;  3MKP A;  2J8L A;  2J8J A;  4APL A;  1GMN A; 
#chains in the Genus database with same CATH homology
 3HMS A;  4R1C A;  2X2Z A;  5EOD A;  1NK1 A;  1GMO A;  2YIO A;  1BHT A;  2HGF A;  2Z8W A;  5CS3 A;  4DUR A;  2Z8V A;  5CS9 A;  2K13 X;  5CP9 A;  1YXE A;  5CSQ A;  2Q8B A;  1Z40 A;  1HKY A;  5EOK A;  3HMT A;  4YIV A;  3SP8 A;  2LL3 A;  2Q8A A;  2YIP A;  2KL5 A;  3ZWZ A;  4Z0F A;  1GP9 A;  5COE A;  2F83 A;  4IUA A;  4APM A;  4Z09 A;  5CT3 A;  5I25 A;  3HMR A;  1I8N A;  4A5T S;  2QJ2 A;  4R1B A;  1W81 A;  4Z0E A;  3ZLE A;  3SRI A;  5CT2 A;  4Z0D A;  4UV6 A;  3HN4 A;  5CS1 A;  4R1A A;  4YIZ A;  4R19 A;  5CS5 A;  2QJ4 A;  1W8K A;  2LL4 M;  5CT1 A;  2Y8R A;  4UAO A;  2YIL A;  3SRJ A;  3MKP A;  2J8L A;  2J8J A;  4APL A;  1GMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...