3SS0A

Engineered high-affinity halide-binding protein derived from yfp: fluoride complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
236
structure length
231
Chain Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMRQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYAQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Determination of engineered chloride-binding site structures in fluorescent proteins reveals principles of halide recognition
rcsb
source organism Aequorea victoria
molecule tags Halide binding protein
total genus 59
structure length 231
sequence length 236
ec nomenclature
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ss0A00
2GW4B 1H6RA 3U8AA 5EXBA 2Z6XA 4W6IA 4IZNA 2HGDA 3WLDA 1GL4A 2FZUA 4HQ8A 3VHTB 4OQWA 1Q4EA 3EKJA 3S05A 5HW9A 3AI5A 2G6YA 2YDZA 3ED8A 3SSKA 4JFGA 4W6MA 2AH8A 4XGYA 2VAEA 2QLGB 1EMAA 3E5TA 2AWLA 2Z6YA 4IK9A 2A46A 2A54B 3DPXA 1F0BA 4H3MA 5FVGA 2QT2A 3DQNA 3DQ5A 4KF5A 4KGEA 4W6PA 2BTJA 5DQBA 4U2VA 2RH7A 3SG4A 3DQHA 3OSQA 4B5YA 1HCJA 3EVRA 2DDDA 4HE4A 5EBJA 1CV7A 1OXDA 2FL1A 1EMMA 4KAGA 2DDCA 4OY4A 4W76A 1EMKA 3LF3A 3CB9A 4RTCA 2PXWA 4DKMA 3NEZA 1UISA 2EMDA 3ZULA 3RWAA 4XVPA 1HUYA 2GX2A 2POXA 2Q57A 3U0NA 3SG6A 4LQUA 5EB6A 4LJDA 3A8SA 2C9IA 5DRFA 3DQLA 4IK5A 4W6DA 2WISA 2YE1A 3E5WA 4W6NA 3H1OA 2QLEA 1GFLA 2A52B 4JF9A 1JC1A 4UTSA 1KYPA 3LVCA 2GW3A 3W1DA 4JGEA 2PXSA 2WHTA 3DQ2A 4HVFA 2C9JA 3UFZA 3OGOA 4W77A 1RRXA 2Z6ZA 3EKHA 3CD9A 5LTQA 4B30A 4LJBA 2G3OA 4IK1A 3DPWA 4I2YA 1OXEA 2ICRA 4ZFSA 4DKNA 5EXUA 3SVCA 4AR7A 3DQIA 2GX0A 3SSLA 1W7TA 4TZAA 4RYWA 2YFPA 3GL4A 3NT9A 1G7KA 4W6JA 4W6UA 3LSAA 4EDSA 2B3QA 5J2OA 2H5QA 3SVSA 3EVVA 3CD1A 3SVUA 1RMPA 2HPWA 3CFFA 3LF4B 4W6LA 5BQLA 3CFHA 4ZF5A 2H6VA 2WSNA 3VHTA 3ZUFA 4KGFA 5HGEA 2HGYA 1ZGPA 2YE0A 3ST0A 4R6DA 3U0MA 4W6RA 1XSSA 3CGLA 3AKOA 2EMOA 4W72A 2OTBA 3E5VA 2HJOA 4DXOA 3MGFA 4Q7TA 2QLGA 5DTXA 4W6FA 2IB6A 2VVHA 3GB3A 1JBZA 1H4UA 4IK3A 4Q7RA 1KP5A 3U8PA 4XOVA 3SS0A 5HZUA 1YJFA 2WIQA 3DQ7A 4R6BA 4ZINA 3DQ9A 3GJ1A 4Q9XA 1C4FA 2WHSA 4PFEA 3EVUA 2H5PA 2QZ0A 3K1KA 1Q4AA 3O78A 4L13A 3KCTA 4W7XA 5BTTB 2WSOA 1XQMA 4W74A 2A48A 4KW4A 4H47A 2VADA 4PPJA 3U0KA 1JBYA 2QRFA 2DD9A 3GJ2A 4PPLA 3SG5A 5FVFA 3SVNA 3H1RA 4EULA 2HFCA 5DTYA 3M24A 2G2SB 4ORNA 5FVIA 4W7AA 2G5ZB 1JC0A 2H9WA 4AS8A 3TMTA 1Q73A 1YFPA 5EXCI 4N3DA 1EMFA 5FHVA 4OJ0A 4XL5A 2H5OA 3M22A 2V4EA 5LTRA 4BDUA 4RYSA 2OKYA 3U8CA 1MOVA 3ST3A 2IOVA 3CFAA 1RM9A 3EK8A 4HQCA 5DPHA 2A56B 4OHSA 4W7RA 1YHIA 2HCGA 4W73A 1QXTA 3KCSA 3SG2A 5KTGA 2ZMUA 3U0LA 4W6SA 3G9AA 4J88A 3ZUJA 1EMCA 3PIBA 5DU0A 4DXQA 3PJ7A 1MOUA 2ZMWA 3DQ4A 4JC2A 3DQCA 3O77A 4Z4MA 3P8UA 4Q9WA 2VVJA 3DQMA 3V3DA 2O24A 4P76A 4KW9A 4ZIOA 2DD7A 4JRBA 2A53B 2OKWA 3LVDA 4EN1A 3P28A 4KEXA 3NEDA 3DQDA 2O29A 3SVEA 3PJBA 4W7FA 2ARLA 4IK4A 2QLHA 5H89A 4W6HA 3BXBA 2QU1A 3TMRA 1QYQA 5LTPA 4NWSA 4W6OA 2Z1OA 2OJKA 3SVDA 2DUHA 4Z4KA 3LS3A 4J89A 5HBDA 4IK8A 4LQTA 3ST4A 4KF4A 4HQ9A 4W6TA 1W7SA 3IR8A 2AWMA 2FWQA 4DXPA 5EJUA 2VVIA 5H88A 5DTZA 1KYRA 4H48A 2H5RA 2P4MA 2DUIA 3IP2A 4W75A 2VZXA 5DY6A 1XMZA 5BTTA 2QLIA 2IE2A 3SG3A 3DQ8A 3DQ3A 4ZB1A 1YHHA 3SSPA 3BX9A 4DXMA 4Q7UA 2IB5A 2OGRA 1KYSA 3DPZA 3SRYA 5EB7A 1ZGOA 4OGSA 4DXNA 5H87A 4ANJA 3NF0A 5BT0A 2HRSA 4W69A 2B3PA 3SVOA 3ZTFA 4W7EA 4H3LA 4GF6B 3SV5A 1EMGA 3DQFA 5DPIA 4ZF4A 1QYFA 3EVPA 3UG0A 4W6CA 1Z1PA 3DQOA 5F9GA 1W7UA 1F09A 4GESB 3SSTA 1QYOA 3WCKA 2H8QA 3BXCA 1EMBA 2WHUA 4KF5C 2ZO6A 3W1CA 3AI4A 3SVBA 2DUFA 4W6KA 1XAEA 3PJ5A 3RWTA 3EK7A 4W6AA 1Q4CA 4H3NA 2Q6PA 2EMNA 4W6GA 2AWKA 2A50B 3ADFA 1B9CA 2AWJA 2A47A 1YZWA 3DQ1A 3DQ6A 5HZOA 2OTEA 3DQEA 1ZGQA 1YJ2A 5DTLA 2G3DB 4ZF3A 5DPJA 3SSVA 2DUEA 4KPIA 1RMMA 3ST2A 4JEOA 1MYWA 5LK4A 4KW8A 1YHGA 4EMQA 2AHAA 3BXAA 1Q4DA 4LJDC 2HQKA 2V4EC 4KA9A 1EMEA 4W6BA 2O2BA 4LJCA 3DQJA 3GEXA 4EDOA 1BFPA 3CBEA 4W7CA 5HZTA 1GGXA 3WLCA 5HZSA 2ZO7A 3OSRA 5AQBB 2V4EB 2G6EA 3LVAA 3NT3A 1RMOA 3SSYA 3LA1A 4P1QA 4TZGA 2DUGA 5T3IA 3EK4A 5DQMA 3SG7A 1EMLA 2JADA 3I19A 3VICA 5DRGA 1OXFA 4L12A 1QY3A 4LW5A 2Y0GA 5EHUA 3DQUA 4XOWA 1Q4BA 4DXIA 4W7DA 4L1IA 1XA9A 4B30B 3SVRA 4ZBLA 3DQAA 2G16B 1ZUXA 3VK1A 4J8AA 5DPGA 4GOBA 1Z1QA 2G6XA 2HQZA 4PPKA 3DQKA 2WURA 1S6ZA 3SSHA
chains in the Genus database with same CATH superfamily
2GW4B 1H6RA 3U8AA 5EXBA 2Z6XA 4W6IA 4IZNA 2HGDA 3WLDA 1GL4A 2FZUA 4HQ8A 3VHTB 4OQWA 1Q4EA 3EKJA 3S05A 5HW9A 3AI5A 2G6YA 2YDZA 3ED8A 3SSKA 4JFGA 4W6MA 2AH8A 4XGYA 2VAEA 2QLGB 1EMAA 3E5TA 2AWLA 2Z6YA 4IK9A 2A46A 2A54B 3DPXA 1F0BA 4H3MA 5FVGA 2QT2A 3DQNA 3DQ5A 4KF5A 4KGEA 4W6PA 2BTJA 5DQBA 4U2VA 2RH7A 3SG4A 3DQHA 3OSQA 4B5YA 1HCJA 3EVRA 2DDDA 4HE4A 5EBJA 1CV7A 1OXDA 2FL1A 1EMMA 4KAGA 2DDCA 4OY4A 4W76A 1EMKA 3LF3A 3CB9A 4RTCA 2PXWA 4DKMA 3NEZA 1UISA 2EMDA 3ZULA 3RWAA 4XVPA 1HUYA 2GX2A 2POXA 2Q57A 3U0NA 3SG6A 4LQUA 5EB6A 4LJDA 3A8SA 2C9IA 5DRFA 3DQLA 4IK5A 4W6DA 2WISA 2YE1A 3E5WA 4W6NA 3H1OA 2QLEA 1GFLA 2A52B 4JF9A 1JC1A 4UTSA 1KYPA 3LVCA 2GW3A 3W1DA 4JGEA 2PXSA 2WHTA 3DQ2A 4HVFA 2C9JA 3UFZA 3OGOA 4W77A 1RRXA 2Z6ZA 3EKHA 3CD9A 5LTQA 4B30A 4LJBA 2G3OA 4IK1A 3DPWA 4I2YA 1OXEA 2ICRA 4ZFSA 4DKNA 5EXUA 3SVCA 4AR7A 3DQIA 2GX0A 3SSLA 1W7TA 4TZAA 4RYWA 2YFPA 3GL4A 3NT9A 1G7KA 4W6JA 4W6UA 3LSAA 4EDSA 2B3QA 5J2OA 2H5QA 3SVSA 3EVVA 3CD1A 3SVUA 1RMPA 2HPWA 3CFFA 3LF4B 4W6LA 5BQLA 3CFHA 4ZF5A 2H6VA 2WSNA 3VHTA 3ZUFA 4KGFA 5HGEA 2HGYA 1ZGPA 2YE0A 3ST0A 4R6DA 3U0MA 4W6RA 1XSSA 3CGLA 3AKOA 2EMOA 4W72A 2OTBA 3E5VA 2HJOA 4DXOA 3MGFA 4Q7TA 2QLGA 5DTXA 4W6FA 2IB6A 2VVHA 3GB3A 1JBZA 1H4UA 4IK3A 4Q7RA 1KP5A 3U8PA 4XOVA 3SS0A 5HZUA 1YJFA 2WIQA 3DQ7A 4R6BA 4ZINA 3DQ9A 3GJ1A 4Q9XA 1C4FA 2WHSA 4PFEA 3EVUA 2H5PA 2QZ0A 3K1KA 1Q4AA 3O78A 4L13A 3KCTA 4W7XA 5BTTB 2WSOA 1XQMA 4W74A 2A48A 4KW4A 4H47A 2VADA 4PPJA 3U0KA 1JBYA 2QRFA 2DD9A 3GJ2A 4PPLA 3SG5A 5FVFA 3SVNA 3H1RA 4EULA 2HFCA 5DTYA 3M24A 2G2SB 4ORNA 5FVIA 4W7AA 2G5ZB 1JC0A 2H9WA 4AS8A 3TMTA 1Q73A 1YFPA 5EXCI 4N3DA 1EMFA 5FHVA 4OJ0A 4XL5A 2H5OA 3M22A 2V4EA 5LTRA 4BDUA 4RYSA 2OKYA 3U8CA 1MOVA 3ST3A 2IOVA 3CFAA 1RM9A 3EK8A 4HQCA 5DPHA 2A56B 4OHSA 4W7RA 1YHIA 2HCGA 4W73A 1QXTA 3KCSA 3SG2A 5KTGA 2ZMUA 3U0LA 4W6SA 3G9AA 4J88A 3ZUJA 1EMCA 3PIBA 5DU0A 4DXQA 3PJ7A 1MOUA 2ZMWA 3DQ4A 4JC2A 3DQCA 3O77A 4Z4MA 3P8UA 4Q9WA 2VVJA 3DQMA 3V3DA 2O24A 4P76A 4KW9A 4ZIOA 2DD7A 4JRBA 2A53B 2OKWA 3LVDA 4EN1A 3P28A 4KEXA 3NEDA 3DQDA 2O29A 3SVEA 3PJBA 4W7FA 2ARLA 4IK4A 2QLHA 5H89A 4W6HA 3BXBA 2QU1A 3TMRA 1QYQA 5LTPA 4NWSA 4W6OA 2Z1OA 2OJKA 3SVDA 2DUHA 4Z4KA 3LS3A 4J89A 5HBDA 4IK8A 4LQTA 3ST4A 4KF4A 4HQ9A 4W6TA 1W7SA 3IR8A 2AWMA 2FWQA 4DXPA 5EJUA 2VVIA 5H88A 5DTZA 1KYRA 4H48A 2H5RA 2P4MA 2DUIA 3IP2A 4W75A 2VZXA 5DY6A 1XMZA 5BTTA 2QLIA 2IE2A 3SG3A 3DQ8A 3DQ3A 4ZB1A 1YHHA 3SSPA 3BX9A 4DXMA 4Q7UA 2IB5A 2OGRA 1KYSA 3DPZA 3SRYA 5EB7A 1ZGOA 4OGSA 4DXNA 5H87A 4ANJA 3NF0A 5BT0A 2HRSA 4W69A 2B3PA 3SVOA 3ZTFA 4W7EA 4H3LA 4GF6B 3SV5A 1EMGA 3DQFA 5DPIA 4ZF4A 1QYFA 3EVPA 3UG0A 4W6CA 1Z1PA 3DQOA 5F9GA 1W7UA 1F09A 4GESB 3SSTA 1QYOA 3WCKA 2H8QA 3BXCA 1EMBA 2WHUA 4KF5C 2ZO6A 3W1CA 3AI4A 3SVBA 2DUFA 4W6KA 1XAEA 3PJ5A 3RWTA 3EK7A 4W6AA 1Q4CA 4H3NA 2Q6PA 2EMNA 4W6GA 2AWKA 2A50B 3ADFA 1B9CA 2AWJA 2A47A 1YZWA 3DQ1A 3DQ6A 5HZOA 2OTEA 3DQEA 1ZGQA 1YJ2A 5DTLA 2G3DB 4ZF3A 5DPJA 3SSVA 2DUEA 4KPIA 1RMMA 3ST2A 4JEOA 1MYWA 5LK4A 4KW8A 1YHGA 4EMQA 2AHAA 3BXAA 1Q4DA 4LJDC 2HQKA 2V4EC 4KA9A 1EMEA 4W6BA 2O2BA 4LJCA 3DQJA 3GEXA 4EDOA 1BFPA 3CBEA 4W7CA 5HZTA 1GGXA 3WLCA 5HZSA 2ZO7A 3OSRA 5AQBB 2V4EB 2G6EA 3LVAA 3NT3A 1RMOA 3SSYA 3LA1A 4P1QA 4TZGA 2DUGA 5T3IA 3EK4A 5DQMA 3SG7A 1EMLA 2JADA 3I19A 3VICA 5DRGA 1OXFA 4L12A 1QY3A 4LW5A 2Y0GA 5EHUA 3DQUA 4XOWA 1Q4BA 4DXIA 4W7DA 4L1IA 1XA9A 4B30B 3SVRA 4ZBLA 3DQAA 2G16B 1ZUXA 3VK1A 4J8AA 5DPGA 4GOBA 1Z1QA 2G6XA 2HQZA 4PPKA 3DQKA 2WURA 1S6ZA 3SSHA
chains in the Genus database with same CATH topology
2GW4B 1H6RA 3U8AA 5EXBA 2Z6XA 4W6IA 4IZNA 2HGDA 3WLDA 1GL4A 2FZUA 4HQ8A 3VHTB 4OQWA 1Q4EA 3EKJA 3S05A 5HW9A 3AI5A 2G6YA 2YDZA 3ED8A 3SSKA 4JFGA 4W6MA 2AH8A 4XGYA 2VAEA 2QLGB 1EMAA 3E5TA 2AWLA 2Z6YA 4IK9A 2A46A 2A54B 3DPXA 1F0BA 4H3MA 5FVGA 2QT2A 3DQNA 3DQ5A 4KF5A 4KGEA 4W6PA 2BTJA 5DQBA 4U2VA 2RH7A 3SG4A 3DQHA 3OSQA 4B5YA 1HCJA 3EVRA 2DDDA 4HE4A 5EBJA 1CV7A 1OXDA 2FL1A 1EMMA 4KAGA 2DDCA 4OY4A 4W76A 1EMKA 3LF3A 3CB9A 4RTCA 2PXWA 4DKMA 3NEZA 1UISA 2EMDA 3ZULA 3RWAA 4XVPA 1HUYA 2GX2A 2POXA 2Q57A 3U0NA 3SG6A 4LQUA 5EB6A 4LJDA 3A8SA 2C9IA 5DRFA 3DQLA 4IK5A 4W6DA 2WISA 2YE1A 3E5WA 4W6NA 3H1OA 2QLEA 1GFLA 2A52B 4JF9A 1JC1A 4UTSA 1KYPA 3LVCA 2GW3A 3W1DA 4JGEA 2PXSA 2WHTA 3DQ2A 4HVFA 2C9JA 3UFZA 3OGOA 4W77A 1RRXA 2Z6ZA 3EKHA 3CD9A 5LTQA 4B30A 4LJBA 2G3OA 4IK1A 3DPWA 4I2YA 1OXEA 2ICRA 4ZFSA 4DKNA 5EXUA 3SVCA 4AR7A 3DQIA 2GX0A 3SSLA 1W7TA 4TZAA 4RYWA 2YFPA 3GL4A 3NT9A 1G7KA 4W6JA 4W6UA 3LSAA 4EDSA 2B3QA 5J2OA 2H5QA 3SVSA 3EVVA 3CD1A 3SVUA 1RMPA 2HPWA 3CFFA 3LF4B 4W6LA 5BQLA 3CFHA 4ZF5A 2H6VA 2WSNA 3VHTA 3ZUFA 4KGFA 5HGEA 2HGYA 1ZGPA 2YE0A 3ST0A 4R6DA 3U0MA 4W6RA 1XSSA 3CGLA 3AKOA 2EMOA 4W72A 2OTBA 3E5VA 2HJOA 4DXOA 3MGFA 4Q7TA 2QLGA 5DTXA 4W6FA 2IB6A 2VVHA 3GB3A 1JBZA 1H4UA 4IK3A 4Q7RA 1KP5A 3U8PA 4XOVA 3SS0A 5HZUA 1YJFA 2WIQA 3DQ7A 4R6BA 4ZINA 3DQ9A 3GJ1A 4Q9XA 1C4FA 2WHSA 4PFEA 3EVUA 2H5PA 2QZ0A 3K1KA 1Q4AA 3O78A 4L13A 3KCTA 4W7XA 5BTTB 2WSOA 1XQMA 4W74A 2A48A 4KW4A 4H47A 2VADA 4PPJA 3U0KA 1JBYA 2QRFA 2DD9A 3GJ2A 4PPLA 3SG5A 5FVFA 3SVNA 3H1RA 4EULA 2HFCA 5DTYA 3M24A 2G2SB 4ORNA 5FVIA 4W7AA 2G5ZB 1JC0A 2H9WA 4AS8A 3TMTA 1Q73A 1YFPA 5EXCI 4N3DA 1EMFA 5FHVA 4OJ0A 4XL5A 2H5OA 3M22A 2V4EA 5LTRA 4BDUA 4RYSA 2OKYA 3U8CA 1MOVA 3ST3A 2IOVA 3CFAA 1RM9A 3EK8A 4HQCA 5DPHA 2A56B 4OHSA 4W7RA 1YHIA 2HCGA 4W73A 1QXTA 3KCSA 3SG2A 5KTGA 2ZMUA 3U0LA 4W6SA 3G9AA 4J88A 3ZUJA 1EMCA 3PIBA 5DU0A 4DXQA 3PJ7A 1MOUA 2ZMWA 3DQ4A 4JC2A 3DQCA 3O77A 4Z4MA 3P8UA 4Q9WA 2VVJA 3DQMA 3V3DA 2O24A 4P76A 4KW9A 4ZIOA 2DD7A 4JRBA 2A53B 2OKWA 3LVDA 4EN1A 3P28A 4KEXA 3NEDA 3DQDA 2O29A 3SVEA 3PJBA 4W7FA 2ARLA 4IK4A 2QLHA 5H89A 4W6HA 3BXBA 2QU1A 3TMRA 1QYQA 5LTPA 4NWSA 4W6OA 2Z1OA 2OJKA 3SVDA 2DUHA 4Z4KA 3LS3A 4J89A 5HBDA 4IK8A 4LQTA 3ST4A 4KF4A 4HQ9A 4W6TA 1W7SA 3IR8A 2AWMA 2FWQA 4DXPA 5EJUA 2VVIA 5H88A 5DTZA 1KYRA 4H48A 2H5RA 2P4MA 2DUIA 3IP2A 4W75A 2VZXA 5DY6A 1XMZA 5BTTA 2QLIA 2IE2A 3SG3A 3DQ8A 3DQ3A 4ZB1A 1YHHA 3SSPA 3BX9A 4DXMA 4Q7UA 2IB5A 2OGRA 1KYSA 3DPZA 3SRYA 5EB7A 1ZGOA 4OGSA 4DXNA 5H87A 4ANJA 3NF0A 5BT0A 2HRSA 4W69A 2B3PA 3SVOA 3ZTFA 4W7EA 4H3LA 4GF6B 3SV5A 1EMGA 3DQFA 5DPIA 4ZF4A 1QYFA 3EVPA 3UG0A 4W6CA 1Z1PA 3DQOA 5F9GA 1W7UA 1F09A 4GESB 3SSTA 1QYOA 3WCKA 2H8QA 3BXCA 1EMBA 2WHUA 4KF5C 2ZO6A 3W1CA 3AI4A 3SVBA 2DUFA 4W6KA 1XAEA 3PJ5A 3RWTA 3EK7A 4W6AA 1Q4CA 4H3NA 2Q6PA 2EMNA 4W6GA 2AWKA 2A50B 3ADFA 1B9CA 2AWJA 2A47A 1YZWA 3DQ1A 3DQ6A 5HZOA 2OTEA 3DQEA 1ZGQA 1YJ2A 5DTLA 2G3DB 4ZF3A 5DPJA 3SSVA 2DUEA 4KPIA 1RMMA 3ST2A 4JEOA 1MYWA 5LK4A 4KW8A 1YHGA 4EMQA 2AHAA 3BXAA 1Q4DA 4LJDC 2HQKA 2V4EC 4KA9A 1EMEA 4W6BA 2O2BA 4LJCA 3DQJA 3GEXA 4EDOA 1BFPA 3CBEA 4W7CA 5HZTA 1GGXA 3WLCA 5HZSA 2ZO7A 3OSRA 5AQBB 2V4EB 2G6EA 3LVAA 3NT3A 1RMOA 3SSYA 3LA1A 4P1QA 4TZGA 2DUGA 5T3IA 3EK4A 5DQMA 3SG7A 1EMLA 2JADA 3I19A 3VICA 5DRGA 1OXFA 4L12A 1QY3A 4LW5A 2Y0GA 5EHUA 3DQUA 4XOWA 1Q4BA 4DXIA 4W7DA 4L1IA 1XA9A 4B30B 3SVRA 4ZBLA 3DQAA 2G16B 1ZUXA 3VK1A 4J8AA 5DPGA 4GOBA 1Z1QA 2G6XA 2HQZA 4PPKA 3DQKA 2WURA 1S6ZA 3SSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GW4 B;  1H6R A;  3U8A A;  5EXB A;  2Z6X A;  4W6I A;  4IZN A;  2HGD A;  3WLD A;  1GL4 A;  2FZU A;  4HQ8 A;  3VHT B;  4OQW A;  1Q4E A;  3EKJ A;  3S05 A;  5HW9 A;  3AI5 A;  2G6Y A;  2YDZ A;  3ED8 A;  3SSK A;  4JFG A;  4W6M A;  2AH8 A;  4XGY A;  2VAE A;  2QLG B;  1EMA A;  3E5T A;  2AWL A;  2Z6Y A;  4IK9 A;  2A46 A;  2A54 B;  3DPX A;  1F0B A;  4H3M A;  5FVG A;  2QT2 A;  3DQN A;  3DQ5 A;  4KF5 A;  4KGE A;  4W6P A;  2BTJ A;  5DQB A;  4U2V A;  2RH7 A;  3SG4 A;  3DQH A;  3OSQ A;  4B5Y A;  1HCJ A;  3EVR A;  2DDD A;  4HE4 A;  5EBJ A;  1CV7 A;  1OXD A;  2FL1 A;  1EMM A;  4KAG A;  2DDC A;  4OY4 A;  4W76 A;  1EMK A;  3LF3 A;  3CB9 A;  4RTC A;  2PXW A;  4DKM A;  3NEZ A;  1UIS A;  2EMD A;  3ZUL A;  3RWA A;  4XVP A;  1HUY A;  2GX2 A;  2POX A;  2Q57 A;  3U0N A;  3SG6 A;  4LQU A;  5EB6 A;  4LJD A;  3A8S A;  2C9I A;  5DRF A;  3DQL A;  4IK5 A;  4W6D A;  2WIS A;  2YE1 A;  3E5W A;  4W6N A;  3H1O A;  2QLE A;  1GFL A;  2A52 B;  4JF9 A;  1JC1 A;  4UTS A;  1KYP A;  3LVC A;  2GW3 A;  3W1D A;  4JGE A;  2PXS A;  2WHT A;  3DQ2 A;  4HVF A;  2C9J A;  3UFZ A;  3OGO A;  4W77 A;  1RRX A;  2Z6Z A;  3EKH A;  3CD9 A;  5LTQ A;  4B30 A;  4LJB A;  2G3O A;  4IK1 A;  3DPW A;  4I2Y A;  1OXE A;  2ICR A;  4ZFS A;  4DKN A;  5EXU A;  3SVC A;  4AR7 A;  3DQI A;  2GX0 A;  3SSL A;  1W7T A;  4TZA A;  4RYW A;  2YFP A;  3GL4 A;  3NT9 A;  1G7K A;  4W6J A;  4W6U A;  3LSA A;  4EDS A;  2B3Q A;  5J2O A;  2H5Q A;  3SVS A;  3EVV A;  3CD1 A;  3SVU A;  1RMP A;  2HPW A;  3CFF A;  3LF4 B;  4W6L A;  5BQL A;  3CFH A;  4ZF5 A;  2H6V A;  2WSN A;  3VHT A;  3ZUF A;  4KGF A;  5HGE A;  2HGY A;  1ZGP A;  2YE0 A;  3ST0 A;  4R6D A;  3U0M A;  4W6R A;  1XSS A;  3CGL A;  3AKO A;  2EMO A;  4W72 A;  2OTB A;  3E5V A;  2HJO A;  4DXO A;  3MGF A;  4Q7T A;  2QLG A;  5DTX A;  4W6F A;  2IB6 A;  2VVH A;  3GB3 A;  1JBZ A;  1H4U A;  4IK3 A;  4Q7R A;  1KP5 A;  3U8P A;  4XOV A;  3SS0 A;  5HZU A;  1YJF A;  2WIQ A;  3DQ7 A;  4R6B A;  4ZIN A;  3DQ9 A;  3GJ1 A;  4Q9X A;  1C4F A;  2WHS A;  4PFE A;  3EVU A;  2H5P A;  2QZ0 A;  3K1K A;  1Q4A A;  3O78 A;  4L13 A;  3KCT A;  4W7X A;  5BTT B;  2WSO A;  1XQM A;  4W74 A;  2A48 A;  4KW4 A;  4H47 A;  2VAD A;  4PPJ A;  3U0K A;  1JBY A;  2QRF A;  2DD9 A;  3GJ2 A;  4PPL A;  3SG5 A;  5FVF A;  3SVN A;  3H1R A;  4EUL A;  2HFC A;  5DTY A;  3M24 A;  2G2S B;  4ORN A;  5FVI A;  4W7A A;  2G5Z B;  1JC0 A;  2H9W A;  4AS8 A;  3TMT A;  1Q73 A;  1YFP A;  5EXC I;  4N3D A;  1EMF A;  5FHV A;  4OJ0 A;  4XL5 A;  2H5O A;  3M22 A;  2V4E A;  5LTR A;  4BDU A;  4RYS A;  2OKY A;  3U8C A;  1MOV A;  3ST3 A;  2IOV A;  3CFA A;  1RM9 A;  3EK8 A;  4HQC A;  5DPH A;  2A56 B;  4OHS A;  4W7R A;  1YHI A;  2HCG A;  4W73 A;  1QXT A;  3KCS A;  3SG2 A;  5KTG A;  2ZMU A;  3U0L A;  4W6S A;  3G9A A;  4J88 A;  3ZUJ A;  1EMC A;  3PIB A;  5DU0 A;  4DXQ A;  3PJ7 A;  1MOU A;  2ZMW A;  3DQ4 A;  4JC2 A;  3DQC A;  3O77 A;  4Z4M A;  3P8U A;  4Q9W A;  2VVJ A;  3DQM A;  3V3D A;  2O24 A;  4P76 A;  4KW9 A;  4ZIO A;  2DD7 A;  4JRB A;  2A53 B;  2OKW A;  3LVD A;  4EN1 A;  3P28 A;  4KEX A;  3NED A;  3DQD A;  2O29 A;  3SVE A;  3PJB A;  4W7F A;  2ARL A;  4IK4 A;  2QLH A;  5H89 A;  4W6H A;  3BXB A;  2QU1 A;  3TMR A;  1QYQ A;  5LTP A;  4NWS A;  4W6O A;  2Z1O A;  2OJK A;  3SVD A;  2DUH A;  4Z4K A;  3LS3 A;  4J89 A;  5HBD A;  4IK8 A;  4LQT A;  3ST4 A;  4KF4 A;  4HQ9 A;  4W6T A;  1W7S A;  3IR8 A;  2AWM A;  2FWQ A;  4DXP A;  5EJU A;  2VVI A;  5H88 A;  5DTZ A;  1KYR A;  4H48 A;  2H5R A;  2P4M A;  2DUI A;  3IP2 A;  4W75 A;  2VZX A;  5DY6 A;  1XMZ A;  5BTT A;  2QLI A;  2IE2 A;  3SG3 A;  3DQ8 A;  3DQ3 A;  4ZB1 A;  1YHH A;  3SSP A;  3BX9 A;  4DXM A;  4Q7U A;  2IB5 A;  2OGR A;  1KYS A;  3DPZ A;  3SRY A;  5EB7 A;  1ZGO A;  4OGS A;  4DXN A;  5H87 A;  4ANJ A;  3NF0 A;  5BT0 A;  2HRS A;  4W69 A;  2B3P A;  3SVO A;  3ZTF A;  4W7E A;  4H3L A;  4GF6 B;  3SV5 A;  1EMG A;  3DQF A;  5DPI A;  4ZF4 A;  1QYF A;  3EVP A;  3UG0 A;  4W6C A;  1Z1P A;  3DQO A;  5F9G A;  1W7U A;  1F09 A;  4GES B;  3SST A;  1QYO A;  3WCK A;  2H8Q A;  3BXC A;  1EMB A;  2WHU A;  4KF5 C;  2ZO6 A;  3W1C A;  3AI4 A;  3SVB A;  2DUF A;  4W6K A;  1XAE A;  3PJ5 A;  3RWT A;  3EK7 A;  4W6A A;  1Q4C A;  4H3N A;  2Q6P A;  2EMN A;  4W6G A;  2AWK A;  2A50 B;  3ADF A;  1B9C A;  2AWJ A;  2A47 A;  1YZW A;  3DQ1 A;  3DQ6 A;  5HZO A;  2OTE A;  3DQE A;  1ZGQ A;  1YJ2 A;  5DTL A;  2G3D B;  4ZF3 A;  5DPJ A;  3SSV A;  2DUE A;  4KPI A;  1RMM A;  3ST2 A;  4JEO A;  1MYW A;  5LK4 A;  4KW8 A;  1YHG A;  4EMQ A;  2AHA A;  3BXA A;  1Q4D A;  4LJD C;  2HQK A;  2V4E C;  4KA9 A;  1EME A;  4W6B A;  2O2B A;  4LJC A;  3DQJ A;  3GEX A;  4EDO A;  1BFP A;  3CBE A;  4W7C A;  5HZT A;  1GGX A;  3WLC A;  5HZS A;  2ZO7 A;  3OSR A;  5AQB B;  2V4E B;  2G6E A;  3LVA A;  3NT3 A;  1RMO A;  3SSY A;  3LA1 A;  4P1Q A;  4TZG A;  2DUG A;  5T3I A;  3EK4 A;  5DQM A;  3SG7 A;  1EML A;  2JAD A;  3I19 A;  3VIC A;  5DRG A;  1OXF A;  4L12 A;  1QY3 A;  4LW5 A;  2Y0G A;  5EHU A;  3DQU A;  4XOW A;  1Q4B A;  4DXI A;  4W7D A;  4L1I A;  1XA9 A;  4B30 B;  3SVR A;  4ZBL A;  3DQA A;  2G16 B;  1ZUX A;  3VK1 A;  4J8A A;  5DPG A;  4GOB A;  1Z1Q A;  2G6X A;  2HQZ A;  4PPK A;  3DQK A;  2WUR A;  1S6Z A;  3SSH A; 
#chains in the Genus database with same CATH topology
 2GW4 B;  1H6R A;  3U8A A;  5EXB A;  2Z6X A;  4W6I A;  4IZN A;  2HGD A;  3WLD A;  1GL4 A;  2FZU A;  4HQ8 A;  3VHT B;  4OQW A;  1Q4E A;  3EKJ A;  3S05 A;  5HW9 A;  3AI5 A;  2G6Y A;  2YDZ A;  3ED8 A;  3SSK A;  4JFG A;  4W6M A;  2AH8 A;  4XGY A;  2VAE A;  2QLG B;  1EMA A;  3E5T A;  2AWL A;  2Z6Y A;  4IK9 A;  2A46 A;  2A54 B;  3DPX A;  1F0B A;  4H3M A;  5FVG A;  2QT2 A;  3DQN A;  3DQ5 A;  4KF5 A;  4KGE A;  4W6P A;  2BTJ A;  5DQB A;  4U2V A;  2RH7 A;  3SG4 A;  3DQH A;  3OSQ A;  4B5Y A;  1HCJ A;  3EVR A;  2DDD A;  4HE4 A;  5EBJ A;  1CV7 A;  1OXD A;  2FL1 A;  1EMM A;  4KAG A;  2DDC A;  4OY4 A;  4W76 A;  1EMK A;  3LF3 A;  3CB9 A;  4RTC A;  2PXW A;  4DKM A;  3NEZ A;  1UIS A;  2EMD A;  3ZUL A;  3RWA A;  4XVP A;  1HUY A;  2GX2 A;  2POX A;  2Q57 A;  3U0N A;  3SG6 A;  4LQU A;  5EB6 A;  4LJD A;  3A8S A;  2C9I A;  5DRF A;  3DQL A;  4IK5 A;  4W6D A;  2WIS A;  2YE1 A;  3E5W A;  4W6N A;  3H1O A;  2QLE A;  1GFL A;  2A52 B;  4JF9 A;  1JC1 A;  4UTS A;  1KYP A;  3LVC A;  2GW3 A;  3W1D A;  4JGE A;  2PXS A;  2WHT A;  3DQ2 A;  4HVF A;  2C9J A;  3UFZ A;  3OGO A;  4W77 A;  1RRX A;  2Z6Z A;  3EKH A;  3CD9 A;  5LTQ A;  4B30 A;  4LJB A;  2G3O A;  4IK1 A;  3DPW A;  4I2Y A;  1OXE A;  2ICR A;  4ZFS A;  4DKN A;  5EXU A;  3SVC A;  4AR7 A;  3DQI A;  2GX0 A;  3SSL A;  1W7T A;  4TZA A;  4RYW A;  2YFP A;  3GL4 A;  3NT9 A;  1G7K A;  4W6J A;  4W6U A;  3LSA A;  4EDS A;  2B3Q A;  5J2O A;  2H5Q A;  3SVS A;  3EVV A;  3CD1 A;  3SVU A;  1RMP A;  2HPW A;  3CFF A;  3LF4 B;  4W6L A;  5BQL A;  3CFH A;  4ZF5 A;  2H6V A;  2WSN A;  3VHT A;  3ZUF A;  4KGF A;  5HGE A;  2HGY A;  1ZGP A;  2YE0 A;  3ST0 A;  4R6D A;  3U0M A;  4W6R A;  1XSS A;  3CGL A;  3AKO A;  2EMO A;  4W72 A;  2OTB A;  3E5V A;  2HJO A;  4DXO A;  3MGF A;  4Q7T A;  2QLG A;  5DTX A;  4W6F A;  2IB6 A;  2VVH A;  3GB3 A;  1JBZ A;  1H4U A;  4IK3 A;  4Q7R A;  1KP5 A;  3U8P A;  4XOV A;  3SS0 A;  5HZU A;  1YJF A;  2WIQ A;  3DQ7 A;  4R6B A;  4ZIN A;  3DQ9 A;  3GJ1 A;  4Q9X A;  1C4F A;  2WHS A;  4PFE A;  3EVU A;  2H5P A;  2QZ0 A;  3K1K A;  1Q4A A;  3O78 A;  4L13 A;  3KCT A;  4W7X A;  5BTT B;  2WSO A;  1XQM A;  4W74 A;  2A48 A;  4KW4 A;  4H47 A;  2VAD A;  4PPJ A;  3U0K A;  1JBY A;  2QRF A;  2DD9 A;  3GJ2 A;  4PPL A;  3SG5 A;  5FVF A;  3SVN A;  3H1R A;  4EUL A;  2HFC A;  5DTY A;  3M24 A;  2G2S B;  4ORN A;  5FVI A;  4W7A A;  2G5Z B;  1JC0 A;  2H9W A;  4AS8 A;  3TMT A;  1Q73 A;  1YFP A;  5EXC I;  4N3D A;  1EMF A;  5FHV A;  4OJ0 A;  4XL5 A;  2H5O A;  3M22 A;  2V4E A;  5LTR A;  4BDU A;  4RYS A;  2OKY A;  3U8C A;  1MOV A;  3ST3 A;  2IOV A;  3CFA A;  1RM9 A;  3EK8 A;  4HQC A;  5DPH A;  2A56 B;  4OHS A;  4W7R A;  1YHI A;  2HCG A;  4W73 A;  1QXT A;  3KCS A;  3SG2 A;  5KTG A;  2ZMU A;  3U0L A;  4W6S A;  3G9A A;  4J88 A;  3ZUJ A;  1EMC A;  3PIB A;  5DU0 A;  4DXQ A;  3PJ7 A;  1MOU A;  2ZMW A;  3DQ4 A;  4JC2 A;  3DQC A;  3O77 A;  4Z4M A;  3P8U A;  4Q9W A;  2VVJ A;  3DQM A;  3V3D A;  2O24 A;  4P76 A;  4KW9 A;  4ZIO A;  2DD7 A;  4JRB A;  2A53 B;  2OKW A;  3LVD A;  4EN1 A;  3P28 A;  4KEX A;  3NED A;  3DQD A;  2O29 A;  3SVE A;  3PJB A;  4W7F A;  2ARL A;  4IK4 A;  2QLH A;  5H89 A;  4W6H A;  3BXB A;  2QU1 A;  3TMR A;  1QYQ A;  5LTP A;  4NWS A;  4W6O A;  2Z1O A;  2OJK A;  3SVD A;  2DUH A;  4Z4K A;  3LS3 A;  4J89 A;  5HBD A;  4IK8 A;  4LQT A;  3ST4 A;  4KF4 A;  4HQ9 A;  4W6T A;  1W7S A;  3IR8 A;  2AWM A;  2FWQ A;  4DXP A;  5EJU A;  2VVI A;  5H88 A;  5DTZ A;  1KYR A;  4H48 A;  2H5R A;  2P4M A;  2DUI A;  3IP2 A;  4W75 A;  2VZX A;  5DY6 A;  1XMZ A;  5BTT A;  2QLI A;  2IE2 A;  3SG3 A;  3DQ8 A;  3DQ3 A;  4ZB1 A;  1YHH A;  3SSP A;  3BX9 A;  4DXM A;  4Q7U A;  2IB5 A;  2OGR A;  1KYS A;  3DPZ A;  3SRY A;  5EB7 A;  1ZGO A;  4OGS A;  4DXN A;  5H87 A;  4ANJ A;  3NF0 A;  5BT0 A;  2HRS A;  4W69 A;  2B3P A;  3SVO A;  3ZTF A;  4W7E A;  4H3L A;  4GF6 B;  3SV5 A;  1EMG A;  3DQF A;  5DPI A;  4ZF4 A;  1QYF A;  3EVP A;  3UG0 A;  4W6C A;  1Z1P A;  3DQO A;  5F9G A;  1W7U A;  1F09 A;  4GES B;  3SST A;  1QYO A;  3WCK A;  2H8Q A;  3BXC A;  1EMB A;  2WHU A;  4KF5 C;  2ZO6 A;  3W1C A;  3AI4 A;  3SVB A;  2DUF A;  4W6K A;  1XAE A;  3PJ5 A;  3RWT A;  3EK7 A;  4W6A A;  1Q4C A;  4H3N A;  2Q6P A;  2EMN A;  4W6G A;  2AWK A;  2A50 B;  3ADF A;  1B9C A;  2AWJ A;  2A47 A;  1YZW A;  3DQ1 A;  3DQ6 A;  5HZO A;  2OTE A;  3DQE A;  1ZGQ A;  1YJ2 A;  5DTL A;  2G3D B;  4ZF3 A;  5DPJ A;  3SSV A;  2DUE A;  4KPI A;  1RMM A;  3ST2 A;  4JEO A;  1MYW A;  5LK4 A;  4KW8 A;  1YHG A;  4EMQ A;  2AHA A;  3BXA A;  1Q4D A;  4LJD C;  2HQK A;  2V4E C;  4KA9 A;  1EME A;  4W6B A;  2O2B A;  4LJC A;  3DQJ A;  3GEX A;  4EDO A;  1BFP A;  3CBE A;  4W7C A;  5HZT A;  1GGX A;  3WLC A;  5HZS A;  2ZO7 A;  3OSR A;  5AQB B;  2V4E B;  2G6E A;  3LVA A;  3NT3 A;  1RMO A;  3SSY A;  3LA1 A;  4P1Q A;  4TZG A;  2DUG A;  5T3I A;  3EK4 A;  5DQM A;  3SG7 A;  1EML A;  2JAD A;  3I19 A;  3VIC A;  5DRG A;  1OXF A;  4L12 A;  1QY3 A;  4LW5 A;  2Y0G A;  5EHU A;  3DQU A;  4XOW A;  1Q4B A;  4DXI A;  4W7D A;  4L1I A;  1XA9 A;  4B30 B;  3SVR A;  4ZBL A;  3DQA A;  2G16 B;  1ZUX A;  3VK1 A;  4J8A A;  5DPG A;  4GOB A;  1Z1Q A;  2G6X A;  2HQZ A;  4PPK A;  3DQK A;  2WUR A;  1S6Z A;  3SSH A; 
#chains in the Genus database with same CATH homology
 2GW4 B;  1H6R A;  3U8A A;  5EXB A;  2Z6X A;  4W6I A;  4IZN A;  2HGD A;  3WLD A;  1GL4 A;  2FZU A;  4HQ8 A;  3VHT B;  4OQW A;  1Q4E A;  3EKJ A;  3S05 A;  5HW9 A;  3AI5 A;  2G6Y A;  2YDZ A;  3ED8 A;  3SSK A;  4JFG A;  4W6M A;  2AH8 A;  4XGY A;  2VAE A;  2QLG B;  1EMA A;  3E5T A;  2AWL A;  2Z6Y A;  4IK9 A;  2A46 A;  2A54 B;  3DPX A;  1F0B A;  4H3M A;  5FVG A;  2QT2 A;  3DQN A;  3DQ5 A;  4KF5 A;  4KGE A;  4W6P A;  2BTJ A;  5DQB A;  4U2V A;  2RH7 A;  3SG4 A;  3DQH A;  3OSQ A;  4B5Y A;  1HCJ A;  3EVR A;  2DDD A;  4HE4 A;  5EBJ A;  1CV7 A;  1OXD A;  2FL1 A;  1EMM A;  4KAG A;  2DDC A;  4OY4 A;  4W76 A;  1EMK A;  3LF3 A;  3CB9 A;  4RTC A;  2PXW A;  4DKM A;  3NEZ A;  1UIS A;  2EMD A;  3ZUL A;  3RWA A;  4XVP A;  1HUY A;  2GX2 A;  2POX A;  2Q57 A;  3U0N A;  3SG6 A;  4LQU A;  5EB6 A;  4LJD A;  3A8S A;  2C9I A;  5DRF A;  3DQL A;  4IK5 A;  4W6D A;  2WIS A;  2YE1 A;  3E5W A;  4W6N A;  3H1O A;  2QLE A;  1GFL A;  2A52 B;  4JF9 A;  1JC1 A;  4UTS A;  1KYP A;  3LVC A;  2GW3 A;  3W1D A;  4JGE A;  2PXS A;  2WHT A;  3DQ2 A;  4HVF A;  2C9J A;  3UFZ A;  3OGO A;  4W77 A;  1RRX A;  2Z6Z A;  3EKH A;  3CD9 A;  5LTQ A;  4B30 A;  4LJB A;  2G3O A;  4IK1 A;  3DPW A;  4I2Y A;  1OXE A;  2ICR A;  4ZFS A;  4DKN A;  5EXU A;  3SVC A;  4AR7 A;  3DQI A;  2GX0 A;  3SSL A;  1W7T A;  4TZA A;  4RYW A;  2YFP A;  3GL4 A;  3NT9 A;  1G7K A;  4W6J A;  4W6U A;  3LSA A;  4EDS A;  2B3Q A;  5J2O A;  2H5Q A;  3SVS A;  3EVV A;  3CD1 A;  3SVU A;  1RMP A;  2HPW A;  3CFF A;  3LF4 B;  4W6L A;  5BQL A;  3CFH A;  4ZF5 A;  2H6V A;  2WSN A;  3VHT A;  3ZUF A;  4KGF A;  5HGE A;  2HGY A;  1ZGP A;  2YE0 A;  3ST0 A;  4R6D A;  3U0M A;  4W6R A;  1XSS A;  3CGL A;  3AKO A;  2EMO A;  4W72 A;  2OTB A;  3E5V A;  2HJO A;  4DXO A;  3MGF A;  4Q7T A;  2QLG A;  5DTX A;  4W6F A;  2IB6 A;  2VVH A;  3GB3 A;  1JBZ A;  1H4U A;  4IK3 A;  4Q7R A;  1KP5 A;  3U8P A;  4XOV A;  3SS0 A;  5HZU A;  1YJF A;  2WIQ A;  3DQ7 A;  4R6B A;  4ZIN A;  3DQ9 A;  3GJ1 A;  4Q9X A;  1C4F A;  2WHS A;  4PFE A;  3EVU A;  2H5P A;  2QZ0 A;  3K1K A;  1Q4A A;  3O78 A;  4L13 A;  3KCT A;  4W7X A;  5BTT B;  2WSO A;  1XQM A;  4W74 A;  2A48 A;  4KW4 A;  4H47 A;  2VAD A;  4PPJ A;  3U0K A;  1JBY A;  2QRF A;  2DD9 A;  3GJ2 A;  4PPL A;  3SG5 A;  5FVF A;  3SVN A;  3H1R A;  4EUL A;  2HFC A;  5DTY A;  3M24 A;  2G2S B;  4ORN A;  5FVI A;  4W7A A;  2G5Z B;  1JC0 A;  2H9W A;  4AS8 A;  3TMT A;  1Q73 A;  1YFP A;  5EXC I;  4N3D A;  1EMF A;  5FHV A;  4OJ0 A;  4XL5 A;  2H5O A;  3M22 A;  2V4E A;  5LTR A;  4BDU A;  4RYS A;  2OKY A;  3U8C A;  1MOV A;  3ST3 A;  2IOV A;  3CFA A;  1RM9 A;  3EK8 A;  4HQC A;  5DPH A;  2A56 B;  4OHS A;  4W7R A;  1YHI A;  2HCG A;  4W73 A;  1QXT A;  3KCS A;  3SG2 A;  5KTG A;  2ZMU A;  3U0L A;  4W6S A;  3G9A A;  4J88 A;  3ZUJ A;  1EMC A;  3PIB A;  5DU0 A;  4DXQ A;  3PJ7 A;  1MOU A;  2ZMW A;  3DQ4 A;  4JC2 A;  3DQC A;  3O77 A;  4Z4M A;  3P8U A;  4Q9W A;  2VVJ A;  3DQM A;  3V3D A;  2O24 A;  4P76 A;  4KW9 A;  4ZIO A;  2DD7 A;  4JRB A;  2A53 B;  2OKW A;  3LVD A;  4EN1 A;  3P28 A;  4KEX A;  3NED A;  3DQD A;  2O29 A;  3SVE A;  3PJB A;  4W7F A;  2ARL A;  4IK4 A;  2QLH A;  5H89 A;  4W6H A;  3BXB A;  2QU1 A;  3TMR A;  1QYQ A;  5LTP A;  4NWS A;  4W6O A;  2Z1O A;  2OJK A;  3SVD A;  2DUH A;  4Z4K A;  3LS3 A;  4J89 A;  5HBD A;  4IK8 A;  4LQT A;  3ST4 A;  4KF4 A;  4HQ9 A;  4W6T A;  1W7S A;  3IR8 A;  2AWM A;  2FWQ A;  4DXP A;  5EJU A;  2VVI A;  5H88 A;  5DTZ A;  1KYR A;  4H48 A;  2H5R A;  2P4M A;  2DUI A;  3IP2 A;  4W75 A;  2VZX A;  5DY6 A;  1XMZ A;  5BTT A;  2QLI A;  2IE2 A;  3SG3 A;  3DQ8 A;  3DQ3 A;  4ZB1 A;  1YHH A;  3SSP A;  3BX9 A;  4DXM A;  4Q7U A;  2IB5 A;  2OGR A;  1KYS A;  3DPZ A;  3SRY A;  5EB7 A;  1ZGO A;  4OGS A;  4DXN A;  5H87 A;  4ANJ A;  3NF0 A;  5BT0 A;  2HRS A;  4W69 A;  2B3P A;  3SVO A;  3ZTF A;  4W7E A;  4H3L A;  4GF6 B;  3SV5 A;  1EMG A;  3DQF A;  5DPI A;  4ZF4 A;  1QYF A;  3EVP A;  3UG0 A;  4W6C A;  1Z1P A;  3DQO A;  5F9G A;  1W7U A;  1F09 A;  4GES B;  3SST A;  1QYO A;  3WCK A;  2H8Q A;  3BXC A;  1EMB A;  2WHU A;  4KF5 C;  2ZO6 A;  3W1C A;  3AI4 A;  3SVB A;  2DUF A;  4W6K A;  1XAE A;  3PJ5 A;  3RWT A;  3EK7 A;  4W6A A;  1Q4C A;  4H3N A;  2Q6P A;  2EMN A;  4W6G A;  2AWK A;  2A50 B;  3ADF A;  1B9C A;  2AWJ A;  2A47 A;  1YZW A;  3DQ1 A;  3DQ6 A;  5HZO A;  2OTE A;  3DQE A;  1ZGQ A;  1YJ2 A;  5DTL A;  2G3D B;  4ZF3 A;  5DPJ A;  3SSV A;  2DUE A;  4KPI A;  1RMM A;  3ST2 A;  4JEO A;  1MYW A;  5LK4 A;  4KW8 A;  1YHG A;  4EMQ A;  2AHA A;  3BXA A;  1Q4D A;  4LJD C;  2HQK A;  2V4E C;  4KA9 A;  1EME A;  4W6B A;  2O2B A;  4LJC A;  3DQJ A;  3GEX A;  4EDO A;  1BFP A;  3CBE A;  4W7C A;  5HZT A;  1GGX A;  3WLC A;  5HZS A;  2ZO7 A;  3OSR A;  5AQB B;  2V4E B;  2G6E A;  3LVA A;  3NT3 A;  1RMO A;  3SSY A;  3LA1 A;  4P1Q A;  4TZG A;  2DUG A;  5T3I A;  3EK4 A;  5DQM A;  3SG7 A;  1EML A;  2JAD A;  3I19 A;  3VIC A;  5DRG A;  1OXF A;  4L12 A;  1QY3 A;  4LW5 A;  2Y0G A;  5EHU A;  3DQU A;  4XOW A;  1Q4B A;  4DXI A;  4W7D A;  4L1I A;  1XA9 A;  4B30 B;  3SVR A;  4ZBL A;  3DQA A;  2G16 B;  1ZUX A;  3VK1 A;  4J8A A;  5DPG A;  4GOB A;  1Z1Q A;  2G6X A;  2HQZ A;  4PPK A;  3DQK A;  2WUR A;  1S6Z A;  3SSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...