3SSHA

Engineered high-affinity halide-binding protein derived from yfp: chloride complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
236
structure length
231
Chain Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMRQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYAQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Determination of engineered chloride-binding site structures in fluorescent proteins reveals principles of halide recognition
rcsb
source organism Aequorea victoria
molecule tags Halide binding protein
total genus 59
structure length 231
sequence length 236
ec nomenclature
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sshA00
1XMZA 4W6UA 2Q6PA 2GX2A 2POXA 2A48A 3LF3A 4H47A 5EB7A 2GW3A 3U0LA 1RRXA 3DQ4A 3DQMA 4W6LA 2AWMA 3PJBA 2ZO6A 1JBZA 4P1QA 5DQMA 5LTQA 2G3OA 5EB6A 2PXSA 1Q4EA 4PPLA 5FVGA 1MYWA 4ZF5A 2WHTA 1UISA 4HVFA 3SVRA 2H8QA 4AS8A 4UTSA 1GL4A 1RMMA 2GW4B 5HZSA 4ZFSA 4ORNA 3DQCA 5HZOA 2A52B 2IE2A 3ZUJA 4OHSA 4Z4KA 3CGLA 1Q4CA 3ST2A 4EDOA 1KP5A 1YHHA 4PPJA 1B9CA 4W6PA 4RYWA 3IR8A 4JRBA 3U8AA 1RM9A 3E5WA 4HQ8A 3EVVA 4IZNA 3RWAA 3DQNA 3EVPA 3SG5A 3SVUA 1EMCA 3GEXA 4OGSA 2ICRA 1OXDA 1QYQA 2C9IA 3DQFA 3WCKA 4ANJA 3SVOA 4IK9A 3NEZA 3VICA 5BTTA 5DU0A 3EKHA 3VHTA 3DPWA 2QLGA 3O77A 3BXCA 4W72A 3DPXA 1W7UA 3EK7A 4RTCA 3KCSA 1MOUA 2AWJA 3G9AA 1JBYA 3DQ6A 2G6YA 5H89A 3DQ7A 3NF0A 3BXAA 2QRFA 4R6BA 4KW9A 1G7KA 3EKJA 4RYSA 4DXPA 3OSRA 4OQWA 1YZWA 1JC1A 3ADFA 3IP2A 2HPWA 4W69A 2G16B 2G6XA 4W77A 4IK5A 4IK3A 1YJFA 5EJUA 4W6CA 2QLIA 1H4UA 4BDUA 4J8AA 4U2VA 2ZMUA 1Q4DA 1OXEA 5H87A 5DY6A 4H48A 4ZIOA 2O24A 3SVDA 5HW9A 3NT9A 2H6VA 3DQOA 4JEOA 3TMTA 1ZUXA 5HBDA 2Z6YA 3W1CA 1YHGA 4HQ9A 3ZUFA 3AI4A 1QYFA 2HQZA 3OGOA 3DQJA 1QYOA 4EN1A 2ARLA 4DXOA 4N3DA 2QLHA 4OY4A 2V4EC 2V4EB 2OKYA 4PPKA 5FVIA 3ST3A 1Z1PA 5DQBA 4W7AA 3E5TA 2HGYA 3I19A 4TZAA 4ZBLA 2H5RA 3V3DA 3TMRA 2VAEA 3A8SA 5DTLA 4B5YA 3K1KA 2OKWA 4OJ0A 5DPGA 2O29A 1JC0A 2AH8A 3VK1A 3SRYA 2EMOA 4W6HA 1H6RA 4KW4A 5HZTA 5EXBA 2H5QA 3WLCA 4W6GA 4KEXA 5EXCI 3DQEA 3DQUA 4XL5A 4JGEA 4KF5C 5FVFA 2ZO7A 1RMOA 2DD9A 2OJKA 2DD7A 3CD9A 3U8PA 3SSLA 3SSPA 3DQIA 3WLDA 3LVDA 3SS0A 2OTBA 4W6NA 4W6KA 3SSYA 2P4MA 2Q57A 4LJDA 4W7RA 4LJBA 5DPJA 3GJ2A 3PJ5A 4W6MA 3M24A 1Q4AA 3M22A 3W1DA 2VVHA 4W6OA 4JFGA 3SV5A 1EMMA 4ZF3A 2DUHA 4H3LA 3PIBA 4W7DA 3O78A 5EHUA 3SVBA 3U8CA 2AWLA 3DPZA 3ZTFA 1YJ2A 3SSVA 3ST0A 4LQUA 4Q7UA 3ZULA 2VVJA 4EMQA 1KYSA 5DTZA 1GFLA 2YE0A 1BFPA 4KGEA 5F9GA 2YDZA 4Q9WA 3SSKA 2WURA 2BTJA 5HZUA 2IB5A 3SG4A 4AR7A 1KYPA 1ZGOA 1ZGPA 4B30A 3UG0A 1GGXA 3E5VA 2YE1A 3EVUA 4L1IA 2G3DB 1QY3A 3SSHA 4ZINA 3DQLA 4XGYA 3CD1A 2B3QA 4W7XA 4IK1A 3DQ8A 3H1OA 4W7FA 2HJOA 2QT2A 2HRSA 5BTTB 3DQ9A 3U0NA 4GF6B 3VHTB 5DPIA 2QLGB 2OGRA 4HE4A 3LF4B 2VVIA 3DQ5A 3GJ1A 5LK4A 1MOVA 4KF4A 2IB6A 5DTXA 4Q7TA 3LS3A 4DXMA 4EDSA 4DXIA 4LQTA 4W7CA 1HCJA 3SVSA 5EXUA 1XQMA 2HQKA 3AI5A 1EMEA 1CV7A 3SG2A 1YHIA 4W76A 2RH7A 3EK8A 4I2YA 2DUGA 2DDCA 2Z6XA 4L12A 3CBEA 2DUIA 1W7TA 4GESB 3OSQA 3LSAA 1F09A 2WSNA 2WISA 4W6JA 4Z4MA 4L13A 2YFPA 2A47A 2VZXA 3BX9A 2IOVA 5BT0A 3DQDA 3DQKA 1S6ZA 5DTYA 4KF5A 5DRFA 3CFFA 2AHAA 4W6BA 2EMNA 3DQ3A 4J88A 3CB9A 1EMKA 3U0KA 2DDDA 2WHUA 4ZB1A 2H5OA 5LTPA 4W73A 4KA9A 3ST4A 2A46A 4TZGA 3CFHA 1Q73A 1EMGA 2HFCA 3GB3A 3SVCA 4KW8A 4W6DA 3DQ2A 4HQCA 4PFEA 5BQLA 3S05A 1QXTA 5H88A 2AWKA 2G5ZB 1YFPA 3H1RA 3SG6A 2A56B 4R6DA 3ED8A 2FZUA 2JADA 3DQAA 4IK4A 4LW5A 4EULA 4W74A 2HGDA 2VADA 3KCTA 2OTEA 2Z6ZA 1RMPA 2H9WA 1HUYA 3CFAA 1ZGQA 4LJDC 2O2BA 4IK8A 4KPIA 3DQHA 2WSOA 1OXFA 4DKMA 1Q4BA 4W6RA 1KYRA 3LA1A 2A50B 2B3PA 4LJCA 4JC2A 4P76A 5AQBB 4W6FA 5EBJA 4KAGA 2GX0A 4JF9A 4Q9XA 1XA9A 3LVCA 4XVPA 3SVEA 5HGEA 5FHVA 2A54B 2WIQA 3BXBA 4DKNA 1C4FA 3EVRA 2Z1OA 3EK4A 5KTGA 4J89A 4H3MA 4W7EA 2A53B 3LVAA 2HCGA 4ZF4A 4W6IA 2QU1A 2QLEA 2Y0GA 4W6AA 4B30B 3SG7A 2G2SB 2PXWA 2EMDA 3AKOA 3SSTA 3P8UA 2QZ0A 1W7SA 5DRGA 3U0MA 1EMLA 1EMBA 4Q7RA 4DXNA 1XAEA 2V4EA 4W6TA 4XOWA 3SVNA 4GOBA 2ZMWA 2FL1A 3UFZA 1EMAA 4W75A 2DUFA 2H5PA 4H3NA 1Z1QA 4DXQA 2G6EA 5DPHA 5T3IA 3MGFA 4W6SA 4NWSA 3SG3A 1XSSA 2FWQA 1F0BA 3NEDA 4XOVA 3DQ1A 3GL4A 1EMFA 3NT3A 5LTRA 2C9JA 5J2OA 3P28A 4KGFA 2WHSA 3RWTA 3PJ7A 2DUEA
chains in the Genus database with same CATH superfamily
1XMZA 4W6UA 2Q6PA 2GX2A 2POXA 2A48A 3LF3A 4H47A 5EB7A 2GW3A 3U0LA 1RRXA 3DQ4A 3DQMA 4W6LA 2AWMA 3PJBA 2ZO6A 1JBZA 4P1QA 5DQMA 5LTQA 2G3OA 5EB6A 2PXSA 1Q4EA 4PPLA 5FVGA 1MYWA 4ZF5A 2WHTA 1UISA 4HVFA 3SVRA 2H8QA 4AS8A 4UTSA 1GL4A 1RMMA 2GW4B 5HZSA 4ZFSA 4ORNA 3DQCA 5HZOA 2A52B 2IE2A 3ZUJA 4OHSA 4Z4KA 3CGLA 1Q4CA 3ST2A 4EDOA 1KP5A 1YHHA 4PPJA 1B9CA 4W6PA 4RYWA 3IR8A 4JRBA 3U8AA 1RM9A 3E5WA 4HQ8A 3EVVA 4IZNA 3RWAA 3DQNA 3EVPA 3SG5A 3SVUA 1EMCA 3GEXA 4OGSA 2ICRA 1OXDA 1QYQA 2C9IA 3DQFA 3WCKA 4ANJA 3SVOA 4IK9A 3NEZA 3VICA 5BTTA 5DU0A 3EKHA 3VHTA 3DPWA 2QLGA 3O77A 3BXCA 4W72A 3DPXA 1W7UA 3EK7A 4RTCA 3KCSA 1MOUA 2AWJA 3G9AA 1JBYA 3DQ6A 2G6YA 5H89A 3DQ7A 3NF0A 3BXAA 2QRFA 4R6BA 4KW9A 1G7KA 3EKJA 4RYSA 4DXPA 3OSRA 4OQWA 1YZWA 1JC1A 3ADFA 3IP2A 2HPWA 4W69A 2G16B 2G6XA 4W77A 4IK5A 4IK3A 1YJFA 5EJUA 4W6CA 2QLIA 1H4UA 4BDUA 4J8AA 4U2VA 2ZMUA 1Q4DA 1OXEA 5H87A 5DY6A 4H48A 4ZIOA 2O24A 3SVDA 5HW9A 3NT9A 2H6VA 3DQOA 4JEOA 3TMTA 1ZUXA 5HBDA 2Z6YA 3W1CA 1YHGA 4HQ9A 3ZUFA 3AI4A 1QYFA 2HQZA 3OGOA 3DQJA 1QYOA 4EN1A 2ARLA 4DXOA 4N3DA 2QLHA 4OY4A 2V4EC 2V4EB 2OKYA 4PPKA 5FVIA 3ST3A 1Z1PA 5DQBA 4W7AA 3E5TA 2HGYA 3I19A 4TZAA 4ZBLA 2H5RA 3V3DA 3TMRA 2VAEA 3A8SA 5DTLA 4B5YA 3K1KA 2OKWA 4OJ0A 5DPGA 2O29A 1JC0A 2AH8A 3VK1A 3SRYA 2EMOA 4W6HA 1H6RA 4KW4A 5HZTA 5EXBA 2H5QA 3WLCA 4W6GA 4KEXA 5EXCI 3DQEA 3DQUA 4XL5A 4JGEA 4KF5C 5FVFA 2ZO7A 1RMOA 2DD9A 2OJKA 2DD7A 3CD9A 3U8PA 3SSLA 3SSPA 3DQIA 3WLDA 3LVDA 3SS0A 2OTBA 4W6NA 4W6KA 3SSYA 2P4MA 2Q57A 4LJDA 4W7RA 4LJBA 5DPJA 3GJ2A 3PJ5A 4W6MA 3M24A 1Q4AA 3M22A 3W1DA 2VVHA 4W6OA 4JFGA 3SV5A 1EMMA 4ZF3A 2DUHA 4H3LA 3PIBA 4W7DA 3O78A 5EHUA 3SVBA 3U8CA 2AWLA 3DPZA 3ZTFA 1YJ2A 3SSVA 3ST0A 4LQUA 4Q7UA 3ZULA 2VVJA 4EMQA 1KYSA 5DTZA 1GFLA 2YE0A 1BFPA 4KGEA 5F9GA 2YDZA 4Q9WA 3SSKA 2WURA 2BTJA 5HZUA 2IB5A 3SG4A 4AR7A 1KYPA 1ZGOA 1ZGPA 4B30A 3UG0A 1GGXA 3E5VA 2YE1A 3EVUA 4L1IA 2G3DB 1QY3A 3SSHA 4ZINA 3DQLA 4XGYA 3CD1A 2B3QA 4W7XA 4IK1A 3DQ8A 3H1OA 4W7FA 2HJOA 2QT2A 2HRSA 5BTTB 3DQ9A 3U0NA 4GF6B 3VHTB 5DPIA 2QLGB 2OGRA 4HE4A 3LF4B 2VVIA 3DQ5A 3GJ1A 5LK4A 1MOVA 4KF4A 2IB6A 5DTXA 4Q7TA 3LS3A 4DXMA 4EDSA 4DXIA 4LQTA 4W7CA 1HCJA 3SVSA 5EXUA 1XQMA 2HQKA 3AI5A 1EMEA 1CV7A 3SG2A 1YHIA 4W76A 2RH7A 3EK8A 4I2YA 2DUGA 2DDCA 2Z6XA 4L12A 3CBEA 2DUIA 1W7TA 4GESB 3OSQA 3LSAA 1F09A 2WSNA 2WISA 4W6JA 4Z4MA 4L13A 2YFPA 2A47A 2VZXA 3BX9A 2IOVA 5BT0A 3DQDA 3DQKA 1S6ZA 5DTYA 4KF5A 5DRFA 3CFFA 2AHAA 4W6BA 2EMNA 3DQ3A 4J88A 3CB9A 1EMKA 3U0KA 2DDDA 2WHUA 4ZB1A 2H5OA 5LTPA 4W73A 4KA9A 3ST4A 2A46A 4TZGA 3CFHA 1Q73A 1EMGA 2HFCA 3GB3A 3SVCA 4KW8A 4W6DA 3DQ2A 4HQCA 4PFEA 5BQLA 3S05A 1QXTA 5H88A 2AWKA 2G5ZB 1YFPA 3H1RA 3SG6A 2A56B 4R6DA 3ED8A 2FZUA 2JADA 3DQAA 4IK4A 4LW5A 4EULA 4W74A 2HGDA 2VADA 3KCTA 2OTEA 2Z6ZA 1RMPA 2H9WA 1HUYA 3CFAA 1ZGQA 4LJDC 2O2BA 4IK8A 4KPIA 3DQHA 2WSOA 1OXFA 4DKMA 1Q4BA 4W6RA 1KYRA 3LA1A 2A50B 2B3PA 4LJCA 4JC2A 4P76A 5AQBB 4W6FA 5EBJA 4KAGA 2GX0A 4JF9A 4Q9XA 1XA9A 3LVCA 4XVPA 3SVEA 5HGEA 5FHVA 2A54B 2WIQA 3BXBA 4DKNA 1C4FA 3EVRA 2Z1OA 3EK4A 5KTGA 4J89A 4H3MA 4W7EA 2A53B 3LVAA 2HCGA 4ZF4A 4W6IA 2QU1A 2QLEA 2Y0GA 4W6AA 4B30B 3SG7A 2G2SB 2PXWA 2EMDA 3AKOA 3SSTA 3P8UA 2QZ0A 1W7SA 5DRGA 3U0MA 1EMLA 1EMBA 4Q7RA 4DXNA 1XAEA 2V4EA 4W6TA 4XOWA 3SVNA 4GOBA 2ZMWA 2FL1A 3UFZA 1EMAA 4W75A 2DUFA 2H5PA 4H3NA 1Z1QA 4DXQA 2G6EA 5DPHA 5T3IA 3MGFA 4W6SA 4NWSA 3SG3A 1XSSA 2FWQA 1F0BA 3NEDA 4XOVA 3DQ1A 3GL4A 1EMFA 3NT3A 5LTRA 2C9JA 5J2OA 3P28A 4KGFA 2WHSA 3RWTA 3PJ7A 2DUEA
chains in the Genus database with same CATH topology
1XMZA 4W6UA 2Q6PA 2GX2A 2POXA 2A48A 3LF3A 4H47A 5EB7A 2GW3A 3U0LA 1RRXA 3DQ4A 3DQMA 4W6LA 2AWMA 3PJBA 2ZO6A 1JBZA 4P1QA 5DQMA 5LTQA 2G3OA 5EB6A 2PXSA 1Q4EA 4PPLA 5FVGA 1MYWA 4ZF5A 2WHTA 1UISA 4HVFA 3SVRA 2H8QA 4AS8A 4UTSA 1GL4A 1RMMA 2GW4B 5HZSA 4ZFSA 4ORNA 3DQCA 5HZOA 2A52B 2IE2A 3ZUJA 4OHSA 4Z4KA 3CGLA 1Q4CA 3ST2A 4EDOA 1KP5A 1YHHA 4PPJA 1B9CA 4W6PA 4RYWA 3IR8A 4JRBA 3U8AA 1RM9A 3E5WA 4HQ8A 3EVVA 4IZNA 3RWAA 3DQNA 3EVPA 3SG5A 3SVUA 1EMCA 3GEXA 4OGSA 2ICRA 1OXDA 1QYQA 2C9IA 3DQFA 3WCKA 4ANJA 3SVOA 4IK9A 3NEZA 3VICA 5BTTA 5DU0A 3EKHA 3VHTA 3DPWA 2QLGA 3O77A 3BXCA 4W72A 3DPXA 1W7UA 3EK7A 4RTCA 3KCSA 1MOUA 2AWJA 3G9AA 1JBYA 3DQ6A 2G6YA 5H89A 3DQ7A 3NF0A 3BXAA 2QRFA 4R6BA 4KW9A 1G7KA 3EKJA 4RYSA 4DXPA 3OSRA 4OQWA 1YZWA 1JC1A 3ADFA 3IP2A 2HPWA 4W69A 2G16B 2G6XA 4W77A 4IK5A 4IK3A 1YJFA 5EJUA 4W6CA 2QLIA 1H4UA 4BDUA 4J8AA 4U2VA 2ZMUA 1Q4DA 1OXEA 5H87A 5DY6A 4H48A 4ZIOA 2O24A 3SVDA 5HW9A 3NT9A 2H6VA 3DQOA 4JEOA 3TMTA 1ZUXA 5HBDA 2Z6YA 3W1CA 1YHGA 4HQ9A 3ZUFA 3AI4A 1QYFA 2HQZA 3OGOA 3DQJA 1QYOA 4EN1A 2ARLA 4DXOA 4N3DA 2QLHA 4OY4A 2V4EC 2V4EB 2OKYA 4PPKA 5FVIA 3ST3A 1Z1PA 5DQBA 4W7AA 3E5TA 2HGYA 3I19A 4TZAA 4ZBLA 2H5RA 3V3DA 3TMRA 2VAEA 3A8SA 5DTLA 4B5YA 3K1KA 2OKWA 4OJ0A 5DPGA 2O29A 1JC0A 2AH8A 3VK1A 3SRYA 2EMOA 4W6HA 1H6RA 4KW4A 5HZTA 5EXBA 2H5QA 3WLCA 4W6GA 4KEXA 5EXCI 3DQEA 3DQUA 4XL5A 4JGEA 4KF5C 5FVFA 2ZO7A 1RMOA 2DD9A 2OJKA 2DD7A 3CD9A 3U8PA 3SSLA 3SSPA 3DQIA 3WLDA 3LVDA 3SS0A 2OTBA 4W6NA 4W6KA 3SSYA 2P4MA 2Q57A 4LJDA 4W7RA 4LJBA 5DPJA 3GJ2A 3PJ5A 4W6MA 3M24A 1Q4AA 3M22A 3W1DA 2VVHA 4W6OA 4JFGA 3SV5A 1EMMA 4ZF3A 2DUHA 4H3LA 3PIBA 4W7DA 3O78A 5EHUA 3SVBA 3U8CA 2AWLA 3DPZA 3ZTFA 1YJ2A 3SSVA 3ST0A 4LQUA 4Q7UA 3ZULA 2VVJA 4EMQA 1KYSA 5DTZA 1GFLA 2YE0A 1BFPA 4KGEA 5F9GA 2YDZA 4Q9WA 3SSKA 2WURA 2BTJA 5HZUA 2IB5A 3SG4A 4AR7A 1KYPA 1ZGOA 1ZGPA 4B30A 3UG0A 1GGXA 3E5VA 2YE1A 3EVUA 4L1IA 2G3DB 1QY3A 3SSHA 4ZINA 3DQLA 4XGYA 3CD1A 2B3QA 4W7XA 4IK1A 3DQ8A 3H1OA 4W7FA 2HJOA 2QT2A 2HRSA 5BTTB 3DQ9A 3U0NA 4GF6B 3VHTB 5DPIA 2QLGB 2OGRA 4HE4A 3LF4B 2VVIA 3DQ5A 3GJ1A 5LK4A 1MOVA 4KF4A 2IB6A 5DTXA 4Q7TA 3LS3A 4DXMA 4EDSA 4DXIA 4LQTA 4W7CA 1HCJA 3SVSA 5EXUA 1XQMA 2HQKA 3AI5A 1EMEA 1CV7A 3SG2A 1YHIA 4W76A 2RH7A 3EK8A 4I2YA 2DUGA 2DDCA 2Z6XA 4L12A 3CBEA 2DUIA 1W7TA 4GESB 3OSQA 3LSAA 1F09A 2WSNA 2WISA 4W6JA 4Z4MA 4L13A 2YFPA 2A47A 2VZXA 3BX9A 2IOVA 5BT0A 3DQDA 3DQKA 1S6ZA 5DTYA 4KF5A 5DRFA 3CFFA 2AHAA 4W6BA 2EMNA 3DQ3A 4J88A 3CB9A 1EMKA 3U0KA 2DDDA 2WHUA 4ZB1A 2H5OA 5LTPA 4W73A 4KA9A 3ST4A 2A46A 4TZGA 3CFHA 1Q73A 1EMGA 2HFCA 3GB3A 3SVCA 4KW8A 4W6DA 3DQ2A 4HQCA 4PFEA 5BQLA 3S05A 1QXTA 5H88A 2AWKA 2G5ZB 1YFPA 3H1RA 3SG6A 2A56B 4R6DA 3ED8A 2FZUA 2JADA 3DQAA 4IK4A 4LW5A 4EULA 4W74A 2HGDA 2VADA 3KCTA 2OTEA 2Z6ZA 1RMPA 2H9WA 1HUYA 3CFAA 1ZGQA 4LJDC 2O2BA 4IK8A 4KPIA 3DQHA 2WSOA 1OXFA 4DKMA 1Q4BA 4W6RA 1KYRA 3LA1A 2A50B 2B3PA 4LJCA 4JC2A 4P76A 5AQBB 4W6FA 5EBJA 4KAGA 2GX0A 4JF9A 4Q9XA 1XA9A 3LVCA 4XVPA 3SVEA 5HGEA 5FHVA 2A54B 2WIQA 3BXBA 4DKNA 1C4FA 3EVRA 2Z1OA 3EK4A 5KTGA 4J89A 4H3MA 4W7EA 2A53B 3LVAA 2HCGA 4ZF4A 4W6IA 2QU1A 2QLEA 2Y0GA 4W6AA 4B30B 3SG7A 2G2SB 2PXWA 2EMDA 3AKOA 3SSTA 3P8UA 2QZ0A 1W7SA 5DRGA 3U0MA 1EMLA 1EMBA 4Q7RA 4DXNA 1XAEA 2V4EA 4W6TA 4XOWA 3SVNA 4GOBA 2ZMWA 2FL1A 3UFZA 1EMAA 4W75A 2DUFA 2H5PA 4H3NA 1Z1QA 4DXQA 2G6EA 5DPHA 5T3IA 3MGFA 4W6SA 4NWSA 3SG3A 1XSSA 2FWQA 1F0BA 3NEDA 4XOVA 3DQ1A 3GL4A 1EMFA 3NT3A 5LTRA 2C9JA 5J2OA 3P28A 4KGFA 2WHSA 3RWTA 3PJ7A 2DUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMZ A;  4W6U A;  2Q6P A;  2GX2 A;  2POX A;  2A48 A;  3LF3 A;  4H47 A;  5EB7 A;  2GW3 A;  3U0L A;  1RRX A;  3DQ4 A;  3DQM A;  4W6L A;  2AWM A;  3PJB A;  2ZO6 A;  1JBZ A;  4P1Q A;  5DQM A;  5LTQ A;  2G3O A;  5EB6 A;  2PXS A;  1Q4E A;  4PPL A;  5FVG A;  1MYW A;  4ZF5 A;  2WHT A;  1UIS A;  4HVF A;  3SVR A;  2H8Q A;  4AS8 A;  4UTS A;  1GL4 A;  1RMM A;  2GW4 B;  5HZS A;  4ZFS A;  4ORN A;  3DQC A;  5HZO A;  2A52 B;  2IE2 A;  3ZUJ A;  4OHS A;  4Z4K A;  3CGL A;  1Q4C A;  3ST2 A;  4EDO A;  1KP5 A;  1YHH A;  4PPJ A;  1B9C A;  4W6P A;  4RYW A;  3IR8 A;  4JRB A;  3U8A A;  1RM9 A;  3E5W A;  4HQ8 A;  3EVV A;  4IZN A;  3RWA A;  3DQN A;  3EVP A;  3SG5 A;  3SVU A;  1EMC A;  3GEX A;  4OGS A;  2ICR A;  1OXD A;  1QYQ A;  2C9I A;  3DQF A;  3WCK A;  4ANJ A;  3SVO A;  4IK9 A;  3NEZ A;  3VIC A;  5BTT A;  5DU0 A;  3EKH A;  3VHT A;  3DPW A;  2QLG A;  3O77 A;  3BXC A;  4W72 A;  3DPX A;  1W7U A;  3EK7 A;  4RTC A;  3KCS A;  1MOU A;  2AWJ A;  3G9A A;  1JBY A;  3DQ6 A;  2G6Y A;  5H89 A;  3DQ7 A;  3NF0 A;  3BXA A;  2QRF A;  4R6B A;  4KW9 A;  1G7K A;  3EKJ A;  4RYS A;  4DXP A;  3OSR A;  4OQW A;  1YZW A;  1JC1 A;  3ADF A;  3IP2 A;  2HPW A;  4W69 A;  2G16 B;  2G6X A;  4W77 A;  4IK5 A;  4IK3 A;  1YJF A;  5EJU A;  4W6C A;  2QLI A;  1H4U A;  4BDU A;  4J8A A;  4U2V A;  2ZMU A;  1Q4D A;  1OXE A;  5H87 A;  5DY6 A;  4H48 A;  4ZIO A;  2O24 A;  3SVD A;  5HW9 A;  3NT9 A;  2H6V A;  3DQO A;  4JEO A;  3TMT A;  1ZUX A;  5HBD A;  2Z6Y A;  3W1C A;  1YHG A;  4HQ9 A;  3ZUF A;  3AI4 A;  1QYF A;  2HQZ A;  3OGO A;  3DQJ A;  1QYO A;  4EN1 A;  2ARL A;  4DXO A;  4N3D A;  2QLH A;  4OY4 A;  2V4E C;  2V4E B;  2OKY A;  4PPK A;  5FVI A;  3ST3 A;  1Z1P A;  5DQB A;  4W7A A;  3E5T A;  2HGY A;  3I19 A;  4TZA A;  4ZBL A;  2H5R A;  3V3D A;  3TMR A;  2VAE A;  3A8S A;  5DTL A;  4B5Y A;  3K1K A;  2OKW A;  4OJ0 A;  5DPG A;  2O29 A;  1JC0 A;  2AH8 A;  3VK1 A;  3SRY A;  2EMO A;  4W6H A;  1H6R A;  4KW4 A;  5HZT A;  5EXB A;  2H5Q A;  3WLC A;  4W6G A;  4KEX A;  5EXC I;  3DQE A;  3DQU A;  4XL5 A;  4JGE A;  4KF5 C;  5FVF A;  2ZO7 A;  1RMO A;  2DD9 A;  2OJK A;  2DD7 A;  3CD9 A;  3U8P A;  3SSL A;  3SSP A;  3DQI A;  3WLD A;  3LVD A;  3SS0 A;  2OTB A;  4W6N A;  4W6K A;  3SSY A;  2P4M A;  2Q57 A;  4LJD A;  4W7R A;  4LJB A;  5DPJ A;  3GJ2 A;  3PJ5 A;  4W6M A;  3M24 A;  1Q4A A;  3M22 A;  3W1D A;  2VVH A;  4W6O A;  4JFG A;  3SV5 A;  1EMM A;  4ZF3 A;  2DUH A;  4H3L A;  3PIB A;  4W7D A;  3O78 A;  5EHU A;  3SVB A;  3U8C A;  2AWL A;  3DPZ A;  3ZTF A;  1YJ2 A;  3SSV A;  3ST0 A;  4LQU A;  4Q7U A;  3ZUL A;  2VVJ A;  4EMQ A;  1KYS A;  5DTZ A;  1GFL A;  2YE0 A;  1BFP A;  4KGE A;  5F9G A;  2YDZ A;  4Q9W A;  3SSK A;  2WUR A;  2BTJ A;  5HZU A;  2IB5 A;  3SG4 A;  4AR7 A;  1KYP A;  1ZGO A;  1ZGP A;  4B30 A;  3UG0 A;  1GGX A;  3E5V A;  2YE1 A;  3EVU A;  4L1I A;  2G3D B;  1QY3 A;  3SSH A;  4ZIN A;  3DQL A;  4XGY A;  3CD1 A;  2B3Q A;  4W7X A;  4IK1 A;  3DQ8 A;  3H1O A;  4W7F A;  2HJO A;  2QT2 A;  2HRS A;  5BTT B;  3DQ9 A;  3U0N A;  4GF6 B;  3VHT B;  5DPI A;  2QLG B;  2OGR A;  4HE4 A;  3LF4 B;  2VVI A;  3DQ5 A;  3GJ1 A;  5LK4 A;  1MOV A;  4KF4 A;  2IB6 A;  5DTX A;  4Q7T A;  3LS3 A;  4DXM A;  4EDS A;  4DXI A;  4LQT A;  4W7C A;  1HCJ A;  3SVS A;  5EXU A;  1XQM A;  2HQK A;  3AI5 A;  1EME A;  1CV7 A;  3SG2 A;  1YHI A;  4W76 A;  2RH7 A;  3EK8 A;  4I2Y A;  2DUG A;  2DDC A;  2Z6X A;  4L12 A;  3CBE A;  2DUI A;  1W7T A;  4GES B;  3OSQ A;  3LSA A;  1F09 A;  2WSN A;  2WIS A;  4W6J A;  4Z4M A;  4L13 A;  2YFP A;  2A47 A;  2VZX A;  3BX9 A;  2IOV A;  5BT0 A;  3DQD A;  3DQK A;  1S6Z A;  5DTY A;  4KF5 A;  5DRF A;  3CFF A;  2AHA A;  4W6B A;  2EMN A;  3DQ3 A;  4J88 A;  3CB9 A;  1EMK A;  3U0K A;  2DDD A;  2WHU A;  4ZB1 A;  2H5O A;  5LTP A;  4W73 A;  4KA9 A;  3ST4 A;  2A46 A;  4TZG A;  3CFH A;  1Q73 A;  1EMG A;  2HFC A;  3GB3 A;  3SVC A;  4KW8 A;  4W6D A;  3DQ2 A;  4HQC A;  4PFE A;  5BQL A;  3S05 A;  1QXT A;  5H88 A;  2AWK A;  2G5Z B;  1YFP A;  3H1R A;  3SG6 A;  2A56 B;  4R6D A;  3ED8 A;  2FZU A;  2JAD A;  3DQA A;  4IK4 A;  4LW5 A;  4EUL A;  4W74 A;  2HGD A;  2VAD A;  3KCT A;  2OTE A;  2Z6Z A;  1RMP A;  2H9W A;  1HUY A;  3CFA A;  1ZGQ A;  4LJD C;  2O2B A;  4IK8 A;  4KPI A;  3DQH A;  2WSO A;  1OXF A;  4DKM A;  1Q4B A;  4W6R A;  1KYR A;  3LA1 A;  2A50 B;  2B3P A;  4LJC A;  4JC2 A;  4P76 A;  5AQB B;  4W6F A;  5EBJ A;  4KAG A;  2GX0 A;  4JF9 A;  4Q9X A;  1XA9 A;  3LVC A;  4XVP A;  3SVE A;  5HGE A;  5FHV A;  2A54 B;  2WIQ A;  3BXB A;  4DKN A;  1C4F A;  3EVR A;  2Z1O A;  3EK4 A;  5KTG A;  4J89 A;  4H3M A;  4W7E A;  2A53 B;  3LVA A;  2HCG A;  4ZF4 A;  4W6I A;  2QU1 A;  2QLE A;  2Y0G A;  4W6A A;  4B30 B;  3SG7 A;  2G2S B;  2PXW A;  2EMD A;  3AKO A;  3SST A;  3P8U A;  2QZ0 A;  1W7S A;  5DRG A;  3U0M A;  1EML A;  1EMB A;  4Q7R A;  4DXN A;  1XAE A;  2V4E A;  4W6T A;  4XOW A;  3SVN A;  4GOB A;  2ZMW A;  2FL1 A;  3UFZ A;  1EMA A;  4W75 A;  2DUF A;  2H5P A;  4H3N A;  1Z1Q A;  4DXQ A;  2G6E A;  5DPH A;  5T3I A;  3MGF A;  4W6S A;  4NWS A;  3SG3 A;  1XSS A;  2FWQ A;  1F0B A;  3NED A;  4XOV A;  3DQ1 A;  3GL4 A;  1EMF A;  3NT3 A;  5LTR A;  2C9J A;  5J2O A;  3P28 A;  4KGF A;  2WHS A;  3RWT A;  3PJ7 A;  2DUE A; 
#chains in the Genus database with same CATH topology
 1XMZ A;  4W6U A;  2Q6P A;  2GX2 A;  2POX A;  2A48 A;  3LF3 A;  4H47 A;  5EB7 A;  2GW3 A;  3U0L A;  1RRX A;  3DQ4 A;  3DQM A;  4W6L A;  2AWM A;  3PJB A;  2ZO6 A;  1JBZ A;  4P1Q A;  5DQM A;  5LTQ A;  2G3O A;  5EB6 A;  2PXS A;  1Q4E A;  4PPL A;  5FVG A;  1MYW A;  4ZF5 A;  2WHT A;  1UIS A;  4HVF A;  3SVR A;  2H8Q A;  4AS8 A;  4UTS A;  1GL4 A;  1RMM A;  2GW4 B;  5HZS A;  4ZFS A;  4ORN A;  3DQC A;  5HZO A;  2A52 B;  2IE2 A;  3ZUJ A;  4OHS A;  4Z4K A;  3CGL A;  1Q4C A;  3ST2 A;  4EDO A;  1KP5 A;  1YHH A;  4PPJ A;  1B9C A;  4W6P A;  4RYW A;  3IR8 A;  4JRB A;  3U8A A;  1RM9 A;  3E5W A;  4HQ8 A;  3EVV A;  4IZN A;  3RWA A;  3DQN A;  3EVP A;  3SG5 A;  3SVU A;  1EMC A;  3GEX A;  4OGS A;  2ICR A;  1OXD A;  1QYQ A;  2C9I A;  3DQF A;  3WCK A;  4ANJ A;  3SVO A;  4IK9 A;  3NEZ A;  3VIC A;  5BTT A;  5DU0 A;  3EKH A;  3VHT A;  3DPW A;  2QLG A;  3O77 A;  3BXC A;  4W72 A;  3DPX A;  1W7U A;  3EK7 A;  4RTC A;  3KCS A;  1MOU A;  2AWJ A;  3G9A A;  1JBY A;  3DQ6 A;  2G6Y A;  5H89 A;  3DQ7 A;  3NF0 A;  3BXA A;  2QRF A;  4R6B A;  4KW9 A;  1G7K A;  3EKJ A;  4RYS A;  4DXP A;  3OSR A;  4OQW A;  1YZW A;  1JC1 A;  3ADF A;  3IP2 A;  2HPW A;  4W69 A;  2G16 B;  2G6X A;  4W77 A;  4IK5 A;  4IK3 A;  1YJF A;  5EJU A;  4W6C A;  2QLI A;  1H4U A;  4BDU A;  4J8A A;  4U2V A;  2ZMU A;  1Q4D A;  1OXE A;  5H87 A;  5DY6 A;  4H48 A;  4ZIO A;  2O24 A;  3SVD A;  5HW9 A;  3NT9 A;  2H6V A;  3DQO A;  4JEO A;  3TMT A;  1ZUX A;  5HBD A;  2Z6Y A;  3W1C A;  1YHG A;  4HQ9 A;  3ZUF A;  3AI4 A;  1QYF A;  2HQZ A;  3OGO A;  3DQJ A;  1QYO A;  4EN1 A;  2ARL A;  4DXO A;  4N3D A;  2QLH A;  4OY4 A;  2V4E C;  2V4E B;  2OKY A;  4PPK A;  5FVI A;  3ST3 A;  1Z1P A;  5DQB A;  4W7A A;  3E5T A;  2HGY A;  3I19 A;  4TZA A;  4ZBL A;  2H5R A;  3V3D A;  3TMR A;  2VAE A;  3A8S A;  5DTL A;  4B5Y A;  3K1K A;  2OKW A;  4OJ0 A;  5DPG A;  2O29 A;  1JC0 A;  2AH8 A;  3VK1 A;  3SRY A;  2EMO A;  4W6H A;  1H6R A;  4KW4 A;  5HZT A;  5EXB A;  2H5Q A;  3WLC A;  4W6G A;  4KEX A;  5EXC I;  3DQE A;  3DQU A;  4XL5 A;  4JGE A;  4KF5 C;  5FVF A;  2ZO7 A;  1RMO A;  2DD9 A;  2OJK A;  2DD7 A;  3CD9 A;  3U8P A;  3SSL A;  3SSP A;  3DQI A;  3WLD A;  3LVD A;  3SS0 A;  2OTB A;  4W6N A;  4W6K A;  3SSY A;  2P4M A;  2Q57 A;  4LJD A;  4W7R A;  4LJB A;  5DPJ A;  3GJ2 A;  3PJ5 A;  4W6M A;  3M24 A;  1Q4A A;  3M22 A;  3W1D A;  2VVH A;  4W6O A;  4JFG A;  3SV5 A;  1EMM A;  4ZF3 A;  2DUH A;  4H3L A;  3PIB A;  4W7D A;  3O78 A;  5EHU A;  3SVB A;  3U8C A;  2AWL A;  3DPZ A;  3ZTF A;  1YJ2 A;  3SSV A;  3ST0 A;  4LQU A;  4Q7U A;  3ZUL A;  2VVJ A;  4EMQ A;  1KYS A;  5DTZ A;  1GFL A;  2YE0 A;  1BFP A;  4KGE A;  5F9G A;  2YDZ A;  4Q9W A;  3SSK A;  2WUR A;  2BTJ A;  5HZU A;  2IB5 A;  3SG4 A;  4AR7 A;  1KYP A;  1ZGO A;  1ZGP A;  4B30 A;  3UG0 A;  1GGX A;  3E5V A;  2YE1 A;  3EVU A;  4L1I A;  2G3D B;  1QY3 A;  3SSH A;  4ZIN A;  3DQL A;  4XGY A;  3CD1 A;  2B3Q A;  4W7X A;  4IK1 A;  3DQ8 A;  3H1O A;  4W7F A;  2HJO A;  2QT2 A;  2HRS A;  5BTT B;  3DQ9 A;  3U0N A;  4GF6 B;  3VHT B;  5DPI A;  2QLG B;  2OGR A;  4HE4 A;  3LF4 B;  2VVI A;  3DQ5 A;  3GJ1 A;  5LK4 A;  1MOV A;  4KF4 A;  2IB6 A;  5DTX A;  4Q7T A;  3LS3 A;  4DXM A;  4EDS A;  4DXI A;  4LQT A;  4W7C A;  1HCJ A;  3SVS A;  5EXU A;  1XQM A;  2HQK A;  3AI5 A;  1EME A;  1CV7 A;  3SG2 A;  1YHI A;  4W76 A;  2RH7 A;  3EK8 A;  4I2Y A;  2DUG A;  2DDC A;  2Z6X A;  4L12 A;  3CBE A;  2DUI A;  1W7T A;  4GES B;  3OSQ A;  3LSA A;  1F09 A;  2WSN A;  2WIS A;  4W6J A;  4Z4M A;  4L13 A;  2YFP A;  2A47 A;  2VZX A;  3BX9 A;  2IOV A;  5BT0 A;  3DQD A;  3DQK A;  1S6Z A;  5DTY A;  4KF5 A;  5DRF A;  3CFF A;  2AHA A;  4W6B A;  2EMN A;  3DQ3 A;  4J88 A;  3CB9 A;  1EMK A;  3U0K A;  2DDD A;  2WHU A;  4ZB1 A;  2H5O A;  5LTP A;  4W73 A;  4KA9 A;  3ST4 A;  2A46 A;  4TZG A;  3CFH A;  1Q73 A;  1EMG A;  2HFC A;  3GB3 A;  3SVC A;  4KW8 A;  4W6D A;  3DQ2 A;  4HQC A;  4PFE A;  5BQL A;  3S05 A;  1QXT A;  5H88 A;  2AWK A;  2G5Z B;  1YFP A;  3H1R A;  3SG6 A;  2A56 B;  4R6D A;  3ED8 A;  2FZU A;  2JAD A;  3DQA A;  4IK4 A;  4LW5 A;  4EUL A;  4W74 A;  2HGD A;  2VAD A;  3KCT A;  2OTE A;  2Z6Z A;  1RMP A;  2H9W A;  1HUY A;  3CFA A;  1ZGQ A;  4LJD C;  2O2B A;  4IK8 A;  4KPI A;  3DQH A;  2WSO A;  1OXF A;  4DKM A;  1Q4B A;  4W6R A;  1KYR A;  3LA1 A;  2A50 B;  2B3P A;  4LJC A;  4JC2 A;  4P76 A;  5AQB B;  4W6F A;  5EBJ A;  4KAG A;  2GX0 A;  4JF9 A;  4Q9X A;  1XA9 A;  3LVC A;  4XVP A;  3SVE A;  5HGE A;  5FHV A;  2A54 B;  2WIQ A;  3BXB A;  4DKN A;  1C4F A;  3EVR A;  2Z1O A;  3EK4 A;  5KTG A;  4J89 A;  4H3M A;  4W7E A;  2A53 B;  3LVA A;  2HCG A;  4ZF4 A;  4W6I A;  2QU1 A;  2QLE A;  2Y0G A;  4W6A A;  4B30 B;  3SG7 A;  2G2S B;  2PXW A;  2EMD A;  3AKO A;  3SST A;  3P8U A;  2QZ0 A;  1W7S A;  5DRG A;  3U0M A;  1EML A;  1EMB A;  4Q7R A;  4DXN A;  1XAE A;  2V4E A;  4W6T A;  4XOW A;  3SVN A;  4GOB A;  2ZMW A;  2FL1 A;  3UFZ A;  1EMA A;  4W75 A;  2DUF A;  2H5P A;  4H3N A;  1Z1Q A;  4DXQ A;  2G6E A;  5DPH A;  5T3I A;  3MGF A;  4W6S A;  4NWS A;  3SG3 A;  1XSS A;  2FWQ A;  1F0B A;  3NED A;  4XOV A;  3DQ1 A;  3GL4 A;  1EMF A;  3NT3 A;  5LTR A;  2C9J A;  5J2O A;  3P28 A;  4KGF A;  2WHS A;  3RWT A;  3PJ7 A;  2DUE A; 
#chains in the Genus database with same CATH homology
 1XMZ A;  4W6U A;  2Q6P A;  2GX2 A;  2POX A;  2A48 A;  3LF3 A;  4H47 A;  5EB7 A;  2GW3 A;  3U0L A;  1RRX A;  3DQ4 A;  3DQM A;  4W6L A;  2AWM A;  3PJB A;  2ZO6 A;  1JBZ A;  4P1Q A;  5DQM A;  5LTQ A;  2G3O A;  5EB6 A;  2PXS A;  1Q4E A;  4PPL A;  5FVG A;  1MYW A;  4ZF5 A;  2WHT A;  1UIS A;  4HVF A;  3SVR A;  2H8Q A;  4AS8 A;  4UTS A;  1GL4 A;  1RMM A;  2GW4 B;  5HZS A;  4ZFS A;  4ORN A;  3DQC A;  5HZO A;  2A52 B;  2IE2 A;  3ZUJ A;  4OHS A;  4Z4K A;  3CGL A;  1Q4C A;  3ST2 A;  4EDO A;  1KP5 A;  1YHH A;  4PPJ A;  1B9C A;  4W6P A;  4RYW A;  3IR8 A;  4JRB A;  3U8A A;  1RM9 A;  3E5W A;  4HQ8 A;  3EVV A;  4IZN A;  3RWA A;  3DQN A;  3EVP A;  3SG5 A;  3SVU A;  1EMC A;  3GEX A;  4OGS A;  2ICR A;  1OXD A;  1QYQ A;  2C9I A;  3DQF A;  3WCK A;  4ANJ A;  3SVO A;  4IK9 A;  3NEZ A;  3VIC A;  5BTT A;  5DU0 A;  3EKH A;  3VHT A;  3DPW A;  2QLG A;  3O77 A;  3BXC A;  4W72 A;  3DPX A;  1W7U A;  3EK7 A;  4RTC A;  3KCS A;  1MOU A;  2AWJ A;  3G9A A;  1JBY A;  3DQ6 A;  2G6Y A;  5H89 A;  3DQ7 A;  3NF0 A;  3BXA A;  2QRF A;  4R6B A;  4KW9 A;  1G7K A;  3EKJ A;  4RYS A;  4DXP A;  3OSR A;  4OQW A;  1YZW A;  1JC1 A;  3ADF A;  3IP2 A;  2HPW A;  4W69 A;  2G16 B;  2G6X A;  4W77 A;  4IK5 A;  4IK3 A;  1YJF A;  5EJU A;  4W6C A;  2QLI A;  1H4U A;  4BDU A;  4J8A A;  4U2V A;  2ZMU A;  1Q4D A;  1OXE A;  5H87 A;  5DY6 A;  4H48 A;  4ZIO A;  2O24 A;  3SVD A;  5HW9 A;  3NT9 A;  2H6V A;  3DQO A;  4JEO A;  3TMT A;  1ZUX A;  5HBD A;  2Z6Y A;  3W1C A;  1YHG A;  4HQ9 A;  3ZUF A;  3AI4 A;  1QYF A;  2HQZ A;  3OGO A;  3DQJ A;  1QYO A;  4EN1 A;  2ARL A;  4DXO A;  4N3D A;  2QLH A;  4OY4 A;  2V4E C;  2V4E B;  2OKY A;  4PPK A;  5FVI A;  3ST3 A;  1Z1P A;  5DQB A;  4W7A A;  3E5T A;  2HGY A;  3I19 A;  4TZA A;  4ZBL A;  2H5R A;  3V3D A;  3TMR A;  2VAE A;  3A8S A;  5DTL A;  4B5Y A;  3K1K A;  2OKW A;  4OJ0 A;  5DPG A;  2O29 A;  1JC0 A;  2AH8 A;  3VK1 A;  3SRY A;  2EMO A;  4W6H A;  1H6R A;  4KW4 A;  5HZT A;  5EXB A;  2H5Q A;  3WLC A;  4W6G A;  4KEX A;  5EXC I;  3DQE A;  3DQU A;  4XL5 A;  4JGE A;  4KF5 C;  5FVF A;  2ZO7 A;  1RMO A;  2DD9 A;  2OJK A;  2DD7 A;  3CD9 A;  3U8P A;  3SSL A;  3SSP A;  3DQI A;  3WLD A;  3LVD A;  3SS0 A;  2OTB A;  4W6N A;  4W6K A;  3SSY A;  2P4M A;  2Q57 A;  4LJD A;  4W7R A;  4LJB A;  5DPJ A;  3GJ2 A;  3PJ5 A;  4W6M A;  3M24 A;  1Q4A A;  3M22 A;  3W1D A;  2VVH A;  4W6O A;  4JFG A;  3SV5 A;  1EMM A;  4ZF3 A;  2DUH A;  4H3L A;  3PIB A;  4W7D A;  3O78 A;  5EHU A;  3SVB A;  3U8C A;  2AWL A;  3DPZ A;  3ZTF A;  1YJ2 A;  3SSV A;  3ST0 A;  4LQU A;  4Q7U A;  3ZUL A;  2VVJ A;  4EMQ A;  1KYS A;  5DTZ A;  1GFL A;  2YE0 A;  1BFP A;  4KGE A;  5F9G A;  2YDZ A;  4Q9W A;  3SSK A;  2WUR A;  2BTJ A;  5HZU A;  2IB5 A;  3SG4 A;  4AR7 A;  1KYP A;  1ZGO A;  1ZGP A;  4B30 A;  3UG0 A;  1GGX A;  3E5V A;  2YE1 A;  3EVU A;  4L1I A;  2G3D B;  1QY3 A;  3SSH A;  4ZIN A;  3DQL A;  4XGY A;  3CD1 A;  2B3Q A;  4W7X A;  4IK1 A;  3DQ8 A;  3H1O A;  4W7F A;  2HJO A;  2QT2 A;  2HRS A;  5BTT B;  3DQ9 A;  3U0N A;  4GF6 B;  3VHT B;  5DPI A;  2QLG B;  2OGR A;  4HE4 A;  3LF4 B;  2VVI A;  3DQ5 A;  3GJ1 A;  5LK4 A;  1MOV A;  4KF4 A;  2IB6 A;  5DTX A;  4Q7T A;  3LS3 A;  4DXM A;  4EDS A;  4DXI A;  4LQT A;  4W7C A;  1HCJ A;  3SVS A;  5EXU A;  1XQM A;  2HQK A;  3AI5 A;  1EME A;  1CV7 A;  3SG2 A;  1YHI A;  4W76 A;  2RH7 A;  3EK8 A;  4I2Y A;  2DUG A;  2DDC A;  2Z6X A;  4L12 A;  3CBE A;  2DUI A;  1W7T A;  4GES B;  3OSQ A;  3LSA A;  1F09 A;  2WSN A;  2WIS A;  4W6J A;  4Z4M A;  4L13 A;  2YFP A;  2A47 A;  2VZX A;  3BX9 A;  2IOV A;  5BT0 A;  3DQD A;  3DQK A;  1S6Z A;  5DTY A;  4KF5 A;  5DRF A;  3CFF A;  2AHA A;  4W6B A;  2EMN A;  3DQ3 A;  4J88 A;  3CB9 A;  1EMK A;  3U0K A;  2DDD A;  2WHU A;  4ZB1 A;  2H5O A;  5LTP A;  4W73 A;  4KA9 A;  3ST4 A;  2A46 A;  4TZG A;  3CFH A;  1Q73 A;  1EMG A;  2HFC A;  3GB3 A;  3SVC A;  4KW8 A;  4W6D A;  3DQ2 A;  4HQC A;  4PFE A;  5BQL A;  3S05 A;  1QXT A;  5H88 A;  2AWK A;  2G5Z B;  1YFP A;  3H1R A;  3SG6 A;  2A56 B;  4R6D A;  3ED8 A;  2FZU A;  2JAD A;  3DQA A;  4IK4 A;  4LW5 A;  4EUL A;  4W74 A;  2HGD A;  2VAD A;  3KCT A;  2OTE A;  2Z6Z A;  1RMP A;  2H9W A;  1HUY A;  3CFA A;  1ZGQ A;  4LJD C;  2O2B A;  4IK8 A;  4KPI A;  3DQH A;  2WSO A;  1OXF A;  4DKM A;  1Q4B A;  4W6R A;  1KYR A;  3LA1 A;  2A50 B;  2B3P A;  4LJC A;  4JC2 A;  4P76 A;  5AQB B;  4W6F A;  5EBJ A;  4KAG A;  2GX0 A;  4JF9 A;  4Q9X A;  1XA9 A;  3LVC A;  4XVP A;  3SVE A;  5HGE A;  5FHV A;  2A54 B;  2WIQ A;  3BXB A;  4DKN A;  1C4F A;  3EVR A;  2Z1O A;  3EK4 A;  5KTG A;  4J89 A;  4H3M A;  4W7E A;  2A53 B;  3LVA A;  2HCG A;  4ZF4 A;  4W6I A;  2QU1 A;  2QLE A;  2Y0G A;  4W6A A;  4B30 B;  3SG7 A;  2G2S B;  2PXW A;  2EMD A;  3AKO A;  3SST A;  3P8U A;  2QZ0 A;  1W7S A;  5DRG A;  3U0M A;  1EML A;  1EMB A;  4Q7R A;  4DXN A;  1XAE A;  2V4E A;  4W6T A;  4XOW A;  3SVN A;  4GOB A;  2ZMW A;  2FL1 A;  3UFZ A;  1EMA A;  4W75 A;  2DUF A;  2H5P A;  4H3N A;  1Z1Q A;  4DXQ A;  2G6E A;  5DPH A;  5T3I A;  3MGF A;  4W6S A;  4NWS A;  3SG3 A;  1XSS A;  2FWQ A;  1F0B A;  3NED A;  4XOV A;  3DQ1 A;  3GL4 A;  1EMF A;  3NT3 A;  5LTR A;  2C9J A;  5J2O A;  3P28 A;  4KGF A;  2WHS A;  3RWT A;  3PJ7 A;  2DUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...