3SS7X

Crystal structure of holo d-serine dehydratase from escherichia coli at 1.55 a resolution
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
437
structure length
437
Chain Sequence
MNSLIAQYPLVKDLVALKETTWFNPGTTSLAEGLPYVGLTEQDVQDAHARLSRFAPYLAKAFPETAATGGIIESELVAIPAMQKRLEKEYQQPISGQLLLKKDSHLPISGSIKARGGIYEVLAHAEKLALEAGLLTLDDDYSKLLSPEFKQFFSQYSIAVGSTGNLGLSIGIMSARIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEQDYGVAVEEGRKAAQSDPNCFFIDDENSRTLFLGYSVAGQRLKAQFAQQGRIVDADNPLFVYLPCGVGGGPGGVAFGLKLAFGDHVHCFFAEPTHSPCMLLGVHTGLHDQISVQDIGIDNLTAADGLAVGRASGFVGRAMERLLDGFYTLSDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRVCASVSYQQMHGFSAEQLRNTTHLVWATGGGMVPEEEMNQYLAKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of D-serine dehydratase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords D-serine dehydratase
total genus 176
structure length 437
sequence length 437
ec nomenclature ec 4.3.1.18: D-serine ammonia-lyase.
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ss7X02
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ss7X01
1Y7LA 1F2DA 3IQIX 3AEYA 1V71A 4PCUA 1J0EA 2CLFB 1J0DA 2V03A 4KKXB 1A50B 1V8ZA 2C2GA 4JBLA 3X43A 1PWEA 3DWIA 1UINA 3SS9X 4COOA 4NU8X 1K3UB 5I7AA 1E5XA 1K7EB 1TZ2A 1Z7WA 2CLEB 5B53A 1K7XB 3R0XA 4XUGB 1K8XB 3CEPB 1K8ZB 1TTQB 5DVZA 4D9IA 5D87A 1UIMA 3DWGA 1KFKB 4D96A 4I1YA 4OFXA 4F4FA 2BHTA 4OREX 1TTPB 1Z7YA 5BW6B 5C3UA 3RR2A 2CLMB 4LI3X 2ZPUA 4D9NA 4JBNA 5HBGA 4D8TA 3SPXA 1OASA 5EY5B 2ZR8A 4D9CA 2GN0A 3PC2A 4HN4B 3PC3A 5CVCA 4D99A 1KFEB 2Q3BA 1CW2B 3TBHA 1TZJA 2TRSB 1J0BA 3L6RA 3VBEA 1KFBB 2CLKB 3VC3A 5T6MA 3X44A 2TSYB 5J43A 4L28A 1FUYB 2RHGB 1VE1A 3PC4A 3PR2B 5I7OA 2JC3A 4WX2B 2D1FA 1VE5A 2EGUA 1PWHA 1TYZA 3BM5A 3T4PA 1A5SB 1BEUB 1C29B 4D9KA 4LMAA 5DBEX 2GN2A 5I7HA 5I6DA 2Q3DA 2PQMA 1WKVA 4D97A 5I7RA 1WDWB 1KFCB 5B1HA 2J9ZB 2C2BA 3L6CA 5B36A 3AEXA 1X1QA 4L27A 1P5JA 1WTCA 2EFYA 5D84A 4HT3B 3VSDA 1JBQA 1KL7A 5J5VA 4D9GA 4H27A 1D6SA 2RKBA 1K7FB 1RQXA 2BHSA 2J9XB 5D86A 4D92A 4D9FA 2J9YB 3FGPA 1A5AB 5DBHX 5DW0A 2ZSJA 4ZU1X 3ZEIA 2DH5A 3DKIA 1FCJA 1QOPB 5IWCA 1O58A 2DH6A 5B1IA 2ISQA 2CLIB 1M54A 3L6BA 2RH9B 4Y6GB 1QOQB 3HMKA 1TDJA 5D85A 5JISA 1TZKA 3V7NA 2CLHB 2WSYB 4QYSA 1J0AA 5E0KB 5IXJA 2CLLB 2O2JA 1WBJB 2ECOA 3FCAA 5I7WA 4HPJB 4L3VA 4D9MA 4D9EA 1TJPB 1C8VB 4IL5A 2GN1A 2Q3CA 5IW8A 1K8YB 4D9BA 5B55A 1V7CA 1CX9B 4HO1X 4ZU6X 3R0ZA 1BKSB 1KFJB 4AECA 4D8WA 5KZMB 1A5BB 2TYSB 3SS7X 3VSCA 1J0CA 2CLOB 5KINB 3IAUA 3IQGX 5CGQB 2ECQA 1TZMA 4LMBA 3VSAA 4L0DA 5B3AA 3IQHX 1VB3A 4D8UA 4AIRA 5JJCA 4ZQCB 4NEGA 2O2EA 4HPXB 1UBSB 1C9DB 5DW3A
chains in the Genus database with same CATH superfamily
4EYKA 4Z0NA 4JITA 2LIVA 4B6SA 1TJ4A 3KJQA 3M5DA 5HS6A 3FUWA 1OTYA 1Z0AA 3PEYA 3PHHA 1E2HA 1CZHA 4YRZA 2BHRA 2FG5A 1YCDA 2Y77A 5DULA 2JFOA 3SYLA 1KI9A 3FB4A 1UQTA 4LJ5A 4RPCA 4C5CA 5K3SA 4EG8A 1RSZA 1VSQA 1TRHA 1K7EB 1E7YA 3STUA 3ICPA 4G4SO 3I1YA 4XUGB 3SXPA 1LCIA 3OJEA 4HS9A 1NUQA 1OFGA 4OFWA 1RVDA 3H1BA 4C2TA 4IDBA 2OKCA 4Y2XA 1BS9A 1IHOA 4KV9A 4I6GA 4M0PA 1SC6A 2RHRA 1YZTA 4QUEA 2X9NA 2HQBA 4L8LA 1KWKA 1NX9A 3D4IA 5K4AA 3HRHA 3CBGA 2QJFA 1OGJA 3ZXYA 4MUBA 3VZRA 4TWIA 1LDMA 1D1QA 4DCSA 2RARA 16PKA 1D4FA 1RNLA 2R47A 4DMRA 5J2UF 5ITWA 121PA 5ALJA 5BN5A 3RIGA 4OGWA 5EUQB 4BNKA 4UVDA 2WE7A 4DLSA 5DM70 3STTA 3FHCB 3H5OA 4MA0A 1Q3TA 2IEGA 4HJRA 4EP1A 3C8ZA 3DWFA 5CYOA 2JCVA 4DY4A 3ZX4A 5JNUA 3IR5A 4C7KA 3ACDA 2HJSA 3JZIA 1UEJA 4WN9A 1D4ZA 1MC4A 3OU7A 1UKBA 2PX8A 2QAGA 2MCFA 3ER9A 1YDEA 4K6CA 4M0CA 4CPDA 1KDTA 4CKWA 5ED4A 4F06A 3VX3A 5JO0A 3C4VA 3C98A 4MQ5A 2AFVA 2QTVB 1IEVA 3R3SA 3DBLA 3ORRA 2FJ0A 3EEBA 3G0GA 2WDPA 2JHCA 2WJYA 5KNCA 5LMCA 3SZOA 1ZI8A 3E18A 3ASUA 2X6TA 2BE9A 3PXBA 3WIBA 2XCLA 4A0RA 4HQOA 4J3JA 2XYQA 3DE2X 5D3MA 1NR1A 3UMVA 2AR0A 4A15A 4OMDA 2J3QA 2WG2A 3GJRA 1RZUA 4GX5A 4ZC8A 4CDNA 1IY9A 3BMOB 5GQSA 1IAVA 1QO9A 4ON9A 3UPTA 1Q1EA 4EQ6B 1QK5A 1UIRA 3CLUD 2XSZD 3L82B 3O8OB 3WGLA 4MQEA 4RTQA 1NRWA 3ZQKA 4OMFG 2CLIB 4QARA 3ZWPA 2IYPA 4Y6GB 3KFXA 1U90A 2IEAA 4FFSA 4QQNA 4DDUA 4AZTA 2KYRA 1YFJA 1T9BA 1GAWA 3GFFA 3K53A 3SJUA 1DKMA 4PINA 3RWBA 1STOA 3PX3A 5FI0B 2A3NA 5CHEA 3P2JA 2NVOA 1H4VB 3NDRA 4DV2B 4JBIA 2F43A 2JK0A 4Q47A 3VJKA 4MDHA 3M5WA 5JFGA 3ODGA 1YBAA 1BKSB 3NJRA 3U9TA 2FWAA 5IJ9A 1NJGA 1KH2A 2V7VA 4EFDA 4ZVVA 1E58A 1IE3A 2W4QA 4B76A 4DMKA 1MZPA 1JN0A 3OM9A 3C6XA 1S2OA 5J58A 2EJWA 2Y1LA 1GKYA 2Y92A 3J7TA 1BMDA 1TEVA 3CKLA 3NEPX 3F5FA 2I4RA 1DWUA 2ILVA 4JS0A 3U3DA 3RRJA 3V1YA 1TM5E 2QR3A 2K4MA 2I4NA 1JG3A 3V9AA 3MA0A 1DHTA 3PT9A 1NI4B 2NSHA 4CM4A 3ZJUA 2GBLA 3M1LA 5IDQA 3EXIA 2Q6VA 1LSUA 2OB1A 4ZOEA 2UXDB 2D7JA 3ZPXA 3FROA 3EEIA 4MA5A 4EJFA 4JR2A 3SZUA 1RE1A 3R7FA 4BVLA 4QUDA 3SC4A 1YQXA 3E15A 1JR6A 4D3XA 2G9UA 4GNKA 5L3SA 1OT5A 3A6LA 3O84A 5E6UA 2DBYA 4J4TA 4MWBA 1Z0IA 4C7OA 2WD7B 1BCRA 3KUCA 2W48A 2GEFA 3D5EA 3LOQA 4CM8A 1JX6A 3LE8A 4LZZA 1XAGA 3JVEA 3E9YA 1ID8A 1XQWA 3RS5A 1ZEMA 3WB9A 3WR5A 4MITA 2GD0A 3YASA 4F84A 5BQ3A 5CIYA 4JI7B 4PZEA 5GONF 1W8DA 4EPTA 4F0JA 3OOSA 4FKBA 1W49A 1U4NA 1IQ0A 1U7WA 1XBTA 4JYMA 4YXWD 4H7PA 3B2EA 3UM9A 1SBZA 2HHAA 4JNKA 3MWGA 3IKTA 2PMWB 2W43A 5E7IA 4UBLA 5JXWA 3HVHA 1QZTA 1CR2A 3QTLA 4RDHA 5AVKA 3TRKA 4YIHA 4FFWA 2ST1A 3FMVA 5KYUB 1ZM4A 2GZRA 3LCUA 4ND8A 2G5CA 4L9WA 3GEPA 1AKVA 1V2HE 1X0XA 5CB4B 3U7QA 1R4NB 4IDOA 1CNEA 3O8OA 1KRHA 1VHLA 1S3IA 1LTHR 1LX7A 1I9CA 2P30A 2E4UA 3GNSA 1N57A 5KNLA 2VHCA 3KQKA 2ZUVA 1Z22A 4P35A 1H0SA 3NC1C 2FI1A 3FSEA 5E4FA 4JASB 5HE8A 3HWSA 4BX2A 5LBIA 3DOIA 1DAHA 4L27A 1CFJA 2VRCD 3C3EA 1QAOA 3S8YA 3OA2A 4G0PA 2HT6A 4RZ2A 1SHJA 1IIBA 3E5NA 3DW3X 1EQAA 3AY0A 3OLCX 2DBQA 1AQNA 2PH1A 2MMGA 3GXBA 5EESA 4IDHA 5IJZA 3KEOA 1SPXA 2CFRA 1UMDB 1HF3A 3HWWA 2G07A 4MVJG 2QX6A 4XIJA 3PITA 3C3PA 2XNKA 1DPFA 3HJUA 4TV9A 3T3OA 1IJKA 4KAFA 3EDMA 1A9OA 3KPVA 5IXJA 4ZA2A 2RBGA 2HRQA 3MAAC 5HZMA 3NNNA 2QTBA 3BL6A 1DG9A 4QAJA 4XWYA 5E6RA 2EDAA 3X1KA 1OBHA 1T9GS 1W35A 1F0PA 1RYFA 1FDUA 1T9GR 4CG1A 1EBUA 4IVRA 2ZYRA 1GT6A 1P1RA 4GQBA 4KQCA 4CCAA 1M2OB 1X86B 1W96A 5KINB 1G7SA 1RC0A 3ADKA 3IMEA 4L8VA 4HDMB 5AJZA 5FHRA 1P0MA 4MRAA 2CNNA 2H7VA 1EFRD 2B8JA 3FRIA 2BD0A 5ALNA 1JEAA 1SIBE 2QVXX 1K0UA 1JQEA 3B70A 1F8UA 3HDVA 1ZCZA 4K7JA 4TWBA 2MU1A 5DM4A 4WXYB 4KGDA 4LSMA 3K6JA 5JY6A 4JLJA 4JUAA 4MA4A 2H7CA 3QYPA 4M6WA 4HVLA 2IP4A 4G8JA 1B0PA 4PFSA 4Q16A 4TM7A 5CMLA 3IEUA 3T7CA 1OPXA 1U3GA 3M2PA 3EGOA 3EQ2A 2GR9A 2NUBA 2WSLA 1UBOS 1XEXA 3A6ZA 1A9RA 2ATVA 1XXLA 4F7WA 3AXTA 1AD2A 1C7JA 1HE2A 2ZVJA 3ZTWA 4HR7A 3UNXA 4DSZA 1TJ3A 1PL7A 2Y4OA 4EZEA 1YZQA 5ARDA 1EDEA 5T5QA 1GFSA 3GRCA 1M1YE 2H4XA 3TNDA 1NN0A 3VNSA 1PLKA 1QQ6A 2PZ8A 1VHTA 4GBGA 5MF6A 4RCZA 2AJ8A 1GA1A 3RRYA 4P7BA 3N6XA 3VHXB 4B7XA 2EX1A 1IZ0A 2BM0A 4MV4A 4OLHA 2ZR8A 3RE1A 5LA6A 1F1BA 1P2FA 3WLJA 4BV2A 1TM3E 3ICEA 4B6RA 1WHTB 4AY3A 1W85A 4RJ2A 5LMZA 2WD9A 1QP8A 2GF9A 1I7NA 4FFRA 3PC8A 1RFGE 3WFZA 1U80A 2P6NA 3FZNA 3JQAD 3TVYA 4C7MA 2O1WA 3NANA 1Y4DE 5HIAA 4M21A 1RKUA 4L8WB 1WMFA 1Z3IX 3PR2B 1P1CA 3VO2A 1YR9A 3D8NA 4MYCA 4W8HA 1KS2A 4BBJA 1E32A 1QKIA 3AUFA 1OR8A 1UOPA 3BK7A 4UTPA 2XMDA 2F43B 4JOQA 5LOVF 1XPOA 1MAHA 3E5RA 3MFQA 5IC5A 1OIWA 5L3ZA 2ANBA 4QTYA 3BZWA 3H3FA 1RKVA 3QXJA 2WAYA 4ITRC 3CO0S 2B5WA 4TV9B 4TTSA 3TOSA 4JI8B 3NHLA 3IHLA 1NXOA 3FUCA 1ZI9A 4CM9D 3T0IA 3T5GA 2G4CA 4AX4A 1IC6A 3AEXA 4FC7A 4L6AA 1QYVA 1SXJB 3NHUA 2XODA 2XGOA 3AG5A 3D0RA 2ZJBA 2WFLA 4A10A 1FLAA 3THXB 1OFTA 4YRNA 5EWMA 5FOWA 2ZU0C 3UAZA 4D82A 4H7HA 2Z6VA 3PYMA 2P90A 4PM4A 4ZI2A 1ABFA 2EFHB 2C7VA 5KB3A 1L5HA 1OH6A 5B7NA 4XUEA 3IPRA 2PFGA 2Q9CA 1NJSA 3CR3C 3MQ4A 5E2AA 4IS3A 3S28A 1Y48E 4F9FA 1TZKA 1ZD8A 2ET6A 4H7DA 5FLKA 3S5UA 3EXHC 2EVWX 2RGRA 3A4LA 4EHFA 3KOUA 1PWZA 4ZEXA 3N7TA 4WFIA 3ELYA 3EAFA 3PRYA 2OZEA 5GOTA 3SP1A 2A88A 1FFAA 1N9KA 5CVUA 1ML3A 1PD0A 4NMHA 3OJWA 2Z2IA 1KYWA 1M2WA 2KI5A 2FW1A 1EINA 3ANMA 3JASB 3KPWA 3RSGA 1GAEO 1OFHA 4R9VA 4ZCLA 2VYQA 2YJ6A 3A9RA 3O0TA 4FNAA 4O63O 4S0XA 2QENA 4XX0A 1EGQA 1P0CA 4LXGA 1SKBA 3H2JA 3RTAA 3JZFA 4GAEA 2HK6A 3T7EA 2Z04A 4ZAYA 5B64A 3NATA 1IG0A 4AMGA 3VO9A 4MS1A 4R69A 5F1OA 4M37A 1OWPA 1ZFNA 1DAEA 1QHNA 3FJOA 1R0BA 3GDOA 1S6YA 3NDPA 3O2JA 5DM2A 5TR9A 5BSTA 1DV2A 1VFNA 4B6JA 3LWDA 5JCXA 1JDZA 2PZAA 3HU3A 4HMQA 5LZ5A 4B3HA 3UT5B 1BGWA 1G8AA 4RMJA 1CHNA 3A2NA 1TAUA 3DE7X 1JJAA 4FBLA 5FPQA 2BFBA 1VGRA 1OROA 2CMDA 2ROQA 4U7TB 1OB2A 2HSJA 1OBCA 3WLNA 4Q3NA 5JY1A 3C16C 1HNXB 3GEIA 1TK9A 3U4HA 4WA7A 1OH8A 1UBRS 4MICA 1E79A 2ACWA 2CNWD 3HXPA 5FAKA 5KYYB 4OSEA 4OFXA 3JQPA 2FR8C 1DC7A 3TFQA 1U4SA 2PO5A 4ZDKA 1K97A 3V8QA 1Z4NA 5A4MS 3NT2A 5E9WA 1NI5A 4RV4A 1DIHA 3V80A 1PJAA 3D7NA 2AHRA 5FRDA 3LQKA 4LF7B 1E6EA 5G0WA 4DXDA 3ASVA 3G68A 5F64A 2NZVG 1DBIA 1PK9A 4R05A 3OMLA 3RUAA 1GXSB 4PICA 1PEYA 1DQZA 3EGEA 2JI7A 2H5IA 3B3GA 1M8KA 2OZLB 3T0GA 2H85A 4UNSA 5JPIA 1HGXA 2ZIEA 2R8BA 3GLFB 4KRGA 1SU7A 3HCNA 4KG7A 4ZHQA 2HA5A 4YMWA 3VC3A 5K8LA 4UUBA 3I04A 2SICE 4JFAA 1O97C 3MGKA 2AN4A 1DC5A 2C4NA 1XZIA 3GZ4A 3NHYA 4H3KB 1XMJA 5EMLA 4ES6A 2XZPA 5JRDS 2PYDA 3WL8A 1EA7A 4M9RA 4BIMA 1W5AA 1NI3A 2FVXA 4J0EA 2FQQA 3FA2A 3QBTA 3DMHA 1BE6A 1EFVB 1E9SA 2G25A 2JCXA 4I8XA 2IF2A 4PGMA 2E48A 3T3HA 3SEQA 1BAPA 2H18A 1ODJA 2IHJA 1M34E 3TMAA 3NIDB 1E1DA 3KAPA 1X1QA 1OMOA 4G8DA 1Z0UA 4EBFA 1QGZA 4J1TA 4V39A 2Q2WA 3JQ8B 4IDPA 2W6JA 1EWYA 2BFFB 3QKUA 3QWIA 4QL3A 5IAEA 4TT3A 3VM6A 3O21A 5IXSA 3QKRB 1GR0A 1JJVA 3P52A 1AF7A 1M6VB 1GLVA 3WG9A 3M82A 3CTMA 1NMZA 1O87A 3GLKA 1QF9A 4JELA 2QN7A 3Q3CA 4I50A 2W2XA 4Z8YA 3FTFA 1FU8A 5IVKA 2GTHA 3W2IA 4BLSA 2EATA 2YJGA 1HSZA 4NZ9A 5FCDA 3CEJA 1X13A 2Q9BA 2A30A 2VN8A 3IAEA 4KIGA 3CLSC 4NWIA 4QOHA 2F64A 4ENUA 2AZMA 3WIOA 4UUPA 4OQEA 3JQ9A 2OBYA 3WSVA 1F4LA 1P7VA 2F2TA 3MQ2A 3PNKA 4GGOA 3O7WA 4NNPA 1N36B 1NW8A 1ZJYA 5KTYA 2W4IA 1KXJA 3K3PA 4P2BA 2WNIA 1OSNA 4PLWA 1JEQB 2IFTA 4E5KA 1MC5A 3F4BA 4L22A 1X15A 3BJEA 3QLJA 1ZGZA 2Y68A 5KQLA 1V3UA 4NEGA 4IZIA 4ER3A 4UJ5A 2FEPA 2EG5A 4PHTA 2YUTA 3UOAB 3K8ZA 2OE2A 4R3WA 1JEOA 3ENKA 3LVBA 4OBWA 1W85B 4XB6B 2DCUA 3S4YA 1JKJA 3HBAA 5HOQA 4DZTA 1YRBA 1UBCA 1E60A 1VZ3A 1K88A 1WXFA 2V7PA 3QX7A 3WGNA 1IBKB 3W5UA 2QMZA 2RFLA 3IUQA 5DT2A 2V5UA 3HCAA 2EBWA 2PYZA 3REGA 4WOJA 4D4GA 2JHFA 5DGXA 5HCIA 5AVYA 1K8XB 3L7NA 4PAQA 4F56A 3OIDA 4MRMB 4Z53A 1YIDA 5DYYA 1XPUA 3AUKA 1VJ0A 4X24A 4I66A 2C9MA 3BMCA 5D5PA 1EGVB 2BCJQ 3TLMA 4AY4A 1JHAA 1PRYA 3GLVA 3U7GA 3CW8X 1SXIA 2QNIA 2BYTA 2Q4OA 4NSNA 4PG4A 5JXJA 1R0RE 1H9CA 1N6IA 3I2GA 4TOIA 1G20A 2R62A 4CMJA 3DOEA 3MTAA 4F5DA 1REQB 5FBRB 2AJDA 4Q34A 2OAQ1 1XEWX 1RWWA 5KC8A 4NCHA 2IPXA 1SHLA 3MIIA 4NFLA 4YRAA 2GSDA 3DZIA 3MWDB 5DIZA 4Z54A 4IMPA 1ND5A 3R7SA 4IEIA 3BOSA 2CNLA 1L8XA 4IOJA 1SBTA 3E1KA 1RTKA 1IN1A 4Z9XA 1T13A 3STWA 1UXKA 1WB5A 5F9MA 3ZIDA 1XFAA 3Q3IA 3SEZA 4BN4A 1ND6A 3KTAA 1VE1A 1F6BA 3LDFA 3HPQA 1E61A 2B20A 1NTRA 1P4JA 3BXEA 4K81B 4PQRA 5HSGA 4ZT5A 4LF5B 5LJLA 1WZEA 4P4SA 5CH5A 4EQZA 1W4RA 3DVQX 1XQYA 1Y3DE 2GYWA 1HH4A 1R10A 1J07A 2O8NA 4I8DA 1O9HA 4RQTA 1H93A 3GJ3A 1V8OA 4Q7QA 3IBYA 4ZT4A 1YZUA 3QI2A 3SHWA 3K1AB 2XF2A 5D84A 3BFKA 2Q07A 4JSTA 1XTBA 5D8DA 3T12A 4HAZA 2CC2A 4INJA 3NIBA 4QXOA 1WVIA 5BPHA 1D9ZA 5DSZA 3ZBUA 3I04M 2A84A 1BU8A 3IPAA 4ZI3A 2AR7A 1GZVA 2CHVA 3AHIA 3CKKA 2BGTA 4YJFB 3HR8A 4KB5A 3BFJA 4XXHA 1CULC 3BX1A 1ZVQA 2ZJ1A 4DLVA 4HXGA 1C4OA 3LXXA 1P29A 1R0YA 1AXRA 1HM5A 3QKSB 1SJ9A 4HQFA 5K0LA 2NU8A 3QEAZ 2DEUA 3EIUA 2P2DA 2ZYIA 3V4VB 1Q16A 1I2CA 2RHOA 5T4FA 3NHZA 1GUZA 1VDZA 4DGSA 3BDAA 1JKJB 3GO4A 4CR7A 1GCIA 2ZPTX 3LUGA 1Z63A 3RU2A 4CHGA 3FKJA 4CTNA 4EGCB 2XE8A 5BO5A 3PWKA 4YCBA 4OHRA 4B09A 4B80A 2XUGA 4QOSA 1JG2A 4ILKA 3OTQA 1LWOA 1V1RB 1Z2DA 4NEHB 5FUQA 3PX7A 3PFNA 4HYQA 3A9CA 4QBKA 3RF6A 1PJ8A 4QRHA 3ZJYA 5CG1A 4PC2A 3MHPA 4FNMA 1ZIYA 4MUHA 3C6KA 1L4YA 4KXYA 2WM8A 2FR8A 1PSZA 4AZVA 4KFSA 1IDN1 2B94A 2ZREA 2HK7A 3AG6A 4XVHA 3WMEA 3DKRA 4E7PA 1NFFA 1U8AA 3EYAA 2HIHA 5TRTA 5ALQA 3DWIA 4COOA 3UKOA 3LX5A 1QE0A 4RF4A 4AMZA 4LCJA 4D02A 4FFBB 1EP3B 4B87A 1FLNA 1S0UA 1YA8A 1QVZA 3Q10A 3U7HB 3R7WA 1LZLA 1B6SA 3DMPA 4DNFA 1EVYA 1JF8A 3KQWA 3DLTA 4W4TA 2OL4A 1V37A 1WSDA 4OREX 5L95A 3WOHA 3AEQB 5CXQA 5HRCA 4FHDA 4RGQA 1GKLA 3KQOA 3T9DA 1NMXA 4OFZA 1CUUA 2Q5OA 4OF4A 5AP9A 3WP1B 5C1OA 3Q1LA 3TSZA 4L73A 4Y0VA 1DBSA 3IJ5A 4EL5A 2C2YA 5DASA 4BASA 2ZSHA 3C1TA 4PG6A 3FRHA 3UWMA 1QYWA 1W9MA 4A73A 1DKLA 2IUFA 2FN7A 2Z5FA 1RMTA 2RHTA 3I1FA 5D6OA 4FKZA 3NIFB 3TGLA 4CW7A 3B1WA 5IVDA 4EVIA 4HLQB 3KJEA 5K6TA 2JL1A 1I32A 3FAKA 5EWLA 2H2GA 2I4OA 1BN7A 1T8WA 3KU4A 1IHUA 1QCCA 3GVIA 1MR3F 3K1YA 1VPLA 3RW9A 5I9MA 3HYSA 5DCWA 3TMYA 5DIFA 2OQRA 4CGYA 3T4PA 1MU0A 1Z0ZA 5IAKA 3WDSA 1BXGA 2YJZA 5EJ9A 2DKFA 1L7QA 1SBYA 1YC5A 2ON6A 3QKSA 3ITDA 2AF3C 3PX2A 4NCNA 2JGAA 2IU4A 5CA0B 1KARA 2D5BA 1GZUA 3K9NA 2ZWVA 4X63A 2QLNA 1ORRA 3HVJA 4J0KA 5EXTA 5BYBA 4DB4A 3VR0A 1WMBA 3JZDA 3DM5A 5EJ2A 4CMKA 3OEWA 1SUIA 4P54A 5MN6A 4L8YA 3FWHA 3M9XA 2CNDA 3D59A 4R2HA 2OXIA 4JP1A 3OLQA 4JHLA 2O0HA 2R11A 1SUBA 3MJCA 2GPAA 2R7NA 3KVNA 4N3AA 3M4XA 1K7CA 2XBLA 3DAGA 3E9DA 3LGAA 4P3YA 1HO3A 3RK1A 3EUWA 4EECA 2GVZC 3BTOA 2PBZA 3VYWA 2YDYA 4RHXA 4F93B 2C0QA 4Q1BA 4UULA 3GJ8A 1L5NA 5LXTA 4GC5A 2HSWA 4N18A 3P2IA 4ACAA 2CB0A 4E5NA 3KEMA 1OXXK 2NVUB 2PDAA 2ORED 3BSSA 1C50A 4DPMA 1EPUA 2CJPA 4BO0A 4F04A 1BD4A 1YKSA 2PLWA 1VLZA 3WAKA 4FCCA 4FOOA 2H1LA 1N6PA 1P7PA 4O02B 3CZQA 4R0VA 5EUBA 2Z6UA 4WOPA 4G0UA 2CHEA 1CRWG 2R8PA 3ZDAA 4HZUB 5FNVF 1LWNA 1AKNA 2ERYA 1IJFA 4MGZR 3DEKA 3WHIA 4L7VA 5ENDA 1N0WA 1E6WA 5D3QA 2WTXA 1NQOA 3A3NA 4PZAA 5E1BA 4B79A 2AZXA 3ND7A 4QE3A 1G60A 4JXZA 1Z6PA 4MB6A 1CUFA 4QUBA 3T8YA 3KT3A 2AOTB 1NVXQ 1TEHA 1UK9A 3D02A 4EX7A 4O08A 3RHTA 1JLKA 4YN3A 1IJEA 4EL0A 2B6HA 2FFBA 3BC1A 4EW2A 1XDBA 1FVFA 4Q9JA 5ALZA 4BC0A 3MF4A 1I94B 3IUEA 4YCJA 1L5QA 3OPYI 3IP7A 4CMGA 5G41A 1CY0A 5THKA 1T9DA 2XGSA 1XPJA 3C3YA 4LHYA 4BX8A 2O8DB 3T4UA 4LVCA 1PUIA 4GG1A 3KVVA 2BBTA 4JJZA 4E14A 3KR0A 2Q5JA 4Q39A 2HGZA 3R20A 4EJSC 1G18A 2IS2A 4MW7A 4QUKA 4XFJA 2DSTA 3SR3A 4ZYVA 1Y9EA 1DDGA 1NXTA 2AG5A 1FSGA 3ZQUA 4GT1A 1HYBA 3VUEA 1M34B 2OYRA 5A9SA 3D8TA 5BW4A 1K7YA 4M8LA 4MUMA 3PI6A 4EFMA 2GS9A 5H81A 2I3GA 3VGPA 3A6KA 2JLYA 4D99A 3ZJTA 1YE8A 1FFDA 4G81A 1X7HA 4MGHA 2FPPA 2WY2D 5F1PA 3TW8A 3WMXA 3VBEA 2VDMB 4C05A 1GDDA 4DRZA 2BH9A 3P96A 3AKZA 1X74A 1EX9A 4XYMA 3N2GA 1UBHS 3OZSA 5BURA 4L28A 4UE2A 1NU6A 1J90A 2CJYA 2XB8A 4NOLA 1OAKA 2G40A 4YCNA 5EIBD 4GUDA 2VOJA 4X1KA 3KVRA 1YONA 5JXHA 4DN6A 4BX9A 3SI7A 3AR9A 2GEDA 2YRXA 1NYTA 3ETJA 2HBZA 1GGKA 2HX1A 2N1BA 3B6JA 3NONA 4O1MA 4D97A 2BGMA 1K2WA 4NU6A 1Y98A 1CF4A 2V45A 4OEHA 3TIFA 5F2EA 2PBFA 3CA8A 3FTQA 3P9ZA 4GEGA 1OVMA 4Q6BA 4RTPA 1WU7A 2AJTA 2VPYA 2WQZA 2BFOA 3QQ5A 3E5HA 1QJ4A 1A5AB 2WEKA 4RGYA 4X44A 4CUZA 5AJHA 1BQEA 1COZA 1ZDMA 3FLMA 3W9SA 1OX6A 2OO5C 2ISQA 2VZLA 4NQZA 5AI5A 4ZZ2A 3OJ0A 4D26A 1PTJC 3JATB 4MVJF 1GYQA 3KBBA 1V4VA 9LDBA 2BZGA 1ULZA 3OEYA 1FX0B 3R9IA 1W2HA 2R8EA 5C5CA 5HQTA 1C1DA 3PBKA 4G85A 4OXKA 4DBLC 3SQXA 4PSDA 3STXA 3HRIA 2R7LA 4JA2A 4XIGS 4EGQA 2HBRA 1FYEA 4PU0A 3WGOA 3V8PA 3I9FA 3LL7A 4DW8A 4PYOA 1NIPA 5IM4A 5C80A 5CJJA 3U56A 1VLMA 1T5IA 3CLKA 4MLPA 4P36A 4EPXA 4CQLB 2JAPA 3LNCA 4G4GA 3L1IA 2PXXA 2PSDA 3NHFA 1U5CA 5DEOA 1VPDA 2BC9A 3EODA 2FW7A 3H4MA 3PDUA 4KJZA 1E9FA 1A2QA 4TT8A 4QJBA 2Q7OE 2XDQB 4YRKA 1U0JA 4GX2A 2OBNA 4Q37A 3PC7A 2XY4A 4KUHA 1IXSB 2PQ0A 1U28C 2XOKD 1KEVA 2QVCA 4OHBA 1KEEA 4PW0A 1FFWA 1WMAA 5CDSA 4F6LA 4GL2A 1PFKA 3DMYA 1VI5A 1UJNA 4BP9A 5CK5A 4ARVA 3CLRC 4OJTA 4ZC1A 4DZRA 3GUZA 4N01A 1DRWA 1REQA 1N1GA 4YRLA 4IOKA 1JDSA 4KQJA 2BF7A 1QE5A 3L1KA 4DS3A 3BXOA 4LVUA 1LW7A 1PWXA 3IEIA 5IC4A 4G1VA 1ZC3A 4ZYWA 4P3PA 3CRMA 1YBHA 3LK6A 1YR6A 5FPYA 2H9YA 5DYIA 2EU8A 1OU4A 2I8LA 2PFKA 1SOMA 4M46A 2DQZA 1UJ4A 3PUIA 5KAPA 4LQLA 2IH5A 2CLDX 4URFA 4XDZA 1L4BA 3OIGA 3OQVA 3PD7A 1M8FA 4ZPXA 3SHQA 4E08A 3ZWMA 1Z4LA 3JQGB 4RKEA 2QI9C 1S3GA 3RS2A 1H8HD 1FFEA 5AK3A 4NU0A 3B1FA 1ZXLA 3SYMA 4P6VF 4TSFD 3PSAA 3C24A 3HKCA 2M1ZA 1QHYA 3MMSA 3IUBA 1UKYA 1EWKA 2A8YA 5CBPA 3W7VA 2GZ3A 4LXYA 3QU5A 1ZJ4A 3WLTA 3ZCSA 2VRNA 4PRKA 3NTQA 4WKBA 1MO2A 3S55A 3L06A 2DZDA 2CFCA 3IQFA 4YQZA 1K1EA 2FP3A 3PQ5A 4IGAA 1IHYA 3EDCA 2W83A 3AHCA 3G13A 4UREA 1ZVMA 1H3FA 4CM5A 4RORA 1CHDA 1NF8A 1JQJC 1VA5A 1BHSA 2CXPA 2BTQB 1RYEA 3EFEA 3IKJA 2A1TR 3P32A 4G0NA 3IIIA 3AVYA 1CERA 1EWRA 2VP5A 3T1OA 5JU6A 1FTNA 1HX7A 1NTOA 4JYZA 3T3MB 4EKNB 3EPKA 1AZLA 5HF6A 2WU3A 2GK7A 1EFPB 2FNAA 5LUBA 4NK5A 5IJ9B 2A35A 4RY8A 1KP9A 1M72A 2V0GA 5DW0A 1J21A 5KOHB 2B8TA 2UKDA 3I52A 1KSHA 2QTNA 3HI4A 1E8MA 3IAM6 2H2DA 3RJ9A 1XD9A 4U2FA 1HE1C 3RSZA 3R3HA 4Z4HA 3V1TC 1T6NA 4ZV4A 1XRNA 3HMKA 2QQ0A 1M0SA 2VHJA 1U04A 2OOSA 2WSYB 4IYJA 2IHZA 4LS3A 4GI5A 4NBWA 4R1PA 5BR7A 1W34A 4IF4A 4KO3S 3RARA 3T1QA 3W4JA 3ZW7A 5KVAA 2E55A 3LX8A 2BFCA 2CHQA 2O9JA 1N32B 4ZVOA 1MENA 1F8GA 2Y2UA 4GM0A 4NJMB 3ROEA 4AJNA 1ZOIA 3QA9A 2F9FA 1PDVA 3RC9A 4A8JC 5LDHA 4CG2A 5AOAA 5BWBA 1N2ZA 1XD2B 4D43A 3H4IA 4V0RA 2GRAA 4M1SA 3RS4A 4B31A 4LWOA 3B5IA 1D0SA 3K0CC 2ZANA 4CL8A 1SXJE 1CZNA 1W4BA 3OWXA 3Q12A 1T1SA 2C4UA 1WSAA 4JBGA 3K8OE 4WV3A 4A8JA 1XDZA 2GEBA 3TZEA 2R0QC 2XBMA 4LJ7A 2OXEA 1KK2A 4UVGA 4JK3A 1UR5A 5JH7F 1HOTA 1GCGA 2FQ1A 2HA6A 4ZTUB 1KE2A 3KKOA 1JAIA 1DUSA 2BGNA 3HDJA 4ZVPA 1AO3A 1MF7A 1U0OC 2NWQA 2XKAA 1MFPA 4QU5A 5JS8A 3AZOA 1C0IA 3K15A 1ABBA 4DV0B 4FYVA 4BVKA 4LOJA 3BQMB 3LGSA 5DN9A 2FWMX 2FCAA 4AKGA 4L0CA 4CEIA 2G08A 1E92A 1PFVA 5TQ2A 3D1LA 3QITA 4IV8A 3OQHA 3RU9A 2HJRA 2O4UX 1FRVA 2V98A 3BD6A 4BBPA 1M2JA 5KAMA 4RENA 2YXDA 4KRFA 2QN3A 4NDAA 1RXSA 1ZP6A 3CB2A 2NTJA 3KUKA 3L7YA 1A1SA 1JHRA 1E7MA 4JJFA 1P2BA 1PJCA 4M4SA 5H4HA 1CZKA 4K40A 4YAGA 5JZOA 4MQLA 4X8HA 3C7CB 3LECA 3VC1A 1FFYA 3R1IA 5KTMA 1KVTA 2WPDD 1I1NA 4CEJA 1WRBA 5KS2A 2OVFA 4DHWA 1R5JA 3K4QA 1WCV1 1GUBA 2XTNA 4JQSA 3KT6A 1GU7A 2QYSA 3NBQA 4G8BA 4MCJA 4NPHA 3T0FA 3A1NA 2IHTA 4FB4A 4CGZA 4Y9SA 5K9ZA 4OHKA 4RMIA 5CD1A 4NHOA 4Z7QB 3RIYA 1BD3A 4DUYB 5AI6A 2KB0A 2IX9A 1EDBA 4A8TA 4JX8A 4L5AA 3PNPA 1F6WA 2VT6A 5KOHA 1ULBA 2G67A 3JATA 1AURA 4IWYA 2QL6A 4B35A 1EUCB 1I3NA 4HLDA 4M9SA 2Q9UA 4ZXPA 1K8RA 1ZSVA 1RM3A 4NXNB 5L45A 2AV6A 3K72B 3OTIA 1NT4A 3AETB 4O4LB 1XX6A 1NR5A 2ZRDA 2BKUA 1UBKS 3IHTA 4ITVA 5B4TA 4IDAA 4PX5A 1Q7EA 1EVQA 3ISJA 3PRJA 1Y34E 4PGHA 4X6YA 1SOUA 4URHA 2J3EA 3K5PA 2ADOA 2XXJA 3KJGA 2DBZA 2Q5EA 4R01A 5EXXA 1KY4A 1L5OA 3WRWA 1OZFA 5IFLA 1QVWA 4CCSA 2HJGA 4F3RA 2OUIA 1T6YA 4MKFA 4FHFA 5JJLA 1L8LA 3EVNA 3CLTC 3L3BA 2XB2A 2IDZA 3JSAA 4DDWA 3RJTA 5EKDA 5JD5A 3BHJA 1TKRA 1JAXA 2BEVA 4FZ5A 4OJQA 2P9EA 3RH0A 1DMRA 3LPLA 2MIIA 3H1EA 1C7EA 1JDNA 1YHZA 2P68A 4XX1A 1IRIA 3ZDRA 5C5IA 2X40A 3Q1KA 2XWPA 4KFUA 1RT9A 3ZD8A 1ODKA 4LKOA 3W5CA 4MIYA 3H1GA 4OA8A 1DOHA 2HU8A 2P5SA 2VJOA 3HXLA 3KKKA 3WY9A 5JISA 3U09A 2J4DA 4KIJA 3L05A 1I6LA 4AMYA 3LI2A 3NC4A 3OKFA 3UJHA 3ANXA 3N6VA 1BXZA 5G3YA 4WKGA 3RT7A 4QYIA 3F98A 4AUMA 1GGMA 1P91A 1GAXA 1T29A 3PXUA 5MHTA 3LXMA 4TMVA 2QR2A 3U3JA 3ZXSA 5HM8A 1R12A 4ZYYA 4WK4B 5BRNA 4KWTA 3JPYA 1ILEA 2GD2A 1UKZA 2D74A 2HC9A 2OBMA 2FPIB 5L6LB 4PIMA 2OT3B 3L8YA 3IELA 3MNFA 1HURA 1Z9BA 2QTRA 2FWRA 2WZQA 3C3MA 3F7TA 3LU1A 3FDFA 1DKOA 3PE4A 1WCIB 4CL3A 3HSSA 1KO8A 4BNXA 1SBNE 3RVMA 4HUJA 1PR3A 1Q1ZA 1V5IA 4QEZA 4B2IA 1ISHA 3W79A 5AVVA 2QMUA 2FPRA 1A50B 5FUWA 3G8YA 3MILA 1BZYA 2V7QA 5CVEA 4NS1A 4MR7A 1ID1A 2YV3A 3RC8A 4IJKA 5DBGA 2K2QB 1T1JA 3U0VA 4JLAA 5F76A 1F5NA 1QS0A 1EFLA 4MUJA 1PN3A 3SLRA 3FWZA 3R44A 3EY9A 1V45E 3O3MB 4ZOLB 2X6RA 4JI3B 5A06A 3HCEA 3HEMA 2IDJA 4TKLA 2ZIUB 2BI7A 1D2GA 1NATA 1SG0A 1ULAA 3GYGA 1OFUA 3D4LA 4U9IS 2O5EA 2ORVA 3THSA 2D1YA 1S96A 4MEAA 1GTL1 1VBKA 3A1UA 2IS6A 1WXDA 3L0PA 4PQGA 3AZQA 2MSLA 2PSFA 2VQSA 3KLPX 4CUJA 1VKJA 4IMJB 5D00A 2DULA 3T9BA 3QZUA 4BQPA 2DT8A 1ZSNA 2J9FA 3ZCPA 5JI2E 2XSZA 4GOKA 2GB4A 2VC2B 1W6UA 3O26A 3HUDA 3DB1A 1XNRB 1GOTA 1LPOA 3C14C 4UUQA 2GHIA 1X6VA 5AQEA 1Y7HA 4B1FA 4G0VA 1E9BA 1XTTA 2Z56A 3HB9A 1XKQA 1EH5A 1JMYA 3IQWA 3QBEA 1YGPA 1S7GA 4OJNA 3H5AA 4F91B 3F5MA 1IN4A 3JRWA 1UC9A 3LP8A 5UKDA 5KQGA 4PR0A 4E4TA 3N0WA 3NT4A 1GPBA 4DC9A 1HK7A 3DE5X 3HFRA 2UYOA 4QDUA 4W5JA 4ZEWA 3NDBB 2DQKA 3D8RA 3WKEA 4IJ6A 2O7VA 3L7BA 2CFOA 2Y6UA 3LY5A 4R2WA 1CUDA 4Z4QA 1NN1A 1WWKA 5EIAA 5SV2A 3RRFA 1A4XA 3D6FA 1KKMA 4N9QA 2C99A 4XYEA 1Z8HA 9MHTA 2PGAA 4WE3A 4E1AA 3U4CA 2GESA 4R5MA 1HL7A 1Z5OA 1F3OA 4JUCA 4ZKEA 3PPIA 3PSHA 5A7HA 3QXSA 1NG1A 3O73A 2I5PO 4BKQA 2HOQA 4Z2AA 4F86A 3NTXA 2PLFA 1BA3A 4PSCA 2QV7A 4HSGA 4EYEA 2QVLA 4XLZA 4TUYB 3QHQA 4AJ4A 4HB2A 3A1CA 2NU9B 2XCSB 2JLVA 1LBTA 5FP0A 1OU0A 3H9QA 5K0TA 3PV0A 4GEKA 1NXVA 4P4SB 5HK9A 1U3VA 4ZANA 4ND3A 5LZ7A 1CX9B 1Q50A 5EP2A 4BNJA 1PUJA 3EULA 4HATA 4RKRA 1QS0B 3VKVA 3EVZA 4EG1A 2V3CC 1I13A 2DVMA 1ZRSA 3LM8A 5J2TA 1ZO8A 1JP7A 1MC8A 2VDRB 5EE0A 1MH1A 1C0PA 2RC6A 4YUVA 3VNQA 3ZWOA 3GLQA 4P3OA 1DKRA 5IRCD 1E9VA 1XRRA 3ND6A 3QKIA 4MV7A 2RC5A 3E4CA 3T7DA 4EEZA 2Z98A 1JDVA 1KEKA 3D0QA 2WWRA 4P4UA 5AKGA 2ZJZA 1CTQA 4IO1A 5KHAA 1UH5A 3QNWA 3H5NA 1ZR4A 5DRTA 4AW9A 1ECJA 1KS9A 2VDOB 1OIVA 4XLTA 3ZV5A 3OEED 5CCBA 3G8AA 3AERA 4ECAA 2CCJA 4MEJA 2PE5A 4EA8A 2ECFA 1Z29A 4CCYB 3NUGA 4BFCA 1E1QA 3PL1A 3RFXA 1J9EA 2GM9A 5E9JA 4RM3A 2GTIA 3GAFA 3EZ2A 4MJ7A 1U94A 2PMFA 3FBTA 1MHPA 1IPEA 1Y1SA 3E3MA 3K9WA 2PLAA 4N3BA 5TSDA 4PN7A 3MWKA 4K0KB 2Z2KA 3BGWA 3D81A 3QUTA 2WWVD 2W00A 3H5RA 1DXOA 3K9HA 3INGA 1YDGA 4R2XA 4ZAGA 1G5IA 4ER5A 3ZDBA 3WJAA 4OHVA 5K6AC 4B3FX 3UMSA 1QH9A 1NI4A 4Q6WA 2XRZA 2FEXA 2Q4EA 1Y81A 2FPUA 3TDMA 3V2GA 3MUOA 1XR3A 3OF5A 2Q1XA 3M2TA 5DYTA 2IY7A 2HH9A 3QX3A 1PZNA 4G1FA 3X1WA 1UQUA 1SVLA 3PEFA 1MEJA 3KWFA 3UJ8A 4KX5A 2CVQA 3QTBA 5GJBA 3VHRA 3R3ZA 4LY0A 4E0BA 5BSHA 1MT0A 4TS9A 3T3NA 5LKRA 1C3JA 4H4CA 1KJQA 2AYYA 2QTAA 3LS2A 4QUJA 3TVDA 3NX4A 2AOXA 3GPDG 3OUUA 5EJAA 4OYRA 1JDUA 2QQGA 1A95A 2YY6A 2G9VA 1IUKA 2PXAA 4L0QA 4LBZA 2AOWA 4LGYA 2PPVA 2QG6A 2WPDA 1SFRA 4L5YA 2ZI3A 2ID8A 4DLPA 3IIMA 4FGKA 2EP7A 3RFVA 3USCS 3OE5A 3DLAA 4WEQA 1YVEI 1TCCA 2XEXA 4BB6A 1UKEA 3DE0X 5BUSA 5HS4A 1NHGA 5ALLA 4DMMA 5JRJA 2VNIA 1MG0A 1N1MA 4PZ9A 2F3RA 3QVMA 3NRBA 1X7YA 3S2GA 5FOQA 4JI1B 4KXLA 3LUKA 2BAGA 2P9GA 3ZZ0A 1TIPA 3G1UA 3HLKA 4LCEA 3KSMA 5B2ZA 1ENOA 3CMMA 4TMFA 2VTBB 5PGMA 3SX4A 2Z2ZA 3U7JA 1GZ6A 1NY6A 3EQZA 5EMMA 3CVWA 2BFCB 3LPNA 4YJ2B 5LYJF 1P4HA 1W94A 2RHDA 3UMMA 2JAHA 3EXEA 4B4OA 1NKVA 2RGEA 2Z9CA 3BWDD 1XEFA 5BVHA 4KXNA 1UJCA 2QSUA 1IWOA 2X8WA 3T5MA 1TM7E 3SR4A 1J2JA 1EXWA 1OI4A 2VHEA 4RY9A 5CDFA 1WUYA 1TDJA 4JJAA 5LKAA 1Q0LA 5G1PA 3RVKA 1JWLA 2NUPB 4BQEA 2UAGA 3SVTA 2HJVA 3PI7A 2VNAA 3OC0A 1YKFA 3R24A 3FNGA 2NAFA 1A8QA 4CF4A 2FPLA 3DCJA 3ZUPA 3CX6A 3EG9B 4O4HF 1A9QA 2QLJA 1N3BA 4LJSA 4AECA 1YZLA 1G9TA 1TZCA 1K68A 2AN3A 3MOSA 5F7OA 1A5BB 2O8BB 3PFHA 2TYSB 3P0HA 4MTCA 2PGIA 2R1UA 1Z6AA 2A9RA 4RC9A 2PZBA 3QTTA 3CE6A 1V6AA 3HACA 2QY9A 5LDDC 4FWTA 4D6YA 5FOXA 1LLQA 2EEPA 4U8GA 2CNBA 3OJCA 1QX4A 3IEKA 4QU8A 5DCLA 4ZT6A 4IOMA 2IZ1A 2H11A 1HV8A 4TPKA 4NCKA 1N25A 3SJ7A 4JLDA 1DC6A 4RK1A 4YHHB 2EZ9A 2P35A 2DLDA 1UBSB 4CEHA 1P9NA 3W5BA 3ELDA 4QXAA 5DW3A 3DHVA 1IBMB 3WAJA 1QZUA 4MPTA 2Z3ZA 4DUZB 3LQ2A 4GPEA 2AZTA 2GBLC 1QIMA 1V8ZA 2X8JB 2OUKA 3EGCA 1B0AA 3SZ3A 4PC3A 2O5CA 1E2NA 2E6KA 2ZXEA 3N1UA 1W36D 3W5JA 3DUFA 2FPXA 3QE3A 4PC6A 5KVQA 5LYYA 3CS3A 1NDUA 3QVJA 1BOOA 3QBDA 1QKJA 1JHPA 1RWQA 3EVDA 4MQFA 5JAOA 4L3OA 4ND7A 1QHHB 2LKDA 2A3RA 1A8SA 3TI9A 3FRJA 3TCKA 1PQWA 4TVOA 5HJ5A 4Z4IA 4WZZA 5M3BA 5T57A 2AH5A 3ZIAD 4C03A 3TX6A 2QLFA 4OJMX 5LB4A 2WIGA 3KQVA 3WE7A 6REQA 2NP6A 3ZV3A 1J70A 1XRLA 1LDYA 2C97A 4M8NE 1U98A 3K73O 3GRVA 3MQFA 3URKA 1T9AA 5KJ6A 2FFQA 3RM3A 4E15A 4RX1A 4PYJA 3DSRA 4KMMA 5CT6A 4BS9A 1RAEA 3EJ6A 2IYLD 3BWBA 1WV0A 1WUKS 2XQJA 4OGKA 4URZR 2XA1A 3GGPA 4S3MA 4Y67A 2ZR0A 5JVDF 4Z4FA 2DFKB 4G5HA 3L7OA 2XLCA 5EI5A 2PUGA 4YCLA 4F4JA 1IHDA 2FVYA 2FY8A 2Y0PA 4DM3A 1SA0A 1U0SY 4IXWA 3CRZA 4F6RB 3G2HA 3M4NA 5F77A 1O0SA 1US8A 4FUQA 3DEHA 1E8DA 3CM0A 1SBCA 3S68A 1KR5A 1W4LA 3AI1A 5DTRA 4LZAA 4ZYTA 4DBZA 2YW2A 2WABA 3V7WA 1VHWA 1ZD3A 2NUPA 2Q28A 1BQ4A 1U1FA 3P4YA 2VNJA 1UOQA 4X71A 4F9EA 1JLRA 3E48A 2IGBA 3M5PA 2UYCA 3CCBA 4ATNA 3P20A 3E58A 4OKSA 1KL7A 2OORC 3P9QA 5L4NA 3K20A 1I7QB 3V4PB 2M1XA 4C0BA 4CMCA 1EHCA 1QBGA 4LC9A 4QQRA 3AL0C 1TU0A 4PSKA 1SWVA 3JWGA 4CE6A 5CFMA 2XJ9A 1USKA 3VKHA 3GL9A 3FDIA 2IXFA 4MDYA 4PLVA 4LYYA 5CHYA 2YASA 1Z4IA 4P31A 4UBNA 2A5DA 1R15A 3TQOA 1N2IA 4W5WA 5MDHA 3WGIA 3VI3B 1V1RA 4GS5A 5C1BA 3HP4A 5KYKA 2FPSA 4N7MA 5FWNA 2Z8YA 1QG0A 3GZNA 2OP1A 4RYLA 5I8ZA 2AWNA 3EYWA 1XN1A 2CXTA 4PLPA 1YR8A 3LX4A 2I2DA 4QWWA 3GD5A 3RODA 3VVLA 4R0MA 5LBUA 4JQOA 5MN4A 1QFYA 1UQRA 2PMCA 2VYFA 4CQJA 5FTWA 3N8KA 2G3YA 2YZNA 3JU3A 4OG2A 4XD7A 1S8FA 1U1CA 4IV5A 1QP0A 1M8GA 1U3WA 1ZJZA 2X14A 3ASYA 3GJZA 1FVOA 3LA6A 4RLSA 3SFZA 1ZD1A 1IPFA 2W2TA 2VR1A 2CUZA 1U2ZA 3DUFB 1DL5A 1DADA 1ZZEA 2VKTA 4NVRA 4UQLA 5IULC 3ZK8A 1NVTA 1VC2A 4G65A 4NYIQ 3WGTA 3FOCA 2Y1FA 3BN3A 3R5KA 1XZPA 1LXCA 5K8TA 4JD5A 1KH3A 3ZDQA 3DTNA 1SBHA 3B51X 1N7JA 2RMKA 3MGAA 3OZGA 4M9ZA 1R50A 3THYB 1XGKA 4HNAB 1OXVA 4U1RA 3QOWA 4EUEA 3NVMB 3QYFA 1FX0A 1YHNA 1Z38A 1AGYA 1M74A 2Y4NA 2ZJOA 3EZYA 3G2QA 3DVLA 2ZG6A 4YT8A 4GWKA 1U8UA 1RAAA 4D9HA 3D3KA 4N54A 3ZV4A 2FDRA 4RZHA 4NMWA 1Z0DA 2O2YA 2IYRA 3E9CA 1YJAA 3EK2A 3TECE 3D2LA 1V5EA 2XTAA 3JQQA 4F6RA 1IN6A 2IS4A 1I30A 1GP2A 2XMPA 1EZ1A 1PDWA 3NUQA 3WJ2A 4FX5A 1AUPA 2C5EA 3I58A 4QQKA 1H85A 3EDYA 3I05A 2X0EA 3NGXA 1CUIA 1IZZA 2QRZA 4BB5A 5ITSA 3H19A 2C83A 3H05A 2D7DA 1VOTA 3IKVA 5HBGA 3PC6A 3BWVA 2PUFA 3MJTA 2Q7DA 3WGKA 1BXGB 1J24A 3DMGA 2P7HA 1TFUA 1X38A 4ER0A 1FUIA 1KR2A 4PLFA 4EUKA 1WB9A 3KSAC 2CL6X 1CR4A 1E9AA 4LGCA 4BATA 2P6PA 1OXKB 4GQAA 5DHAA 2IV7A 1PKXA 4L8FA 3RSLA 1P60A 3K70D 4TYWA 3R23A 4FCWA 5FYDA 2WFMA 2JH9A 4C88A 4E4YA 1A9ZA 2X41A 3REQB 2AB0A 3BFPA 1OLUB 4GOLD 3I6MA 3OEHD 3CLHA 1U3UA 3PDIA 2R25B 1B8VA 1YDWA 2DFDA 3LXRA 2HMWA 3FVTA 2JGDA 3QVVA 1O96B 3PYLA 4NENB 4E12A 1NBEA 1JILA 2BFMA 4UDOA 5KBYA 2GYVA 1VRCA 3M6AA 2OO3A 4TUYA 1AQ6A 2WAOA 2VP2A 4C2BA 2C2BA 3FFBA 3QPUA 2A78A 1NVFA 1R0ZA 4KAXA 3ZCVA 4ZQHA 7AT1A 3QPWA 4RJJA 3H65A 3E61A 4G5FA 4QHTA 4WADA 2QS9A 4HDMA 4WZBB 2ZCJA 2HCFA 2XUJA 2W58A 2NUAA 2ZUSA 2FSHA 1EE9A 3G6WA 3LUJA 3WNZA 2X0IA 3CZ9A 4R68A 4R8MA 1SUCA 4MI1A 4NBLA 2CV2A 2G0TA 2GNOA 4F8EA 1XN4A 2C4HA 3MTIA 4GHWA 5HUJA 1VDMA 4UJ3A 4F5ZA 3WKBA 1MXFA 4YP7A 3KB1A 3PR1A 1KDVA 1E2KA 1GU1A 4GMDA 3J81k 4J0JA 2F1JA 1WLYA 1BRMA 2GM4A 2ECOA 3AL2A 2JIMA 4E22A 5FPTA 1LPMA 2Q3HA 2A5FA 2YFQA 1TJPB 1C8VB 4A0QA 5HJ7A 1WUTA 2R5WA 2VBGA 3EZFA 3UHOA 5I4CA 3ONVA 5D3KA 4ND2A 4D46A 5BMVB 1MO5A 1RP7A 4BPBA 4RA6B 2HO5A 3DONA 5B7PA 1UBEA 2H65A 4P4LA 3MLEA 1EFTA 4FJ2A 4W7SA 4XWGA 2OWEA 4OU5A 1T43A 3FHJA 4EDFA 2FEMA 3T5CA 5K0EA 4NCAA 4ZGBA 4NBNA 2DWPA 5AH0A 1VB3A 1TVMA 4JGIA 4W1PA 5LYJA 1Q0TA 1YDFA 2HJWA 3CWCA 4GKJB 1J1ZA 3C3WA 3GEGA 3PQFA 5B3JA 5EJEA 5CM8B 1KTIA 2X23A 1KTVA 4BNNA 1N77A 1LSOA 1GA4A 5KJEA 1KI3A 4LV8B 1J0DA 5AHWA 1Q20A 3GV0A 3WKDA 5A6SA 3LFUA 3EISA 3IERA 1GPKA 4FDMA 4UM9D 3OPVA 4YRTA 5FUXA 2C0PA 1FPQA 2FV8A 4BLUA 3VNUA 5HXAA 3CSDA 4OUDB 4FFDA 5F5NA 1MAAA 1NW6A 4IX9A 2WVGA 5CTAA 4A0GA 1QVAA 3ZK7A 1NM5A 2IYWA 3TM4A 4MVWA 5IPFA 2XDWA 3M49A 4P08A 4B7ZA 5IJ0B 4P1ZA 1RWOA 3ETNA 2TS1A 2ZRAA 3GCWA 1VI6A 2ZVQX 1FNBA 4TL6A 3VMMA 4AXXA 1WKCA 5BW6B 2VLBA 5K0GA 1Q3KA 3JV7A 3RR2A 3TOZA 1M0WA 2SKEA 3K2BA 5KOJB 5KX5B 4MGEA 2QTLA 4AUKA 1WSWA 4QQ8A 4BVEA 1ESCA 1G4AE 3RQSA 4X3PA 1RPTA 1U7HA 1KJNA 1L5FA 5AW3A 4AWXA 3NP9A 5EVCA 1EFKA 1SVUA 4TYYA 2W93A 4JOSA 3S29A 1ZK0A 3FYTA 2Q7XA 3D3NA 4DT1A 2OILA 1EB8A 1BHO1 1A8PA 3LQYA 1OFUX 1KQPA 3D6AA 3VGJA 3G7UA 4BWGA 2AMJA 1HT3A 2I6SA 3O4HA 2HJHA 5DBIA 2D7CA 4MZXA 4MZDA 3HB7A 1X1DA 5FJIA 4GRIA 4B3XA 3TD6A 1E4OA 1ZIPA 2DRIA 1QK3A 2OLKA 1KU0A 2WIJA 2VZEA 5CGZA 4YRRA 1CY2A 1UMCB 3HN7A 4UTZA 3ZZMA 4AL4A 1Q84A 4ZEMA 3WWPA 3TKAA 3BB3A 5E3HA 2GVNA 3Q41A 3VVCA 3SDBA 3KJNA 1P9RA 1C9JA 3VYUB 3GF4A 4KH1A 4MEBA 4J1QA 4MRSA 3TAXA 3ZKWB 1G64A 3RB8A 2DKNA 5CURA 2XUKA 1H5UA 4FMPA 3WSWA 1RXWA 3UH0A 1IATA 3GVCA 3LDGA 2J3JA 1DMSA 4I2NA 4BNLA 4ZDIA 4EFLA 5FBVB 3WGHA 2Z2JA 1S4MA 3VSBA 3LNTA 4ZK2A 2XIJA 1Q0HA 4R8RA 3ZD7A 1T2NA 5CLQA 2AXNA 2VDQB 1NRXA 2WTMA 3VKUA 2EQAA 1Y42X 3Q3VA 4RFSB 2O8FB 1VBFA 2OHIA 2REOA 3AR8A 3LC1O 4H77A 4C29A 1SXGA 1FJGB 5HMMA 1E1RD 3G7SA 2Y1XA 4CM3A 2GN6A 2VTBA 5JROA 2HLNA 3VPBA 1G6HA 2CV0A 2WUDA 1T91A 3RFCA 3MPOA 4KQ6A 3T3GA 4CODB 1VJGA 5E1MA 1T0HB 3IUSA 3OCJA 1T3ZA 3F8WA 3ZU6A 1O94D 2IYVA 2I2AA 4M9CA 4H6XA 1XNHA 1RBZA 1T3SA 2YHBA 4R41A 4RZQA 1OA0A 3MT7A 3PEVA 2W2QA 5E2BA 3UG6A 3PQCA 4C7XA 1GTG1 4GGPA 3RFUA 3P9XA 4TTTS 2Y67A 3H17A 4RHUA 4TWJA 4DM4A 5F3RA 1IZ8A 4B2PA 5AM0A 5F4ZA 3QFRA 4ENRA 4CIBA 1R8QA 3OPQA 1UXGA 2D3WA 2JJ1A 2JIDA 3K05A 1PQYA 3PJGA 3ACCA 2X0FA 4TXHA 3GLRA 5EPUA 4ERNA 2BRUA 4ZZ0A 1YZKA 2GLXA 4PZZA 1Q1AA 1AMOA 4AXBA 4WESB 5L3QB 2H4FA 1JDJA 1I9GA 3NVKI 4RTKA 1X8XA 1CUXA 1Z5ZA 2CN1A 2GAFA 2PWAA 3L1JA 3OO1A 3P0JA 4FS3A 2PD6A 1FXWA 2IOHA 4KIFA 3K8QA 3OIYA 1G1MA 3SE7A 2AEFA 1VBNA 3LY9A 3L6OO 1CCWA 2VJQA 5FULA 5IC6A 3PGJA 5I7AA 1UBFA 4GXTA 5J4YA 1JG6A 3ITKA 3O90A 3AU9A 8ATCA 5KX5F 2VBCA 4JVMA 1SU8A 2RI1A 2VDLB 3H5IA 1U8ZA 4FYYA 4MPDA 5AVRA 3B1KA 3OMWA 1Z4OA 3N0TA 5EMJA 2OK8A 1Z47A 3LSTA 4EHNA 1BH2A 2OSBA 5AOVA 2Z2YA 4CV1A 2UUBB 4TV8A 2R79A 2JGJA 3DAOA 2GZDA 1T2UA 3CRQA 1GGNA 3V8EA 4AK9A 4ESEA 4TYMA 4URXR 3VH2A 2WIKA 4HZIA 1RRKA 1T24A 3LL4A 4J76A 4Z6KA 3UCFA 1GR1A 1WVMA 1XMSA 1RXYA 1DC8A 1FS6A 1TO6A 1VPTA 3RREA 4B81A 3L7KA 5BSEA 1ONNA 4DOMA 1B6RA 1B8PA 1JEEA 5AJXA 4QBFA 1AN9A 5EZYA 3ADOA 4GWLA 1SURA 4L4YA 3KALA 2YZMA 4RABA 1CBUA 1FUYB 4HWKA 4GR5A 1TA4A 2D1QA 1YIAA 2QLMA 3DPSA 4FGSA 4I55A 1GN9A 3V48A 2CK3A 2CB9A 1YS7A 1HQDA 1O9BA 1ETHA 4U5XA 5FAXA 1O1YA 1TM2A 2SCUB 4KLNA 5BSUA 5CFNA 4YT4A 2ZVPX 4G5SA 4TMYA 4YMHA 2QMYA 3W3ZB 5GP1A 3C8MA 4RAQA 1XDGA 4ABYA 1ZSYA 3MTBA 5JJKA 5B57C 2LE0A 2WJJA 4YCDA 4L76A 4YREA 4HQKA 1EAYA 1E1NA 2X8AA 3FXAA 4IJUA 4KZPA 5T67A 2HXSA 4UU7A 1U3TA 1V96A 2H1VA 3GZNB 3A1WA 4IQFA 4V3CA 3L4BC 5EGSA 3TUJC 3U48A 1XLVA 2J9FB 1P7CA 5K8JB 1EUDA 5TNXA 1GNRA 4PPNA 3ZE7A 3FOZA 5JBIA 1QRAA 3UK7A 1JMVA 1HE4A 4KAJA 3X1YA 2WWFA 3GY0A 1NYQA 2BONA 2QHXA 5B1IA 1U7UA 4WJZA 4D4JA 2BWJA 4ZYLA 1H2EA 1E1YA 1Z37A 4BLTA 2EW1A 4B3BA 4BAZA 1AF4A 3DB2A 4F71A 3MGBA 4OUKX 2YOHA 3LVQE 5GM1A 1EG2A 2OAGA 2VJAA 5GM2A 3VZQA 3DYBA 5JASA 2HD4A 1K8YB 1KIFA 3C7KA 1QANA 3DAYA 1X9HA 1YI0A 3ABRB 1ZNQO 3IHWA 4LJ6A 4MKXA 3OECA 5EQTA 5HMLA 3ZW8A 1WU8A 1PK8A 4HNAA 3ZHUA 4IQ4A 3IEMA 3VR2A 3U40A 4YMIA 5CX4A 1KGDA 1RQGA 4Z0PA 1J97A 2GDJA 1FMCA 2X7HA 2VWQA 5CAEB 4CKBB 5BNTA 1U3DA 5D3MB 4FSHA 5BN3A 1VCHA 3OEEA 5F73A 5JI3E 5JJCA 4KQWA 5HGJA 3I6QA 5FQOA 3HR4A 2YS7A 4PTYA 2XXAB 3EIWA 3OZEA 5IF3A 4HGOA 2FW9A 2YV2A 1J8YF 3UUFA 3HQ4O 3LF1A 3HBMA 5EHXA 1HZZA 2B8EA 5EJIA 2P6RA 1BXRB 3G8BA 4TZ6A 2FPKA 4BP1A 4DIOA 3DOCA 3B9RA 4AJ9A 2FWNA 3E9NA 1VYUA 3CLVA 4LY9A 4YMGA 2RGCA 3JWIA 3I9LA 1HRKA 2ZB7A 3AFOA 2P9JA 2C9BA 2V7XA 4WOBA 1SUSA 1VMAA 1RQNA 2RI0A 2XLBA 4JKOA 3SIXA 5DNUA 1HDCA 3L0YA 1E59A 2X8BA 2B82A 4HDOB 4WKOA 3WGZA 2XCRB 1OE0A 3HKBB 1F4PA 4UARA 4B34A 4NNOA 3ZVRA 3BIWA 2XR1A 4GVLA 2QJTA 1B2LA 2F1IA 4QO8A 4OHMA 4W82A 5KTSA 3COPA 4RJKA 1PGPA 3PE3A 3CGGA 4YYZA 3C1UA 3DFIA 3LYAA 2G80A 3M3HA 2VP4A 5K0FA 4QIHA 1C2YA 1FP2A 1S1MA 1T9ZA 1CQJA 3QUBA 4O2AB 3A2KA 2FZ5A 2ADMA 4HQ6A 1CY7A 2Y76A 4C4AA 5FWAA 3O6VA 3K0FB 1WE2A 1YZ3A 3H99A 4YJ2F 1QRRA 4J2TA 1T2EA 5J1SB 1KI2A 1QB7A 4EO7A 1NIJA 2O05A 3MERA 2P4SA 4NY1A 4UE6A 1M75A 1AT1A 1NF9A 1I2DA 2PGXA 3MAJA 1JHMA 1X14A 2AW3A 4NHEA 4E1VA 1OZ0A 5CA1F 5C2JB 1QBKC 3RSCA 2CT8A 3H9UA 1A9YA 5IUKC 1OX5A 3HA7A 3OBIA 4MPJA 1BDIA 3D1VA 1C1XA 1BNCA 3LUHA 3QFTA 4M49A 4YWHA 4ALMA 4D9KA 1VB5A 2VPPA 3GZTB 3HPRA 3W5SA 4EPRA 3FKSD 1BX3A 2FMFA 1XHLA 3P4XA 1AZTA 1AGRA 1TCAA 1B00A 5AW0A 5FXMA 4F97A 4LE2A 5EUCA 3D31A 4LYFA 3KLNA 3TJMA 3GR6A 3AIMA 5BRAA 4OQNA 5ELXA 3BWCA 2OBLA 2QD1A 2ZBVA 3PXEA 2RGUA 3LBNA 4KFTA 1H2HA 1QIJA 3FMFA 1FX1A 1NPDA 3EIQA 2ID9A 4DJDC 5DLPA 4K6KA 3GLUA 1GADO 4PS0A 3V55A 3OZAA 5A1JA 1ZZGA 1GY8A 3AHJA 1OTHA 4Z9YA 5IS2A 4OGFA 1HTBA 1I0IA 5D5QA 4FJ1A 3VTKA 4DG9A 4DUPA 3GFSA 3UO8B 2FSIA 3U9LA 4MCIA 1MAVA 1F12A 4GWGA 4LEIA 5BORA 1TK3A 1UFRA 4NZOA 2XGJA 3U3ZA 5KQSA 3LKDA 1N9GB 1LPBB 3MCZA 6YASA 3HUUA 1KP2A 1CV2A 1AQJA 2NO0A 2MWMA 1LQTA 2D1TA 3R5TA 4PHHA 4XIYA 4BV3A 4YJ2A 2ZAMA 4KLAA 3CX8A 4U2DA 4UCXA 3PS9A 2NO9A 2RH8A 2VPIA 2FLKA 2HK9A 3CXRA 5HM6A 1BS2A 1XJWA 3QF7A 1HA3A 4OUDA 2BGGA 1OLSA 4YDQA 4K5QA 3QQPA 4U6SA 3MZ0A 3SM3A 3E82A 3TDKA 3ZWNA 2YKGA 5LQSA 1SU4A 3KQSA 3BYZA 3P26A 4PZPA 1XELA 3N9IA 4PSAA 4FDAA 4XGKA 1SU6A 5TQJA 3ZGVA 3AF6A 1K5HA 2PX3A 1HG0A 1OBVA 3CZ5A 2ZRNA 1YDMA 3E53A 4BNIA 1ZR2A 2HYIC 1S2DA 2ZSEA 5JFOA 2GKSA 3U4IA 3UJDA 1XNQB 4AD8A 1HQYE 1HUQA 3B2NA 3DV0B 3S2YA 3ZHBA 3CVVA 3KOZA 3I6YA 3NOQA 3OOEA 1H0KA 2GZAA 4JLPA 4GM4A 5EOVA 4QKQA 1RAIA 3WO0A 4ZMBA 3WYBA 4CQMB 5F7XA 1Q7TA 3PNVA 1TKAA 5FA8A 2QM3A 2EL7A 3UWKA 4B4WA 4PLGA 3WZMA 4Q1VA 3EIHA 1B74A 4UEJA 4HB3A 5AUNB 2DJIA 3F2VA 3DBRA 2QQEA 2W2KB 1V5FA 5KDDA 2BM8A 3FCYA 3FY4A 1M5UA 3WL7A 3L8HA 2JGNA 4LI0A 3V3KA 3S40A 2ODAA 4CM4B 2NSDA 1OLXA 1QYDA 4BNZA 4W5RA 3RYIB 4NLLA 1CETA 4E09A 3KXIA 2R3SA 4H7FA 5DOVA 2V58A 1NUSA 1RI3A 2YXLA 3DC7A 2G9NA 4B74A 2XNCA 3L7LA 2ZCVA 4MS4A 1N2GA 5FOTA 2UVQA 1JBEA 1LV7A 2ZJAA 4K88A 3SU8A 4A26A 2X4IA 3L5OA 4DUGD 1ICIA 1VM6A 1KETA 3GJ4A 5I7OA 2X0RA 1NPTO 1M5TA 1NNUA 4AJEA 2BR5A 2A2ZA 2WT4A 4NBRA 3DULA 2I1WA 3RUHA 1KVQA 3CVXA 5EZSA 2WJ3A 2GT1A 4TKVB 1SQ6A 4DAOA 4EB6A 1PFQA 3M6XA 1CJTC 4RPLA 2CSUA 2ZE6A 5KO2A 1EK5A 1XRMA 2B1IA 3C1AA 2WKWA 3K2QA 1TPYA 2JA1A 3DBVO 3PT5A 4JVSB 1V6CA 3V2IA 3ICQB 4TT3D 4D9GA 1ONSA 5HKKD 5LWHA 1LJUA 4PYRA 4ROTA 5J2TB 1FA9A 1ISRA 4QASA 5AIBA 1QOPB 1Y33E 2W6PA 5JZVA 1JWAB 5K3EA 1HFEL 2RH4A 6GPBA 2P9HA 1UOOA 3VPCA 3RK4A 4AKIA 3DE1X 1YJ5A 3JAKA 1D07A 5F5XA 3RVSA 1C4WA 4XWWA 4YCAA 1QR6A 3DYVA 4MOWA 2GX6A 4OHXA 1EA5A 4JXKA 1VE7A 3R7WB 4D74A 5JAMA 1ADFA 3G2PA 3NJ8A 2UYYA 1QIKA 4KYTA 4UNIA 4X41A 2XNSA 2VHXA 1KQNA 4CCYA 2Y0CA 4FE7A 3DGFC 4Y18A 5I4BA 2EWMA 5JSYA 4AZ0A 5JBQA 2WAMA 5BSKA 1YRWA 1FDIA 5KYGA 4A91A 2ZP1A 3PL5A 3RGWS 3HO8A 5HE9A 1UODA 1FEZA 3X1JA 1J22A 1PT6A 4CTJA 3IV6A 4UMVA 2ONJA 2CUKA 4C3ZA 4LOLA 5IASA 4ZKDA 4H3HB 3T94A 2G17A 2JB9A 4L78A 3WADA 3DLCA 4FOSA 4MQBA 1ODTC 3O3CA 4Z0HO 4TRJA 3ASZA 2ID7A 2JVKA 3ENWA 4L02A 4YT2A 2XCTB 3TTYA 1IEXA 3UJCA 3TW8B 4U9UA 3DL2A 1N6NA 1JVNA 3L4JA 2BEWA 2QAJA 1IXYA 2ZRLA 2LV8A 4G5OA 2JHAA 3E3NA 2VZ9A 4Y6LA 2GDZA 2ZWPA 1EYZA 1Z7WA 2YZKA 5IBPA 1L5GB 4CU5A 5J4VA 3ZLJA 5C51B 2PUDA 1I3CA 3TEMA 3U7RA 4ZVTA 1CY8A 3OCYA 1OLOA 3FPEA 4LNAA 4JT4A 3ZQJA 2QZJA 3KDAA 5AHKA 1GAJA 1E0SA 3OQ1A 1EVLA 5LB2A 4XJVA 2WMYA 3RS7A 3TIGA 3PCTA 1USGA 3BBLA 4Q4HA 2XITA 3TOVA 5LQDA 2FWJA 5JATA 2COEA 4I08A 2F48A 4IEEA 1YRLA 2ZRBA 5COAA 2CSXA 2OZPA 1XCMA 4EHLA 4MV9A 2PUWA 3BTSA 5GZ6A 2NXCA 2HDNB 1K75A 1KAMA 1NP3A 1FSZA 1W1WA 2LNDA 1SHKA 3D6TB 4N49A 2WVHA 3ZYZA 3HA2A 3RDPA 4PCVA 1F9EA 5CDUA 1CEEA 3OY2A 2W90A 4LJRA 2RGDA 3EHEA 3TEJA 1UDBA 1KK1A 4RK5A 4BGIA 1QFJA 2WYOA 3O8LA 4Z9FA 2ONZA 3BZUA 3ZJVA 1EP2B 1RLMA 2A4MA 2B3TA 4Q1AA 4W5HA 2E5FA 4UEKA 4Z9AA 3X44A 1RD4A 2ZWMA 4DQXA 2XRYA 4PN3A 1TMOA 1IOZA 4FLEA 4MK4A 1G21E 3MJFA 2M98A 3O2NA 3VMFA 1WZNA 3KKPA 4HUQB 1QIHA 5KTKA 2LDBA 4QEKA 2OV8A 2Q46A 1FMLA 1Z34A 3FJYA 1G2QA 1GQ2A 2R6ZA 4WCVA 2WHYA 4HOYA 2FKNA 4I99A 1DEOA 4BFTA 1RHUA 2WB2A 4HVCA 4HRVA 5DMXA 3WZLA 2IJGX 2ZXFA 3B20A 4IV0A 2A1TS 4ZO7A 3QF4A 2P40A 4S1TA 2ODBA 1GRVA 1FTGA 2X15A 4OH1A 4ZO8A 1O6CA 1QV9A 3CR7A 3WK9A 2O4CA 3JVDA 3NDIA 3WP0A 1YVUA 1ZX1A 4WJKB 2BPOA 4ZQBA 1HE5A 4C2UA 3EWAA 3E22A 3TLYA 1TX4B 4M55A 3UKDA 5BN4A 3KQLA 2A7XA 3A37A 4BMXA 3MB5A 2VZ8A 4MJXA 4ZU1X 2XUZA 2QTTA 3DMTA 3Q98A 5C31A 5AUPB 4I5FA 4H0CA 3PEEA 3LMKA 1PJBA 5IJAA 3AHDA 1WNFA 1Z68A 5ARBA 2F55A 4DARA 4RDIA 2BN4A 4U7GA 3DLIA 3HKDA 3B12A 4FTWA 5F9HA 3RC3A 2ZSKA 4IDCA 4DA4A 3QRWA 4IIJA 3CKMA 3HP7A 2ODWA 2PS0A 2WYVA 3SKVA 4YMSA 2CNKA 3FFWA 5KDLA 1E5VA 3MELA 4C4PA 4Y2YA 2XB6A 1KKUA 3E3AA 4TMTA 1YJQA 2W98A 4UW9A 1WHSB 1AK2A 1QIGA 2C1EA 3QENA 2GUGA 5E6UB 1AQLA 4P0TA 4HGQA 4BRSA 3CX3A 1QORA 3EQ6A 3GLTA 5NULA 4P3KA 2HUNA 2W37A 2WP8J 4YMLA 1P3Y1 3K09A 3QMWA 5BN1A 1MT3A 1GZSA 2O2GA 5A5DA 3RNOA 1CJUC 1O9GA 1RQLA 2IPLA 3IXQA 3PENA 5JS2A 1LA2A 4RVGA 4JQZA 2HA0A 4QFCA 1BCRB 3V1KA 2HN9A 1BU5A 3CSSA 2IYUA 4XM2A 2BI8A 1TMKA 2E21A 2JD0A 4B6PA 3MBOA 4E5MA 4RHCA 2JCYA 5B37A 2H1OA 1QG2A 1SUPA 4QBTA 4PCUA 4Y6OA 3H9BA 1EU1A 4TVSA 2JASA 3FUXA 4KW7A 2DWCA 1X7XA 1CEXA 4ALNA 3DZBA 3ZDXB 5DN6A 3N6RA 3I73A 4IVQA 5A03A 2CD7A 3AY3A 2HPVA 2X8LA 1QHGA 3H0CA 3UATA 3VR4H 4BECA 3CHYA 5IT5A 1DEAA 2JHPA 2GZ1A 2V7WA 3GVHA 3JALB 4M7WA 4N0EA 3ITNA 4WECA 5LR6A 4XAQA 4PZDA 5FUYA 3FDZA 1WM1A 2EG9A 4A36A 3CUTA 4BMYA 1MABA 4WVLA 3AVWA 3AJEA 1I0LA 3CVOA 3L6DA 3F2IA 2DUNA 2NXJA 1E3IA 3L01A 4I1SA 4RHEA 2FN3A 3K31A 2GBGA 3GP8A 2MR5A 4O2AF 1JQKA 5FL7D 3OX1A 3Q3JB 3KYDA 4F4DA 1NA5A 2P65A 4MR9A 3CE9A 3CVUA 3HTXA 2G83A 2PYIA 2XNHA 5C5DA 3NETA 1CRZA 3TRHA 4C1BA 4OXRA 3IP9A 3CCCA 2C7OA 3UJ3X 3LTNC 1NAIA 4TVBA 2Z1NA 4JC5A 2JGIA 1CR6A 2QXTA 4EUHA 2ISSD 3D6HA 2QUKA 1X3SA 4G67A 2RB5A 1YFKA 3LSYA 3R5JA 4I1UA 1UM9A 1H23A 2HQSA 2R2GA 5BQXA 4WKCA 4DR3B 2PANA 3BXFA 4GYKA 1YQQA 2WSSD 3OCVA 5SZIA 4H31A 4RA9A 4FINA 1W73A 2IZ0A 4Q15A 1W29A 1Q1QA 3F1KA 5JNWA 2VJMA 2Z5VA 3QPAA 3QVXA 1P5JA 1Q1GA 3ZBPA 2WTEA 4XWAA 3GH3A 5EWLB 1T5LA 1TTHA 5J5VA 4BNMA 1L7VC 3IMFA 3RROA 5JMOA 2O0MA 3K1TA 3DMTC 3JQ6A 1ZIXA 3EH1A 2NVUA 2XQVA 5JWHA 3TLGB 1N0HA 5DHPA 4ALIA 4CDGA 5F9FA 3ZE6A 1QXSA 4RE6A 1KQOA 3UIEA 1RWXA 1BN6A 1WDTA 2NT4A 2LVBA 3EPRA 3F96A 4JZYA 5CT8A 3OHMA 4UNPA 4DIUA 3LBYA 3S44A 1V25A 5IVIA 1Y63A 3OX2A 4JU9A 3A32A 4L50A 2JFWA 4TQGA 4DUGA 4MW9A 2R00C 4AZSA 2ZRGA 4IH9A 1R1DA 1USWA 2YQ4A 1F17A 2ZTUA 3GDWA 1RPZA 2FQWA 4ZTZB 5L3RA 2O2DA 2XX3A 1JKFA 4O5OA 5GINE 5L6MB 3KHUA 1VMIA 4R8VA 1IHXA 1XTKA 5JE8A 1WS6A 2B1JA 2REQB 3NWPA 2XKBA 4D8XA 3TF5A 3HJGA 3FNRA 1MIOA 3UB2A 4UM8B 1UK8A 1UUFA 4DIFA 1P1FA 4L4XA 1FQWA 1JQBA 2ECQA 2XYRA 3HCFA 2H59A 4GLLA 4I9NA 4Y2RA 2V54A 1DAGA 5CTJA 1JHDA 5DEIA 4YRJA 1Q7GA 4HGRA 4LMPA 3HHPA 4Q1FA 4GDMA 5KVVA 1PR0A 3EF3A 4RH1A 5L4SA 1N5OX 1ZITA 4MVJH 5AKXA 4R71A 4KC0A 2AGVA 1TKCA 2JGKA 3BWMA 4NNJA 4D4LA 1QPBA 4IINA 2O2EA 4KCGA 3B6MA 4HPXB 4KMRA 5H80A 3VR3D 1KBOA 1MKYA 1FNDA 1KIAA 3RRNA 3LF2A 3SMVA 4KR6A 3QFHA 2ARKA 3NBUA 1R4MA 3A31A 3P9SA 2WHEA 3FPGA 2RGGA 4IIXA 2EZUA 3KB6A 3Q2OA 5HHTA 1Y7PA 3OLWA 4PO1A 4DWWA 3H9CA 2FJPA 2M6SA 3GAAA 4HNSA 1N8NA 5CPBA 1JHYA 1OXMA 1P1JA 2PGJA 1C2TA 1IYZA 3X2FA 4C0KA 1QYCA 4DLYA 5J4HA 1NVGA 1IWPB 1GFIA 3X0DA 3FNEA 5ILQA 3WNVA 2AOTA 2H7XA 1GGVA 4QOJA 1G2OA 3ZUGA 3B3QA 1W48A 4HDSA 1DRKA 1U7OA 3M33A 3QF4B 2OCKA 4ISCA 1QC5B 3WLMA 1ZM7A 3JVVA 3F67A 3AHGA 3DTVD 4CIDA 1W4AA 4ANFA 1ESNA 4CIVA 3I5MA 3VA7A 1YH3A 4R1NA 5REQA 4CT4B 3PYXA 4GLBA 5BR8B 1BXKA 2WVJA 3CKYA 5K8IA 3O4RA 2QMHA 4W1SA 1JV2B 3LD9A 3QA3E 3KL4A 1YHYA 4NMXB 3OPNA 3W9YA 4BFYA 1IY0A 4H6WA 3NH9A 4PZ0A 4EF5A 1PJRA 3D6UA 1XXHB 4D2IA 3ME5A 3HDQA 1BJKA 4XASA 5HEKA 4QM7A 2BHNA 2G09A 3ZGXA 4DY6A 4GZ5A 1K6JA 3DVRX 3IRUA 2ZJ2A 3A1DA 4H9GA 4K9OA 1JTEA 1KH1A 2IHBA 4XIIA 5SYAA 4PNEA 3MJ4A 2IW3A 3FB1A 2J0VA 1TCUA 3T7JA 3QGMA 1GTZA 1B16A 2WT8A 3A58B 1C3OA 2AHOA 4QC2A 4UTXA 2BV3A 3SQLA 1IBSA 3UB4A 2H3EA 5IN4A 1XT6A 4TS3A 5D6NA 1CQIA 3WBBA 4JLWA 4MI3A 1M6EX 4QTUB 3SX0A 1PNQA 2RBEA 3ORSA 4P81A 5KOIA 4ILEA 4ZREA 2XA2A 4FFLA 1JHQA 4QSHA 2IYXA 2E4AA 2P9YA 5JDCA 5MN5A 3UOWA 2WJAA 2C7PA 4X1IA 2HDWA 1UT8A 3BS4A 2XW6A 1G291 3AF5A 2ZT6A 1NP6A 5AVUA 3RYHA 4LSGA 4UC0A 3DDHA 1KJWA 5AVJA 5BNFA 4BTEA 1V16A 2MR6A 4QFDA 1A69A 3TGPA 1E3DA 2Z5LA 3SXJA 2XKJE 2IYTA 4HP8A 3IO5A 4ZFNA 4D0NA 1XZNA 3TRJA 4B7AA 1LRLA 1Z15A 2BMEA 3TL3A 2UV8A 2KLBA 2A9OA 1QU3A 1T10A 3PQ7A 3QXHA 1XEXB 2CF6A 1RABA 3PVCA 1RYZA 1T5OA 1Z6ZA 2H5EA 2HMAA 3WS7A 1VPEA 2VCHA 4BO8A 3CF0A 4DQDA 5JJ5A 2M32A 3IAAA 4RJLA 2FUCA 5ICSA 1B6TA 2H52A 2PY6A 3D7LA 3KSRA 4IJWA 1ATIA 4ZAVA 4R8KA 1N5DA 2HUPA 4ARCA 2O2XA 3FFTA 4L08A 4U63A 4V03A 5DHQA 3BA6A 1JXOA 2JAXA 4OM8A 5EJMA 3WBKA 1VP3A 3OG9A 3WWCA 1LQUA 2L18A 3QBVA 4HHEA 4A03A 1VHJA 2F3UA 2IRWA 1NOJA 2ZU6A 1CZRA 5K03A 2JGMA 4YCMA 5HUQA 4LXIA 1FU4A 1K08A 3PGLA 4F3YA 2MSWA 5FI3A 4EITA 4TLLB 2V9CA 4Y2UA 4LZWA 2W2OA 1XU7A 2NZXA 2W71A 4U6NA 1RWVA 3GGDA 4S1WA 5A3SA 4CMEA 4DWJA 3U19A 1I4TD 2I66A 2C5LA 4WT7A 1DHRA 3DLPX 4H16A 1M2GA 1AKTA 2QVBA 3KZOA 4XJSA 4XQ0A 5DNWA 4BV8A 2WM9B 2NIPA 4ZODA 4TROA 1OV4A 3HGTA 1P45A 3OE1A 1YZNA 2WU4A 1W30A 3EEQA 1NUTA 4B75A 3OMXA 4Y6RA 1U8EA 2CDAA 2ZR9A 2FMHA 1BTOA 4GX0A 4Y1FA 3C5HA 3QOXA 5ERYA 4ENTA 2NZYA 4W5OA 2GBPA 3JVIA 3AO0B 3CEHA 4IH1A 5FORA 4PV7A 2WLSA 1ESEA 1QDLB 3HA3A 1VCOA 1F2TA 1VJTA 3QSYA 5KYVA 2Y99A 2X0JA 1MAUA 1RJEA 3AV3A 2PS1A 4GMKA 1VJ1A 1ZONA 3A1TA 3WQSB 3I5AA 5C52B 2OCLA 4EA9A 1EWTA 4IIJF 5K3OA 2J3LA 2C3YA 1PR5A 4EDHA 1XWFA 4Q1EA 4M83A 2NM0A 1SG9A 3CJTA 1TAQA 2IXAA 3OETA 3VYVA 3V8NA 1K3FA 4QGGA 2IL1A 1E3MA 3VTFA 3BRQA 3JQ8A 1PX0A 3PLRA 4WFJA 1CLEA 3LZCA 2WOOA 1WETA 3QKRA 2OFPA 3GWZA 3RIHA 3NI2A 4F2PA 3KG2A 3KSUA 1BYUA 1YR3A 2Q5FA 3KOXA 1NDHA 2ZUTA 4G1BA 3UWPA 3IUYA 1MA0A 1Y9JA 2W7TA 4C30A 1RPAA 4E7OA 1V16B 6PFKA 3MSCA 5B2FA 5H9VA 1WBDA 3PJRA 2MT9A 1NUAA 2P9CA 2WAAA 3E9ZA 4RZXA 1GPWB 4IMRA 3HR7A 2A5LA 3JXEA 3CLRD 3NHBA 4HDQB 4FM9A 4OIFA 3ZWYA 4E88A 2C20A 2WFAA 1ZGCA 1M34A 4MVJI 3TLCA 4DA9A 3MRTA 4N6OA 1DBPA 1FMJA 2EX4A 5LQRA 3DLHA 2BISA 1J1IA 3QWFA 5LD2C 4IVNA 4NCIA 3C8DA 4M0DA 5IZ4A 2FOLA 1R3DA 2FPPB 4HMOA 1KOLA 1XU9A 2Q29A 2QNRA 4M9UA 5EJ4A 2IKQA 2R8RA 1JTFA 4RKFA 4K6FA 3TB6A 1GYPA 2H16A 5KEIA 2WUVA 1GZDA 1GWNA 5TDHA 4R2IA